Phosphoacetylglucosamine mutase

Overview
NamePhosphoacetylglucosamine mutase
Smed IDSMED30012839
Length (bp)1691
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoacetylglucosamine mutase (SMED30012839) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoacetylglucosamine mutase (SMED30012839) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoacetylglucosamine mutase (SMED30012839) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoacetylglucosamine mutase (SMED30012839) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012839

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012839h1SMcG0013780 Contig3655newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012839h1SMcG0013780 Contig3655uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012839h1SMcG0013984 Contig3655newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012839h1SMcG0013984 Contig3655uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30012839h1SMcG0013780 dd_Smed_v4_7502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012839h1SMcG0013780 dd_Smed_v4_7502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012839h1SMcG0013780 dd_Smed_v4_7502_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012839h1SMcG0013780 dd_Smed_v4_8460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012839h1SMcG0013780 dd_Smed_v4_8460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30012839h1SMcG0013780 dd_Smed_v4_7502_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Human
Match: PGM3 (phosphoglucomutase 3 [Source:HGNC Symbol;Acc:HGNC:8907])

HSP 1 Score: 389.037 bits (998), Expect = 9.269e-129
Identity = 225/520 (43.27%), Postives = 307/520 (59.04%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFC-MNKSNS---EAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNH-FSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSE----KLRNYAALLTHNNE-----LCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSI 1620
            L YGTAG+R  +++L+    RM  LA +RS     T+G+M+TASHNPE DNG+KLVDP GEML   WE  A         +   + +   S+ K  +N +    V+IG DTR SS  L++     +  +G ++  +  +TTPQLH+ V  Y  N    Y   T E Y++KLS AF  + K  S   +    L VDCANG+GA  L  +    S+ L+++L N  S+  LN  CGAD VK  Q  P        E+    R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L   +E+    ++ ++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGT LFS     K++  A  L          L   I++ N+A GDAISD+L+IE IL+++   ++ W  LYTD P+RQLKV V DR V  TTDAER+  +P  LQ AI     N L   +K SRAFVRPSGTED+VR+Y E+ +QE+AD LAH +
Sbjct:   21 LQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVMVTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLAN-AEEQDMQRVLIDISE-KEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMV--YCRNTGGRYGKATIEGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKLREMEHYFSQGLSVQLFNDGSKGKLNHLCGADFVKSHQKPP-----QGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDKIATLISSFLKELL---VEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAISDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTDAERQAVTPPGLQEAI-----NDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQESADHLAHEV 523          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Human
Match: PGM3 (phosphoglucomutase 3 [Source:HGNC Symbol;Acc:HGNC:8907])

HSP 1 Score: 388.652 bits (997), Expect = 2.268e-128
Identity = 225/520 (43.27%), Postives = 307/520 (59.04%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFC-MNKSNS---EAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNH-FSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSE----KLRNYAALLTHNNE-----LCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSI 1620
            L YGTAG+R  +++L+    RM  LA +RS     T+G+M+TASHNPE DNG+KLVDP GEML   WE  A         +   + +   S+ K  +N +    V+IG DTR SS  L++     +  +G ++  +  +TTPQLH+ V  Y  N    Y   T E Y++KLS AF  + K  S   +    L VDCANG+GA  L  +    S+ L+++L N  S+  LN  CGAD VK  Q  P        E+    R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L   +E+    ++ ++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGT LFS     K++  A  L          L   I++ N+A GDAISD+L+IE IL+++   ++ W  LYTD P+RQLKV V DR V  TTDAER+  +P  LQ AI     N L   +K SRAFVRPSGTED+VR+Y E+ +QE+AD LAH +
Sbjct:   21 LQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVMVTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLAN-AEEQDMQRVLIDISE-KEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMV--YCRNTGGRYGKATIEGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKLREMEHYFSQGLSVQLFNDGSKGKLNHLCGADFVKSHQKPP-----QGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDKIATLISSFLKELL---VEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAISDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTDAERQAVTPPGLQEAI-----NDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQESADHLAHEV 523          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Human
Match: PGM3 (phosphoglucomutase 3 [Source:HGNC Symbol;Acc:HGNC:8907])

HSP 1 Score: 388.267 bits (996), Expect = 3.940e-128
Identity = 225/520 (43.27%), Postives = 307/520 (59.04%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFC-MNKSNS---EAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNH-FSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSE----KLRNYAALLTHNNE-----LCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSI 1620
            L YGTAG+R  +++L+    RM  LA +RS     T+G+M+TASHNPE DNG+KLVDP GEML   WE  A         +   + +   S+ K  +N +    V+IG DTR SS  L++     +  +G ++  +  +TTPQLH+ V  Y  N    Y   T E Y++KLS AF  + K  S   +    L VDCANG+GA  L  +    S+ L+++L N  S+  LN  CGAD VK  Q  P        E+    R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L   +E+    ++ ++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGT LFS     K++  A  L          L   I++ N+A GDAISD+L+IE IL+++   ++ W  LYTD P+RQLKV V DR V  TTDAER+  +P  LQ AI     N L   +K SRAFVRPSGTED+VR+Y E+ +QE+AD LAH +
Sbjct:   49 LQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVMVTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLAN-AEEQDMQRVLIDISE-KEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMV--YCRNTGGRYGKATIEGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKLREMEHYFSQGLSVQLFNDGSKGKLNHLCGADFVKSHQKPP-----QGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDKIATLISSFLKELL---VEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAISDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTDAERQAVTPPGLQEAI-----NDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQESADHLAHEV 551          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Human
Match: PGM3 (phosphoglucomutase 3 [Source:HGNC Symbol;Acc:HGNC:8907])

HSP 1 Score: 374.015 bits (959), Expect = 1.032e-122
Identity = 219/510 (42.94%), Postives = 299/510 (58.63%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFC-MNKSNS---EAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNH-FSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSE----KLRNYAALLTHNNE-----LCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQ 1590
            L YGTAG+R  +++L+    RM  LA +RS     T+G+M+TASHNPE DNG+KLVDP GEML   WE  A         +   + +   S+ K  +N +    V+IG DTR SS  L++     +  +G ++  +  +TTPQLH+ V  Y  N    Y   T E Y++KLS AF  + K  S   +    L VDCANG+GA  L  +    S+ L+++L N  S+  LN  CGAD VK  Q  P        E+    R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L   +E+    ++ ++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGT LFS     K++  A  L          L   I++ N+A GDAISD+L+IE IL+++   ++ W  LYTD P+RQLKV V DR V  TTDAER+  +P  LQ AI     N L   +K SRAFVRPSGTED+VR+Y E+ +Q
Sbjct:   21 LQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVMVTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLAN-AEEQDMQRVLIDISE-KEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMV--YCRNTGGRYGKATIEGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKLREMEHYFSQGLSVQLFNDGSKGKLNHLCGADFVKSHQKPP-----QGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDKIATLISSFLKELL---VEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAISDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTDAERQAVTPPGLQEAI-----NDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQ 513          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Human
Match: PGM3 (phosphoglucomutase 3 [Source:HGNC Symbol;Acc:HGNC:8907])

HSP 1 Score: 374.015 bits (959), Expect = 1.032e-122
Identity = 219/510 (42.94%), Postives = 299/510 (58.63%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFC-MNKSNS---EAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNH-FSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSE----KLRNYAALLTHNNE-----LCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQ 1590
            L YGTAG+R  +++L+    RM  LA +RS     T+G+M+TASHNPE DNG+KLVDP GEML   WE  A         +   + +   S+ K  +N +    V+IG DTR SS  L++     +  +G ++  +  +TTPQLH+ V  Y  N    Y   T E Y++KLS AF  + K  S   +    L VDCANG+GA  L  +    S+ L+++L N  S+  LN  CGAD VK  Q  P        E+    R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L   +E+    ++ ++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGT LFS     K++  A  L          L   I++ N+A GDAISD+L+IE IL+++   ++ W  LYTD P+RQLKV V DR V  TTDAER+  +P  LQ AI     N L   +K SRAFVRPSGTED+VR+Y E+ +Q
Sbjct:   21 LQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVMVTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLAN-AEEQDMQRVLIDISE-KEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMV--YCRNTGGRYGKATIEGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKLREMEHYFSQGLSVQLFNDGSKGKLNHLCGADFVKSHQKPP-----QGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDKIATLISSFLKELL---VEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAISDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTDAERQAVTPPGLQEAI-----NDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQ 513          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Celegans
Match: F21D5.1 (Phosphoacetylglucosamine mutase [Source:UniProtKB/TrEMBL;Acc:Q19680])

HSP 1 Score: 353.984 bits (907), Expect = 1.676e-115
Identity = 208/539 (38.59%), Postives = 298/539 (55.29%), Query Frame = 1
Query:   76 NSNDIHDSFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEHYFEKLSSAFCMNKSNSEAP------PVLNVDCANGVGAKHLERL-SKLVSKQLNLKLHNISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSI-----NHLNQMQLFDGDKIAVLMADYLTDILK---TELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSE----KLRNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWS-VLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLI 1632
            N + I D  K   YGTAG+R  S+ L     R +++A++R+      +G+MITASHNP CDNG+KLVDP G+ML  +WE  A E V    +E       +  + ++ +       V+ G DTR S P L     +       ++     ++TP LH+ VK +NE          + Y+  ++ +F      +E P      P + VDCANGVGA     L  ++ S  L ++  N S+E LN  CGAD VKI Q +P   +   +E     +  S DGDADR++YF       +  N  +LFDGDKIAVL+  Y+ + LK       +    + I+QTAYAN +ST YI  +L I+   VPTGVK+LH+AA ++DIGIYFEANGHGTV+FSE     +R           L  F  +INE  GDA +DLL +E +L    W ++ W+  LY D P+ Q+KV V DR++F TT+AE+ L  P+ +Q  ID  +       + +SRAF+RPSGTE+IVR+Y E+   E   +L  S+E+++
Sbjct:   20 NVHAIQDDEK-FSYGTAGFRFKSEKLPFIVFRCAYVASLRARQLNSAIGVMITASHNPSCDNGVKLVDPSGDMLNEQWEIYATEVVNATDAEL--PAAVRALEKQISVGKTQLSRVVCGMDTRCSGPCLMNAARAGAALFNVQFDDIGVVSTPMLHYAVKAFNEP--KFAEPTHDGYYSAIADSFKKLYEITEEPKDSRYQPKVIVDCANGVGAPRFRNLLERIPSSLLEVEFRNESEE-LNQGCGADFVKISQKLPANFSPTAAE----PKCASFDGDADRLMYFRAKASENSESNDAELFDGDKIAVLIVTYIREQLKDYENSTPMERLRLGIVQTAYANGSSTRYIREKLGIEPIIVPTGVKHLHEAASEFDIGIYFEANGHGTVVFSEIFDRIIRRTPTESLPLRRLALFSRVINETVGDAFADLLAVEAVLRHYGWSMDDWAEKLYRDVPNVQIKVPVIDRSIFKTTNAEQTLVKPVGIQKMIDTDVAK-----YNNSRAFIRPSGTENIVRVYAEADTVENTLQLGKSLEQVV 543          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Fly
Match: nst (gene:FBgn0036298 transcript:FBtr0075967)

HSP 1 Score: 398.667 bits (1023), Expect = 9.775e-133
Identity = 222/527 (42.13%), Postives = 312/527 (59.20%), Query Frame = 1
Query:   97 SFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTV-GIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEH-YFEKLSSAFCMNKS----NSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN--ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNE----LCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEM 1641
            S + + YGTAG+R  +++L+    RM  LA +RS Y+  +V G+MITASHNPE DNG+KLVDP GEML   WE IA + V     E   +      D  +D+ +  +  V +G D R  SP L +     +  +      +  +TTP LH+FV     N    Y   TE  Y++KL  AF + ++    N      +  D ANGVGA+ + +  K +   LN+ + N  I    +N DCGAD+VK++QS P     D     P +R  S+DGDADR+VYF  +   +  L DGD+IA L+A YL +++ T+ E++   + ++QTAYAN AST+YI +QLK    CVPTGVK+LH  A +YDIG+YFEANGHGT++FS+  +   A +    E    L   I++INE  GDAISD+L++E IL+ + WD++ W   Y D P+RQLKV V DRNV  TTDAER    P  LQ  I     NQ+   +K  R+FVRPSGTED+VR+Y E++ +E  D LA+ +  L+ ++
Sbjct:   20 SKETIQYGTAGFRGKAEFLDSVMFRMGVLATLRSRYRGGSVIGVMITASHNPEPDNGVKLVDPKGEMLEASWEAIATDLVNVSDQELEQQVAKIIKDNNIDVTTSSQ--VFVGMDNRYHSPRLLKAVADGVIALKGNVKEYGIVTTPMLHYFV--VAANTKEAYGKPTEEGYYDKLIKAFELLRNGRLENGNYRNSIIYDGANGVGARKMLQFIKRMKGTLNVTVINQGIGVGKINEDCGADYVKVQQSPPKSMPEDVK---PYTRCVSVDGDADRVVYFFTDDKGEFHLLDGDRIATLIAGYLMELV-TQSEIS-LRLGLVQTAYANGASTDYIVDQLKFPVSCVPTGVKHLHHKALEYDIGVYFEANGHGTIVFSDNAKATIAQVAQTKESAKTLLLLIDLINETVGDAISDMLLVETILNHKGWDVQDWISSYNDLPNRQLKVKVQDRNVIETTDAERVCVKPEGLQTEI-----NQVVAKYKRGRSFVRPSGTEDVVRVYAEAATKEDTDNLAYEVGLLVQKL 532          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Zebrafish
Match: pgm3 (phosphoglucomutase 3 [Source:ZFIN;Acc:ZDB-GENE-041024-13])

HSP 1 Score: 407.912 bits (1047), Expect = 2.791e-136
Identity = 224/535 (41.87%), Postives = 321/535 (60.00%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDL--KVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFCMNKSN----SEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKL----------------RNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEM 1641
            L YGTAG+R N+K+L+    RM  LA +RS     T+G+M+TASHNPE DNG+KL+DP GEM+   WE    E+   +++   +  +    D+  K D++     +V IG DTR SS  L++     +  +G +   +  ++TPQLH+ V   N      Y + T E Y++KLS AF     N    ++    L +D ANG+GA  ++ L   +  +L + L N  S   LN  CGAD+VK++Q  P         +  G R CS DGDADRIVY+  +  N   L DGDKIA L++ +L ++L T+  LN   +A++QTAYAN +ST Y+E+ +K+   C  TGVK+LH AA++YDIG+YFEANGHGTVLFS+                  R +AA L  N      +N+IN+  GDAISD+L+IE +L++R   ++ W  +YTD P+RQLKVTV DR V  TTDAER+  +P  LQ+AID  ++      +K++R+FVRPSGTED+VR+Y E+  QE AD+LAH +   ++ +
Sbjct:   22 LQYGTAGFRTNAKHLDHIMFRMGLLATLRSKKTKSTIGVMVTASHNPEEDNGVKLIDPMGEMVAAAWE----EYATQLANAEQDHLLAALKDIIEKEDISMSEAASVYIGRDTRPSSAALSQAVLDGVSSLGGKTHDYGLVSTPQLHYMVCCCNTKGR--YGSATLEGYYQKLSQAFLQLTHNVPNRTDDQKRLLLDGANGIGALKMKELEPFIRSELQVVLSNDGSSGKLNHLCGADYVKVQQKAP-----QGVSMGVGERCCSFDGDADRIVYYYTDSKNCFHLLDGDKIATLISTFLKELL-TQAGLN-LQVAVVQTAYANGSSTRYLEDVMKVAVCCTKTGVKHLHHAAQEYDIGVYFEANGHGTVLFSKAAQKQIVELVKDSNVNDERKHAAKLLENT-----VNLINQTVGDAISDMLVIEAVLAIRGMSVQDWDEIYTDLPNRQLKVTVSDRRVINTTDAERRAVTPEGLQDAIDSLVKK-----YKNARSFVRPSGTEDVVRVYAEADTQEGADRLAHEVSLAVHRL 533          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Xenopus
Match: pgm3 (phosphoglucomutase 3 [Source:NCBI gene;Acc:100158504])

HSP 1 Score: 394.045 bits (1011), Expect = 1.046e-130
Identity = 226/524 (43.13%), Postives = 315/524 (60.11%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEF---FNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAF--CMNKSNSEAPP--VLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDIL-KTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFS----EKLRNYAAL------LTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSI 1620
            L YGTAG+R  +++L+    RM  LA +RS      +G+M+TASHNPE DNG+KLVDP GEML +EWE  A         E     N  I K S     ++ + + +V IG DTR SS  LA      +  +  +Y  +  +TTPQLH+ V   N      Y   T E Y+ KLSSAF   + +++ +      L+VD ANG+GA  L+ + K +    +++L+N  S   LN  CGAD+VK++Q  P        E+  G R CS DGDADRIVY+  + +    L DGDKIA L++ ++ ++L K +L L    MA++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGTVLFS    E++R+ A +       T  N L   +++IN+  GDAISD+L+IE ILS++ + ++ W  +YTD P+RQLKV V DR V  TTDAER+   P  LQ+ ID  ++      +  SR+FVRPSGTED+VR+Y E+  QE AD LAH +
Sbjct:   23 LQYGTAGFRTKAEHLDHVMYRMGLLAVLRSKKTKSVIGVMVTASHNPEEDNGVKLVDPMGEMLAQEWEVYATNLANAEQHELQAVLNDIIQKES-----ISLQQEASVAIGRDTRPSSENLAYAVIDGVTALNSKYHDYGLVTTPQLHYIVCCCNTEGG--YGTPTLEGYYNKLSSAFNSLVKQAHDQGDKNKCLSVDGANGIGALKLKEMEKYLQSTFSIQLYNDGSGGKLNHLCGADYVKVQQKPP-----KGVEIKLGERCCSFDGDADRIVYYYNDSVGCFHLLDGDKIATLISTFIKELLVKVDLSLK---MAVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTVLFSKTAGEQIRHLANMEQNDEKKTAANMLLNTVDLINQTVGDAISDMLVIEAILSIKGFTVQKWDEIYTDLPNRQLKVKVADRRVIDTTDAERRTVKPPGLQDKIDDLVKK-----YSMSRSFVRPSGTEDVVRVYAEADTQENADCLAHEV 526          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Xenopus
Match: pgm3 (phosphoglucomutase 3 [Source:NCBI gene;Acc:100158504])

HSP 1 Score: 393.66 bits (1010), Expect = 1.074e-130
Identity = 228/529 (43.10%), Postives = 312/529 (58.98%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEF---FNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAF---------CMNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDIL-KTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFS----EKLRNYAAL------LTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSI 1620
            L YGTAG+R  +++L+    RM  LA +RS      +G+M+TASHNPE DNG+KLVDP GEML +EWE  A         E     N  I K S     ++ + + +V IG DTR SS  LA      +  +  +Y  +  +TTPQLH+ V   N      Y   T E Y+ KLSSAF         C    N      L+VD ANG+GA  L+ + K +    +++L+N  S   LN  CGAD+VK++Q  P        E+  G R CS DGDADRIVY+  + +    L DGDKIA L++ ++ ++L K +L L    MA++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGTVLFS    E++R+ A +       T  N L   +++IN+  GDAISD+L+IE ILS++ + ++ W  +YTD P+RQLKV V DR V  TTDAER+   P  LQ+ ID  ++      +  SR+FVRPSGTED+VR+Y E+  QE AD LAH +
Sbjct:   19 LQYGTAGFRTKAEHLDHVMYRMGLLAVLRSKKTKSVIGVMVTASHNPEEDNGVKLVDPMGEMLAQEWEVYATNLANAEQHELQAVLNDIIQKES-----ISLQQEASVAIGRDTRPSSENLAYAVIDGVTALNSKYHDYGLVTTPQLHYIVCCCNTEGG--YGTPTLEGYYNKLSSAFNSLVKQVINCSGDKNK----CLSVDGANGIGALKLKEMEKYLQSTFSIQLYNDGSGGKLNHLCGADYVKVQQKPP-----KGVEIKLGERCCSFDGDADRIVYYYNDSVGCFHLLDGDKIATLISTFIKELLVKVDLSLK---MAVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTVLFSKTAGEQIRHLANMEQNDEKKTAANMLLNTVDLINQTVGDAISDMLVIEAILSIKGFTVQKWDEIYTDLPNRQLKVKVADRRVIDTTDAERRTVKPPGLQDKIDDLVKK-----YSMSRSFVRPSGTEDVVRVYAEADTQENADCLAHEV 523          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Xenopus
Match: pgm3 (phosphoglucomutase 3 [Source:NCBI gene;Acc:100158504])

HSP 1 Score: 329.717 bits (844), Expect = 3.098e-106
Identity = 206/524 (39.31%), Postives = 289/524 (55.15%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEF---FNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAF--CMNKSNSEAPP--VLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDIL-KTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFS----EKLRNYAAL------LTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSI 1620
            L YGTAG+R  +++L+    RM  LA +RS      +G+M+TASHNPE DNG+KLVDP GEML +EWE  A         E     N  I K S     ++ + + +V IG DTR SS  LA      +  +  +Y  +  +TTPQLH+ V   N      Y   T E Y+ KLSSAF   + +++ +      L+VD ANG+GA  L+ + K +    +++L+N  S   LN  CGAD+VK++Q  P        E+  G R CS DGDADRIVY+  + +    L DGDKIA L++ ++ ++L K +L L    MA++QTAYAN +ST Y+E  +K                                 VLFS    E++R+ A +       T  N L   +++IN+  GDAISD+L+IE ILS++ + ++ W  +YTD P+RQLKV V DR V  TTDAER+   P  LQ+ ID  ++      +  SR+FVRPSGTED+VR+Y E+  QE AD LAH +
Sbjct:   23 LQYGTAGFRTKAEHLDHVMYRMGLLAVLRSKKTKSVIGVMVTASHNPEEDNGVKLVDPMGEMLAQEWEVYATNLANAEQHELQAVLNDIIQKES-----ISLQQEASVAIGRDTRPSSENLAYAVIDGVTALNSKYHDYGLVTTPQLHYIVCCCNTEGG--YGTPTLEGYYNKLSSAFNSLVKQAHDQGDKNKCLSVDGANGIGALKLKEMEKYLQSTFSIQLYNDGSGGKLNHLCGADYVKVQQKPP-----KGVEIKLGERCCSFDGDADRIVYYYNDSVGCFHLLDGDKIATLISTFIKELLVKVDLSLK---MAVVQTAYANGSSTRYLEEVMK---------------------------------VLFSKTAGEQIRHLANMEQNDEKKTAANMLLNTVDLINQTVGDAISDMLVIEAILSIKGFTVQKWDEIYTDLPNRQLKVKVADRRVIDTTDAERRTVKPPGLQDKIDDLVKK-----YSMSRSFVRPSGTEDVVRVYAEADTQENADCLAHEV 493          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Xenopus
Match: pgm3 (phosphoglucomutase 3 [Source:NCBI gene;Acc:100158504])

HSP 1 Score: 325.094 bits (832), Expect = 1.488e-104
Identity = 204/524 (38.93%), Postives = 284/524 (54.20%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEF---FNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAF--CMNKSNSEAPP--VLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDIL-KTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFS----EKLRNYAAL------LTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSI 1620
            L YGTAG+R  +++L+    RM  LA +RS      +G+M+TASHNPE DNG+KLVDP GEML +EWE  A         E     N  I K S     ++ + + +V IG DTR SS  LA      +  +  +Y  +  +TTPQLH+ V   N      Y   T E Y+ KLSSAF   + +++ +      L+VD ANG+GA  L+ + K +    +++L+N  S   LN  CGAD+VK++Q  P        E+  G R CS DGDADRIVY+  + +    L DGDKIA L++ ++ ++L K +L L    MA++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGTVLFS    E++R+ A +       T  N L   +++IN+                                         V DR V  TTDAER+   P  LQ+ ID  ++      +  SR+FVRPSGTED+VR+Y E+  QE AD LAH +
Sbjct:   20 LQYGTAGFRTKAEHLDHVMYRMGLLAVLRSKKTKSVIGVMVTASHNPEEDNGVKLVDPMGEMLAQEWEVYATNLANAEQHELQAVLNDIIQKES-----ISLQQEASVAIGRDTRPSSENLAYAVIDGVTALNSKYHDYGLVTTPQLHYIVCCCNTEGG--YGTPTLEGYYNKLSSAFNSLVKQAHDQGDKNKCLSVDGANGIGALKLKEMEKYLQSTFSIQLYNDGSGGKLNHLCGADYVKVQQKPP-----KGVEIKLGERCCSFDGDADRIVYYYNDSVGCFHLLDGDKIATLISTFIKELLVKVDLSLK---MAVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTVLFSKTAGEQIRHLANMEQNDEKKTAANMLLNTVDLINQ-----------------------------------------VADRRVIDTTDAERRTVKPPGLQDKIDDLVKK-----YSMSRSFVRPSGTEDVVRVYAEADTQENADCLAHEV 482          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Xenopus
Match: pgm3 (phosphoglucomutase 3 [Source:NCBI gene;Acc:100158504])

HSP 1 Score: 321.627 bits (823), Expect = 1.212e-103
Identity = 195/468 (41.67%), Postives = 269/468 (57.48%), Query Frame = 1
Query:  292 MLIREWEFIAMEFVEWISSEF---FNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAF---------CMNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDIL-KTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFS----EKLRNYAAL------LTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSI 1620
            ML +EWE  A         E     N  I K S     ++ + + +V IG DTR SS  LA      +  +  +Y  +  +TTPQLH+ V   N      Y   T E Y+ KLSSAF         C    N      L+VD ANG+GA  L+ + K +    +++L+N  S   LN  CGAD+VK++Q  P        E+  G R CS DGDADRIVY+  + +    L DGDKIA L++ ++ ++L K +L L    MA++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGTVLFS    E++R+ A +       T  N L   +++IN+  GDAISD+L+IE ILS++ + ++ W  +YTD P+RQLKV V DR V  TTDAER+   P  LQ+ ID  ++      +  SR+FVRPSGTED+VR+Y E+  QE AD LAH +
Sbjct:    1 MLAQEWEVYATNLANAEQHELQAVLNDIIQKES-----ISLQQEASVAIGRDTRPSSENLAYAVIDGVTALNSKYHDYGLVTTPQLHYIVCCCNTEGG--YGTPTLEGYYNKLSSAFNSLVKQVINCSGDKNK----CLSVDGANGIGALKLKEMEKYLQSTFSIQLYNDGSGGKLNHLCGADYVKVQQKPP-----KGVEIKLGERCCSFDGDADRIVYYYNDSVGCFHLLDGDKIATLISTFIKELLVKVDLSLK---MAVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTVLFSKTAGEQIRHLANMEQNDEKKTAANMLLNTVDLINQTVGDAISDMLVIEAILSIKGFTVQKWDEIYTDLPNRQLKVKVADRRVIDTTDAERRTVKPPGLQDKIDDLVKK-----YSMSRSFVRPSGTEDVVRVYAEADTQENADCLAHEV 444          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Mouse
Match: Pgm3 (phosphoglucomutase 3 [Source:MGI Symbol;Acc:MGI:97566])

HSP 1 Score: 391.349 bits (1004), Expect = 7.113e-130
Identity = 222/528 (42.05%), Postives = 305/528 (57.77%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFC----MNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNH-FSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSE----KLRNYAALLTHN-----NELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEMT 1644
            L YGTAG+R N+++L+    RM  LA +RS     T+G+M+TASHNPE DNG+KLVDP GEML   WE  A         +             VDL       V+I  DTR SS  L++     +  +G ++  +  +TTPQLH+ V  Y  N    Y   T E Y +KLS AF         + +    + VDCANG+GA  L  +    S+ L++ L N  +Q  LN  CGAD VK +Q  P        E+  G R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L   LE+    ++ ++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGT LFSE    K++  A  L          L   I++ N+A GDAISD+L+IE IL+++   ++ W  +Y D P+RQLKV V DR V  TTDAER+  +P  LQ AI     N L   +  +RAFVRPSGTEDIVR+Y E+++QE+AD+LA+ +  L+ ++ 
Sbjct:   21 LQYGTAGFRTNAQHLDHIMFRMGLLAVLRSKQTRSTIGVMVTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLASAEEQDVRQVLAAIVEKEAVDLTQ--TAFVVIARDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMV--YCRNSGGRYGQATVEGYCQKLSKAFVDLTNQVSCSGDVKRSVKVDCANGIGALKLREMEHYFSRGLSVLLFNDGTQGRLNHLCGADFVKSQQKPP-----QGIEMKSGERCCSFDGDADRIVYYYCDADGHFHLIDGDKIATLISSFLKELL---LEIGESVNLGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTALFSEAVEVKIKRLAQELDDGKGKAARTLASIIDLFNQAAGDAISDMLVIEAILALKGLTVQQWDAIYVDLPNRQLKVKVADRRVISTTDAERQAVTPPGLQEAI-----NDLVKKYTLARAFVRPSGTEDIVRVYAEANSQESADRLAYEVSLLVFQLA 531          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Mouse
Match: Pgm3 (phosphoglucomutase 3 [Source:MGI Symbol;Acc:MGI:97566])

HSP 1 Score: 328.176 bits (840), Expect = 6.755e-106
Identity = 200/519 (38.54%), Postives = 277/519 (53.37%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFC----MNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNH-FSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEMT 1644
            L YGTAG+R N+++L+    RM  LA +RS     T+G+M+TASHNPE DNG+KLVDP GEML   WE  A         +             VDL       V+I  DTR SS  L++     +  +G ++  +  +TTPQLH+ V  Y  N    Y   T E Y +KLS AF         + +    + VDCANG+GA  L  +    S+ L++ L N  +Q  LN  CGAD VK +Q  P        E+  G R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L   LE+    ++ ++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGT LFSE +           ++ R    +++  G A   L  I  + +                        V DR V  TTDAER+  +P  LQ AI     N L   +  +RAFVRPSGTEDIVR+Y E+++QE+AD+LA+ +  L+ ++ 
Sbjct:   21 LQYGTAGFRTNAQHLDHIMFRMGLLAVLRSKQTRSTIGVMVTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLASAEEQDVRQVLAAIVEKEAVDLTQ--TAFVVIARDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMV--YCRNSGGRYGQATVEGYCQKLSKAFVDLTNQVSCSGDVKRSVKVDCANGIGALKLREMEHYFSRGLSVLLFNDGTQGRLNHLCGADFVKSQQKPP-----QGIEMKSGERCCSFDGDADRIVYYYCDADGHFHLIDGDKIATLISSFLKELL---LEIGESVNLGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTALFSEAV---------EVKIKRLAQELDDGKGKAARTLASIIDLFN-----------------------QVADRRVISTTDAERQAVTPPGLQEAI-----NDLVKKYTLARAFVRPSGTEDIVRVYAEANSQESADRLAYEVSLLVFQLA 490          
BLAST of Phosphoacetylglucosamine mutase vs. UniProt/SwissProt
Match: sp|Q9CYR6|AGM1_MOUSE (Phosphoacetylglucosamine mutase OS=Mus musculus OX=10090 GN=Pgm3 PE=1 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 4.975e-129
Identity = 222/528 (42.05%), Postives = 305/528 (57.77%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFC----MNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNH-FSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSE----KLRNYAALLTHN-----NELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEMT 1644
            L YGTAG+R N+++L+    RM  LA +RS     T+G+M+TASHNPE DNG+KLVDP GEML   WE  A         +             VDL       V+I  DTR SS  L++     +  +G ++  +  +TTPQLH+ V  Y  N    Y   T E Y +KLS AF         + +    + VDCANG+GA  L  +    S+ L++ L N  +Q  LN  CGAD VK +Q  P        E+  G R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L   LE+    ++ ++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGT LFSE    K++  A  L          L   I++ N+A GDAISD+L+IE IL+++   ++ W  +Y D P+RQLKV V DR V  TTDAER+  +P  LQ AI     N L   +  +RAFVRPSGTEDIVR+Y E+++QE+AD+LA+ +  L+ ++ 
Sbjct:   21 LQYGTAGFRTNAQHLDHIMFRMGLLAVLRSKQTRSTIGVMVTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLASAEEQDVRQVLAAIVEKEAVDLTQ--TAFVVIARDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMV--YCRNSGGRYGQATVEGYCQKLSKAFVDLTNQVSCSGDVKRSVKVDCANGIGALKLREMEHYFSRGLSVLLFNDGTQGRLNHLCGADFVKSQQKPP-----QGIEMKSGERCCSFDGDADRIVYYYCDADGHFHLIDGDKIATLISSFLKELL---LEIGESVNLGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTALFSEAVEVKIKRLAQELDDGKGKAARTLASIIDLFNQAAGDAISDMLVIEAILALKGLTVQQWDAIYVDLPNRQLKVKVADRRVISTTDAERQAVTPPGLQEAI-----NDLVKKYTLARAFVRPSGTEDIVRVYAEANSQESADRLAYEVSLLVFQLA 531          
BLAST of Phosphoacetylglucosamine mutase vs. UniProt/SwissProt
Match: sp|Q09687|AGM1_SCHPO (Phosphoacetylglucosamine mutase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC13C5.05c PE=1 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 8.169e-129
Identity = 229/530 (43.21%), Postives = 320/530 (60.38%), Query Frame = 1
Query:  115 YGTAGYRMNSKYLNGFTVRMSFLAAMRSM-YKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFN----KFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIY----NNLTEHYFEKLSSAFC-MNKSNSEAPPV--LNVDCANGVGAKHLERLSKLVSKQLNLKLHNI---SQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEK-LRNYA-ALLTHN-------NELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLI 1632
            YGTAG+R  +  L          AA+RSM  K KT+G+MITASHNP  DNG+K++D DG ML  EWE    +     S   F+    +F+T  +          +  V+IG+DTR SSP LAEL    L E+   Y  + YITTPQLH+ V+  N++    +      +TE Y++ L+SAF  ++ S  ++P V  + VDCANGVG++ L+ ++ LV   L+++L N    + E LN  CGAD VK KQS P+   G   ++ P   + SIDGDADR++++ IN   +  L DGDKI+  +  YL  ++K       FS+ ++QTAYAN ASTEY+++ L I T   PTGVK+LHKAAK++DIG+YFEANGHGTVLFS+K L N A    T +        +L  +  +IN+A GDAISDLL    +L+  +WD   WS  Y D P++  KV V DR ++ +TDAER+L SP  LQ  ID      L   ++  R+FVR SGTED+VR+Y E+S ++AAD+L   + +L+
Sbjct:    9 YGTAGFRTKASDLEAAVYSSGVAAALRSMELKGKTIGVMITASHNPVEDNGVKIIDADGGMLAMEWEDKCTQLANAPSKAEFDFLIKQFLTPTT---------CQPKVIIGYDTRPSSPRLAELLKVCLDEMSASYIDYGYITTPQLHWLVRLINKSTAASFLEEGPPITE-YYDTLTSAFSKIDPSMQDSPTVSRVVVDCANGVGSQPLKTVAGLVKDSLSIELVNTDVRASELLNNGCGADFVKTKQSPPLALEG---KIKPNQLYASIDGDADRLIFYYINQNRKFHLLDGDKISTALVGYLNILVKKSGM--PFSLGVVQTAYANGASTEYLQD-LGITTVFTPTGVKHLHKAAKEFDIGVYFEANGHGTVLFSDKALANLAHPFFTPSPVQAAAIEQLQSYSVLINQAIGDAISDLLATISVLNALHWDASAWSNTYKDLPNKLAKVKVSDRTIYKSTDAERRLVSPDGLQEKID-----ALVAKYEKGRSFVRASGTEDVVRVYAEASTKQAADELCEKVCQLV 517          
BLAST of Phosphoacetylglucosamine mutase vs. UniProt/SwissProt
Match: sp|O95394|AGM1_HUMAN (Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 4.451e-128
Identity = 225/520 (43.27%), Postives = 307/520 (59.04%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFC-MNKSNS---EAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNH-FSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSE----KLRNYAALLTHNNE-----LCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSI 1620
            L YGTAG+R  +++L+    RM  LA +RS     T+G+M+TASHNPE DNG+KLVDP GEML   WE  A         +   + +   S+ K  +N +    V+IG DTR SS  L++     +  +G ++  +  +TTPQLH+ V  Y  N    Y   T E Y++KLS AF  + K  S   +    L VDCANG+GA  L  +    S+ L+++L N  S+  LN  CGAD VK  Q  P        E+    R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L   +E+    ++ ++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++DIG+YFEANGHGT LFS     K++  A  L          L   I++ N+A GDAISD+L+IE IL+++   ++ W  LYTD P+RQLKV V DR V  TTDAER+  +P  LQ AI     N L   +K SRAFVRPSGTED+VR+Y E+ +QE+AD LAH +
Sbjct:   21 LQYGTAGFRTKAEHLDHVMFRMGLLAVLRSKQTKSTIGVMVTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLAN-AEEQDMQRVLIDISE-KEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTPQLHYMV--YCRNTGGRYGKATIEGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKLREMEHYFSQGLSVQLFNDGSKGKLNHLCGADFVKSHQKPP-----QGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDKIATLISSFLKELL---VEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTALFSTAVEMKIKQSAEQLEDKKRKAAKMLENIIDLFNQAAGDAISDMLVIEAILALKGLTVQQWDALYTDLPNRQLKVQVADRRVISTTDAERQAVTPPGLQEAI-----NDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQESADHLAHEV 523          
BLAST of Phosphoacetylglucosamine mutase vs. UniProt/SwissProt
Match: sp|F1RQM2|AGM1_PIG (Phosphoacetylglucosamine mutase OS=Sus scrofa OX=9823 GN=PGM3 PE=1 SV=2)

HSP 1 Score: 386.726 bits (992), Expect = 3.459e-127
Identity = 221/520 (42.50%), Postives = 306/520 (58.85%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFC-MNKSNS---EAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNH-FSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSE----KLRNYAALLTHNNE-----LCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSI 1620
            L YGTAG+R  +  L+    RM  LA +RS     T+G+M+TASHNPE DNG+KLVDP GEML   WE  A         +     +    +  V+L+      V+IG DTR SS  L+E     +  +G ++  +  +TTPQLH+ V   N      Y   T + Y+ KLS+AF  ++K  S   +    L VDCANG+GA  L+ +   + + L+++L N  ++  LN  CGAD VK  Q  P     +  E+    R CS DGDADRI+Y+  +      L DGDKIA L++ +L ++L   LE+    ++ ++QTAYAN +ST Y+E  +K+   C  TGVK+LH  A+++D+G+YFEANGHGTVLFS+    K+R  A  L          L   I++ N+A GDAISD+L+IE IL+++   ++ W  LYTD P+RQLKV V DR V  TTDAER++  P  LQ AI     N L   +K SRAFVRPSGTED+VR+Y E+ +QE AD LA+ +
Sbjct:   21 LQYGTAGFRTKADRLDHVMFRMGLLAVLRSKQTKSTIGVMVTASHNPEDDNGVKLVDPLGEMLAPSWEEHATHLANAEEQDLARALVAISEEAAVNLHQD--AFVVIGRDTRPSSEKLSESVIDGVTVLGGQFHDYGLLTTPQLHYMVCCRNTGGQ--YGEATIDGYYHKLSTAFVELSKQASCSGDDHRTLKVDCANGIGALKLKEMKHYLPQGLSVQLFNDGTKGKLNHFCGADFVKSHQKPP-----EGIEMKANERCCSFDGDADRIIYYYCDVDGHFHLIDGDKIATLISSFLKELL---LEIGESLTVGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDLGVYFEANGHGTVLFSKAAEAKIRQLAKELEDKKGKAAKMLENVIDLFNQATGDAISDMLVIEAILALKGLTIQQWDALYTDLPNRQLKVKVADRQVISTTDAERQVVKPPGLQEAI-----NDLVKKYKLSRAFVRPSGTEDVVRVYAEADSQENADSLAYEV 523          
BLAST of Phosphoacetylglucosamine mutase vs. UniProt/SwissProt
Match: sp|Q9P4V2|AGM1_CANAX (Phosphoacetylglucosamine mutase OS=Candida albicans OX=5476 GN=AGM1 PE=1 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 5.044e-110
Identity = 220/566 (38.87%), Postives = 320/566 (56.54%), Query Frame = 1
Query:   43 MSLNDKLNQIINSNDIHDSFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMY-KAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFV----------EWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEI-GCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEH-YFEKLSSAF----CMNKSNSEAPPVLNVDCANGVGAKHL-ERLSKLVSKQLNLKLHN--ISQENL-NFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILK----TELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNE--------LCRFINIINEADGDAISDL---LIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLI 1632
            MS+   L+Q + S+          YGTAG+RM +  L+  T  +  +A++RS Y + KTVG+MITASHNP  DNG+K+VDP G ML   WE  A +            E   +          SDLK+DL+     NV+I  D+R SSP L+  T    + +   +Y  F   TTP+LH+  +  N+ P+  +   TE  Y+ KL+ +F     + +SN+E   +  +D ANGVGA  + E L K + K+++  + N    Q NL NFDCGAD+VK  Q +P        + V    + S DGDADR++ +  N+ N+ +L DGDK++ L A +L  + K    T++ LN   + ++QTAYAN +ST+Y+E+ LKI   C PTGVK+LH  A+ +DIG+YFEANGHGTV+F+ +          NN+        L  F  +IN+  GDAISDL   LI+ H L +   D   W   YTD P++ +KV VPDR++F TT+AER L  P  +Q+ IDK     L   + + R+FVR SGTED VR+Y E+  Q   ++L+ ++ +L+
Sbjct:    1 MSIEQTLSQYLPSHPKPQGV-TFTYGTAGFRMKADKLDYVTFTVGIIASLRSKYLQGKTVGVMITASHNPPEDNGVKVVDPLGSMLESSWEKYATDLANASPSPSNDSEGEKNSLVEVIKNLVSDLKIDLS--IPANVVIARDSRESSPALSMATIDGFQSVPNTKYQDFGLFTTPELHYVTRTLND-PD--FGKPTEDGYYSKLAKSFQEIYTICESNNEKIDI-TIDAANGVGAPKIQELLEKYLHKEISFTVVNGDYKQPNLLNFDCGADYVKTNQKLP-----KNVKPVNNKLYASFDGDADRLICYYQNNDNKFKLLDGDKLSTLFALFLQQLFKQIDPTKISLN---IGVVQTAYANGSSTKYVEDVLKIPVRCTPTGVKHLHHEAENFDIGVYFEANGHGTVIFNPEAEKKIFDYKPNNDNEAKAIKVLQNFSQLINQTVGDAISDLLAVLIVVHYLKLSPSD---WDNEYTDLPNKLVKVIVPDRSIFKTTNAERTLVEPKGMQDEIDK-----LVAQYPNGRSFVRASGTEDAVRVYAEADTQNNVEELSKAVSELV 543          
BLAST of Phosphoacetylglucosamine mutase vs. TrEMBL
Match: K1QVE8 (Phosphoacetylglucosamine mutase OS=Crassostrea gigas OX=29159 GN=CGI_10026539 PE=3 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 8.606e-143
Identity = 244/535 (45.61%), Postives = 320/535 (59.81%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKA-KTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEH-YFEKLSSAFCMNKSNSEAPPV---------LNVDCANGVGAKHLERLSKLVSKQLNLKLHNISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLN-QMQLFDGDKIAVLMADYLTDILK-TELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFS-------EKLRNYAALLTHNNELCRF----INIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEM 1641
            + YGTAG+R     LN    RM  LAA+RS  K+  T+G+MITASHNPE DNG+KLVDP GEML  EWE  A E      S+          +L V   S     V+   DTR SSP+LA    + +K  G +   F  +TTPQLH+ V+  N N    Y   TE  YFEKLS AF   ++  +A  +         L +D ANGVGA  +  L   +   L + L N     LN +CGAD VK++Q  P   N     + PG RW S DGDADRIVY+ +   + Q  L DGDKIA L+A YL D+++ T L LN   + ++QTAYAN +ST YI +QLK+   CVPTGVK+LH  A+++DIG+YFEANGHGT + S       +K     ++  H  E C      I++IN+  GDAISD+L++E IL+ ++WD+E W+  YTD P+RQLKV V DR+V  TTDAERK  SP+ LQ+AID+ +       + H R+FVRPSGTEDIVR+Y E+  Q AADKLA+ +  L+ +M
Sbjct:   22 IQYGTAGFRTKGSRLNHVIYRMGVLAAIRSATKSGATIGVMITASHNPEEDNGVKLVDPMGEMLGPEWEKYATEVANVPGSKLDVTLQELTKNLGV--TSLQSSRVVFARDTRPSSPVLAAALEAGIKAAGAQCQNFGLLTTPQLHYIVRCINTNGQ--YGKPTEEGYFEKLSEAFIKLRNIRKAKKLKTLEVYNTCLYLDAANGVGAGKIPILQSKLGDLLKISLVNDGSGKLNHECGADFVKVQQKPPTGVN-----MAPGQRWASFDGDADRIVYYFMGVTDKQFFLLDGDKIATLVAGYLKDLVQETGLSLN---LGLVQTAYANGSSTRYITDQLKVPVACVPTGVKHLHHKAQEFDIGVYFEANGHGTAIVSDSSYNLLQKTSQNTSISDHQREACDLLLSVIDLINQTVGDAISDMLLVEMILAAQDWDVEQWNKAYTDLPNRQLKVKVKDRSVIQTTDAERKASSPVGLQSAIDETVAK-----YTHGRSFVRPSGTEDIVRVYAEADTQSAADKLANEVAVLVYKM 539          
BLAST of Phosphoacetylglucosamine mutase vs. TrEMBL
Match: A0A1A8EAY1 (Phosphoacetylglucosamine mutase OS=Nothobranchius kadleci OX=1051664 GN=PGM3 PE=3 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 2.153e-137
Identity = 234/558 (41.94%), Postives = 333/558 (59.68%), Query Frame = 1
Query:   49 LNDKLNQIINSNDIHD--SFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDL--KVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFCM---NKSN-SEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDIL-KTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFS----EKL------------RNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEM 1641
            + D   +++  + +H   +   L YGTAG+R N+K L+    RM  LA +RS     T+G+M+TASHNPE DNG+KL+DP GEML   WE    +F   +++    + +    D+  K  +N K +  V +G DTR+SS  L++     +  +G +   +  +TTPQLH+ V    +N +  Y   T E Y  KLS AF     N SN ++    L VD ANG+GA  L  +   + KQL + + N  S+  LN  CGAD VK++Q  P        E+ PG R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L +  L+L    +A++QTAYAN +ST Y+E+ +K+   C  TGVK+LH AA+++DIG+YFEANGHGTVLFS    EK+            R  AALL  N      +N+IN+  GDAISD+L+IE IL+++   ++ W  +Y+D P+RQLKVTV DR V  TTDAER+  SP  LQ AID  ++      +K +R+FVRPSGTED+VR+Y E+ +QE+AD LAH +   ++ +
Sbjct:    1 MTDGFKEVLEKSSLHPKPAGLVLQYGTAGFRTNAKQLDHIMFRMGLLATLRSRKTKATIGVMVTASHNPEEDNGVKLIDPMGEMLTATWE----DFATQLANTEQKELLAALKDIINKEAINMKLEAEVFVGKDTRSSSASLSQAVLDGVHALGGQSKDYGLVTTPQLHYMV--CCQNSHGQYGEATVEGYCSKLSQAFLALSKNASNRTDDQKHLFVDGANGIGAPKLREVESHLKKQLQISIFNDGSRGELNHQCGADFVKVQQKPPT-----GVEISPGDRCCSFDGDADRIVYYYTDSRGLFHLLDGDKIATLISTFLKELLVQAGLDLK---IAVVQTAYANGSSTRYLEDTMKVIVRCTKTGVKHLHHAAQEFDIGVYFEANGHGTVLFSKTAEEKVQLLAKSTNINDERKRAALLLQNT-----VNVINQTVGDAISDMLLIEAILAIKGMTVQQWDAIYSDLPNRQLKVTVSDRRVIETTDAERRAVSPAGLQEAIDGLVKK-----YKQARSFVRPSGTEDVVRVYAEADSQESADALAHEVSLAVHRL 534          
BLAST of Phosphoacetylglucosamine mutase vs. TrEMBL
Match: A0A1A8BCS8 (Phosphoacetylglucosamine mutase OS=Nothobranchius kadleci OX=1051664 GN=PGM3 PE=3 SV=1)

HSP 1 Score: 419.083 bits (1076), Expect = 2.200e-137
Identity = 234/558 (41.94%), Postives = 333/558 (59.68%), Query Frame = 1
Query:   49 LNDKLNQIINSNDIHD--SFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDL--KVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFCM---NKSN-SEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDIL-KTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFS----EKL------------RNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEM 1641
            + D   +++  + +H   +   L YGTAG+R N+K L+    RM  LA +RS     T+G+M+TASHNPE DNG+KL+DP GEML   WE    +F   +++    + +    D+  K  +N K +  V +G DTR+SS  L++     +  +G +   +  +TTPQLH+ V    +N +  Y   T E Y  KLS AF     N SN ++    L VD ANG+GA  L  +   + KQL + + N  S+  LN  CGAD VK++Q  P        E+ PG R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L +  L+L    +A++QTAYAN +ST Y+E+ +K+   C  TGVK+LH AA+++DIG+YFEANGHGTVLFS    EK+            R  AALL  N      +N+IN+  GDAISD+L+IE IL+++   ++ W  +Y+D P+RQLKVTV DR V  TTDAER+  SP  LQ AID  ++      +K +R+FVRPSGTED+VR+Y E+ +QE+AD LAH +   ++ +
Sbjct:    1 MTDGFKEVLEKSSLHPKPAGLVLQYGTAGFRTNAKQLDHIMFRMGLLATLRSRKTKATIGVMVTASHNPEEDNGVKLIDPMGEMLTATWE----DFATQLANTEQKELLAALKDIINKEAINMKLEAEVFVGKDTRSSSASLSQAVLDGVHALGGQSKDYGLVTTPQLHYMV--CCQNSHGQYGEATVEGYCSKLSQAFLALSKNASNRTDDQKHLFVDGANGIGAPKLREVESHLKKQLQISIFNDGSRGKLNHQCGADFVKVQQKPPT-----GVEISPGDRCCSFDGDADRIVYYYTDSRGLFHLLDGDKIATLISTFLKELLVQAGLDLK---IAVVQTAYANGSSTRYLEDTMKVIVRCTKTGVKHLHHAAQEFDIGVYFEANGHGTVLFSKTAEEKVQLLAKSTNINDERKRAALLLQNT-----VNVINQTVGDAISDMLLIEAILAIKGMTVQQWDAIYSDLPNRQLKVTVSDRRVIETTDAERRAVSPAGLQEAIDGLVKK-----YKQARSFVRPSGTEDVVRVYAEADSQESADALAHEVSLAVHRL 534          
BLAST of Phosphoacetylglucosamine mutase vs. TrEMBL
Match: A0A1A8V218 (Phosphoacetylglucosamine mutase OS=Nothobranchius furzeri OX=105023 GN=PGM3 PE=3 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 3.820e-137
Identity = 234/558 (41.94%), Postives = 333/558 (59.68%), Query Frame = 1
Query:   49 LNDKLNQIINSNDIHD--SFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDL--KVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFCM---NKSN-SEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDIL-KTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFS----EKL------------RNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEM 1641
            + D   +++  + +H   +   L YGTAG+R N+K L+    RM  LA +RS     T+G+M+TASHNPE DNG+KL+DP GEML   WE    +F   +++    + +    D+  K  +N K +  V +G DTR+SS  L++     +  +G +   +  +TTPQLH+ V    +N +  Y   T E Y  KLS AF     N SN ++    L VD ANG+GA  L  +   + KQL + + N  S+  LN  CGAD VK++Q  P        E+ PG R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L +  L+L    +A++QTAYAN +ST Y+E+ +K+   C  TGVK+LH AA+++DIG+YFEANGHGTVLFS    EK+            R  AALL  N      +N+IN+  GDAISD+L+IE IL+++   ++ W  +Y+D P+RQLKVTV DR V  TTDAER+  SP  LQ AID  ++      +K +R+FVRPSGTED+VR+Y E+ +QE+AD LAH +   ++ +
Sbjct:    1 MTDGFKEVLEKSSLHPKPAGLVLQYGTAGFRTNAKQLDHIMFRMGLLATLRSRKTKATIGVMVTASHNPEEDNGVKLIDPMGEMLTATWE----DFATQLANTEQKELLAALKDIINKEAINMKLEAEVFVGKDTRSSSASLSQAVLDGVHALGGQSKDYGLVTTPQLHYMV--CCQNSHGQYGEATVEGYCSKLSQAFLALSKNASNRTDDQKHLFVDGANGIGAPKLREVESHLKKQLQISIFNDGSRGKLNHQCGADFVKVQQKPPT-----GVEISPGDRCCSFDGDADRIVYYYTDSRGFFHLLDGDKIATLISTFLKELLVQAGLDLK---IAVVQTAYANGSSTRYLEDTMKVIVRCTKTGVKHLHHAAQEFDIGVYFEANGHGTVLFSKTAEEKVQLLAKSTNINDERKRAALLLQNT-----VNVINQTVGDAISDMLLIEAILAIKGMTVQQWDAIYSDLPNRQLKVTVSDRRVIETTDAERRAVSPAGLQEAIDGLVKK-----YKQARSFVRPSGTEDVVRVYAEADSQESADALAHEVSLAVHRL 534          
BLAST of Phosphoacetylglucosamine mutase vs. TrEMBL
Match: A0A1C9CW41 (Phosphoacetylglucosamine mutase OS=Bombyx mori OX=7091 GN=pgm PE=2 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 4.683e-137
Identity = 235/538 (43.68%), Postives = 313/538 (58.18%), Query Frame = 1
Query:  109 LPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYK-AKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEF-------VEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEH-YFEKLSSAFCMNKSNSEAPPV-------LNVDCANGVGAKHLERLSKLVSKQLNLKLHNISQEN--LNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNE---------LCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEM 1641
            + YGTAG+R  +  L     RM  LA +RS  K  +T+GIMITASHN E DNG+KL+DPDGEML + WE IA +        +E  ++E   +         V+ N   K ++ IG DTR +SP LA+   + +  +      F  +TTP LHFFVK  N+N    Y   TE  Y+EK+  AF   K+  +  PV       L VD ANGVG K L  + K +  +L+LKL N+      LN +CGAD VK+ Q  P+       E VP  R  S+DGD+DRIVY+ ++  ++M L DGD+IA L+A Y+T++L T  E  H  + ++QTAYAN AST YI  +LK+   CV TGVK+LH AA  YDIG+YFEANGHGTV++S   +   + +    E         L  FI++ NE  GDAISDL ++E +L  R  D E W   Y D P RQ+KVTV DRNV  T DAER   SP  LQ  ID     +L   +   RAFVRPSGTED+VR+Y E+  Q++ADKLA  + + + ++
Sbjct:   25 IEYGTAGFRTKANLLEHVVYRMGLLAVIRSRVKNGRTIGIMITASHNLEPDNGVKLIDPDGEMLEQSWEAIATKLANVSDNDLEATTAEIIKE---------VNANMTLKTSIFIGMDTRYTSPRLAQAAANGVMALKGTPKEFGIVTTPMLHFFVKCRNDN---TYGTPTEEGYYEKIVGAF---KNIRQKLPVYGNYSTTLYVDGANGVGGKKLNIIKKTLDGELDLKLFNLGGNGGKLNLNCGADFVKVSQKPPV-----GVEHVPMQRVASLDGDSDRIVYYYVDDKDKMHLLDGDRIATLLASYITELL-TASEAKHLKLGLVQTAYANGASTAYITQKLKVPVSCVKTGVKHLHHAALSYDIGVYFEANGHGTVIYSHDAKKTISKIAEEGESEQRKAAQLLLDFIDMTNETVGDAISDLFLVETVLCARGLDAEQWLSTYDDLPCRQVKVTVQDRNVISTADAERVCTSPEGLQTRID-----ELVAAYADGRAFVRPSGTEDVVRVYAEADTQQSADKLAAEVSQAVYDL 536          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Yeast
Match: PCM1 (Essential N-acetylglucosamine-phosphate mutase; converts GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the biosynthesis of chitin and for the formation of N-glycosylated mannoproteins and glycosylphosphatidylinositol anchors [Source:SGD;Acc:S000000784])

HSP 1 Score: 328.176 bits (840), Expect = 3.981e-106
Identity = 205/534 (38.39%), Postives = 295/534 (55.24%), Query Frame = 1
Query:  115 YGTAGYRMNSKYLNGFTVRMSFLAAMRSM-YKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWIS-SEFFNKFITKCSDL----KVDLNSKYKGNVLIGFDTRNSSP-LLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYN----ENPNTIYNNLTEHY------FEKLSSAFCMNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHNIS--------QENLNFDCGADHVKIKQSVPIIHNGDCSELVPGS---RWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNH----FSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYL-HKAAKKYDIGIYFEANGHGTVLFSEKL-RNYAALLTHN---------NELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSN 1587
            YGTAG+R  +K L+        LA +RS+  + + VG+MITASHNP  DNG+K+V+PDG ML+  WE  AM+     S +  F +F  + + L    K+DLN+    ++++G D+R SSP LL  LT+S+      +      +TTPQLH+     N    E          ++Y      F +L + + + K  S   P L +D ANG+G   L++L  L S+  ++    +          E LNF+CGAD+VK  Q +P         L P S    +CS DGDADR+V++ ++  ++  L DGDKI+ L A +L+     +LEL H      + ++QTAYAN +ST YI+N L     C  TGVK+L H+AA +YDIGIYFEANGHGT++FSEK  R   + L+ +           L  F  +IN+  GDAISD+L +   L++       W   YTD P++ +K  VPDR++F TTD ERKL +P+ LQ+ ID  +       +   R+FVR SGTED VR+Y E  +
Sbjct:   25 YGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLS--VPKLFIDTANGIGGPQLKKL--LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLP-------KGLSPSSFDSLYCSFDGDADRVVFYYVDSGSKFHLLDGDKISTLFAKFLS----KQLELAHLEHSLKIGVVQTAYANGSSTAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAK-----YPMGRSFVRASGTEDAVRVYAECKD 538          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Nematostella
Match: EDO42108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2H7])

HSP 1 Score: 351.673 bits (901), Expect = 5.452e-115
Identity = 205/524 (39.12%), Postives = 303/524 (57.82%), Query Frame = 1
Query:  115 YGTAGYRMNSKYLNGFTVRMSFLAAMRSMYK-AKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEH-YFEKLSSAFC---MNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHNISQ-ENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDIL-KTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSE----KLRNYAALLTHNNELCR-------FINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLI 1632
            YGTAG+R  +  L     RM  LA +RS  K  + +G++ITASHNP  DNG+KLVDP GEML   WE  A       +++          + KV++     G V I  DTR S     +     ++ +G  Y  +  +TTPQLH+ V+ +N      Y   TE  Y++KLS AF    M     +A  +  +D ANGVGA  ++ ++  +  +L L + N  +   LN  CGAD+VK+ Q  P     D   + PG +  + DGDADR++YF + + +Q  L DGD+IA L+A ++ + L KT + L+   + ++QTAYAN +ST Y ++ LK+      TGVK++H  A+++DIG+YFEANGHGTVLFS+    K++  A     N+E  R        I+++N+A GD+ISD+L++E IL+ ++W+LE W   YTD  +RQLKV V DR V  T+D E ++  P  LQ  I K + N     +   R+F RPSGTED+VR+Y E+ +++AADKLA  + + +
Sbjct:   24 YGTAGFRTRADTLETVMFRMGMLAVIRSRAKEGQAIGVVITASHNPIYDNGVKLVDPLGEMLNESWEKYATSLAN--ANDLIGALKDVIHETKVEMCKP--GKVFIARDTRPSGLAFTKALMDGIQALGGLYHDYGVLTTPQLHYMVRCHNTQGE--YGEATEQGYYKKLSKAFIHLRMLAGKGKAKQI-KLDGANGVGALKVKEMANHMKGELPLVIFNEGEVSKLNEKCGADYVKLYQCAP-----DNMTICPGDKCVTYDGDADRVMYFFMGNDSQFHLLDGDRIATLIAGFIKERLDKTNVVLSR-GLGMVQTAYANGSSTRYAQDVLKVPVALAKTGVKFVHHRAEQFDIGVYFEANGHGTVLFSKEAVAKIKEVAQKSEKNSEQHRAATELIYLIDLVNQAVGDSISDMLVVESILNAQDWELEDWFNCYTDLCNRQLKVKVKDRTVIKTSDTEEQVIEPQGLQVEISKLVAN-----YSKGRSFARPSGTEDVVRVYAEADSRDAADKLAVEVAQKV 529          
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Medaka
Match: pgm3 (phosphoglucomutase 3 [Source:NCBI gene;Acc:101157413])

HSP 1 Score: 400.208 bits (1027), Expect = 2.558e-133
Identity = 227/527 (43.07%), Postives = 314/527 (59.58%), Query Frame = 1
Query:  106 CLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAM-----EFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLT-EHYFEKLSSAFCM---NKSN-SEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHN-ISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNE-----------LCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSI 1620
             L YGTAG+R NS +L+    RM  LA +RS     T+GIM+TASHNPE DNG+KLVDP GEML   WE  A      E  E IS+   N+ I K       ++   + +V +G DTR+SS  L++     +  +G     +  +TTPQLH+ V    +N    Y + T E Y++KL  AF     N SN ++    L VD ANG+GA  L  +   ++K L + + N  S+  LN  CGAD VK++Q  P        ++ PG R CS DGDADRIVY+  +      L DGDKIA L++ +L ++L  +  LN   +A++QTAYAN +ST+Y+EN + +   C  TGVK+LH AA ++D+G+YFEANGHGTVLFS+   +    L  ++            L   IN+IN+  GDA+SD+L+IE IL+++   +E W  +YTD P+RQLKV V DR V  TTDAER+  SP  LQ AID  ++      ++ +R+FVRPSGTED+VR+Y E+  QE+AD LAH +
Sbjct:   21 ALQYGTAGFRSNSIHLDHIMFRMGLLAVLRSKKTKSTIGIMVTASHNPEEDNGVKLVDPMGEMLAATWESYATMLANAEQEELISA--LNEIIEKEG-----IDKSQEASVFVGKDTRSSSASLSQAVLDGVHALGGHSKDYGLVTTPQLHYMV--CCKNTQGKYGDATVEGYYKKLCQAFTQLVGNASNCTDDQKHLCVDGANGIGALKLREMISHLNKGLQVTIFNDGSKGKLNHQCGADFVKVQQKTPT-----GIQVNPGDRCCSFDGDADRIVYYFADSQQVFHLLDGDKIATLISTFLKELL-IQAGLN-LKIAVVQTAYANGSSTDYLENTMNVTVRCTKTGVKHLHHAALEFDVGVYFEANGHGTVLFSKAAEDKIQQLAQDSRIDDERKRAALMLQSTINVINQTVGDALSDMLLIEAILAIKGMTVEQWDRIYTDLPNRQLKVKVSDRRVIDTTDAERRAVSPAGLQEAIDNLVKT-----YRKARSFVRPSGTEDVVRVYAEADTQESADALAHEV 526          
BLAST of Phosphoacetylglucosamine mutase vs. Planmine SMEST
Match: SMESG000058605.1 (SMESG000058605.1)

HSP 1 Score: 1112.44 bits (2876), Expect = 0.000e+0
Identity = 533/536 (99.44%), Postives = 535/536 (99.81%), Query Frame = 1
Query:   43 MSLNDKLNQIINSNDIHDSFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEHYFEKLSSAFCMNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHNISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEMTRY 1650
            MS+NDKLNQIINSNDIHDSFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEHYFEKLSSAFCMNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHNISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHW VLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQ+QLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEMTRY
Sbjct:    1 MSMNDKLNQIINSNDIHDSFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEHYFEKLSSAFCMNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHNISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWFVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQSQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEMTRY 536          
BLAST of Phosphoacetylglucosamine mutase vs. Planmine SMEST
Match: SMESG000058605.1 (SMESG000058605.1)

HSP 1 Score: 1108.21 bits (2865), Expect = 0.000e+0
Identity = 531/534 (99.44%), Postives = 533/534 (99.81%), Query Frame = 1
Query:   49 LNDKLNQIINSNDIHDSFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEHYFEKLSSAFCMNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHNISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEMTRY 1650
            +NDKLNQIINSNDIHDSFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEHYFEKLSSAFCMNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHNISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHW VLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQ+QLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEMTRY
Sbjct:    1 MNDKLNQIINSNDIHDSFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEHYFEKLSSAFCMNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHNISQENLNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWFVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQSQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLINEMTRY 534          
BLAST of Phosphoacetylglucosamine mutase vs. Planmine SMEST
Match: SMESG000058604.1 (SMESG000058604.1)

HSP 1 Score: 363.999 bits (933), Expect = 2.450e-119
Identity = 214/540 (39.63%), Postives = 313/540 (57.96%), Query Frame = 1
Query:   55 DKLNQIINSNDIHDSFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAMRSMY-KAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWISSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKEIGCEYFLFEYITTPQLHFFVKYYN--ENPNTIYNNLTEHYFEKLSSAF--CMNKSNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHNISQEN----LNFDCGADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQLFDGDKIAVLMADYLTDILKTELELN--HFSMAIIQTAYANSASTEYIENQLKIKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHNNELCRFI---NIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQLKVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRPSGTEDIVRIYVESSNQEAADKLAHSIEKLI 1632
            ++L Q +N   I +  K   YGTAG+R  +  L G   R+  +A +RSM  +   +GIM+TASHN   DNG+K+VD  GEML   WE IA++F+     +  +     C +  +D++   +G+V +G D RN+S  ++++    ++ +  +   F  ITTPQLHF V+  N  E+  +I N  +  YF+++  +F   +          L VDCANG+GA+HL  + + +   LN  +H  + +     +N  CGAD +K K   PIIHNGD S++    RW SIDGDADR++YF  N+  ++ + DGDK AVL+A +L ++L +    N     + ++QTAYAN   T+ +   + +   CVPTGVKYLH   K+ DI IYFE NGHG++L S++ R Y      +    RFI    +INEA GD+ S LL+IEHILS  N  L  W  +Y +YPS  L+V + DR    TT+ ER +  P+ LQ  I++ +  +   GF  SR FVRPSGTEDIVR+Y ES NQE A  +A  + +L+
Sbjct:    6 EELIQQLNHYVISEEDKNFIYGTAGFRTAATRLVGIAFRIGIMAVIRSMQERGAVIGIMVTASHNEASDNGLKVVDKGGEMLDESWEEIAVQFIRTNVDDVPDFINEICINRNIDIS--IRGSVFLGEDNRNTSNAISKIVARGIQVLFGKCTYFGKITTPQLHFLVRKQNNLESGKSITNIYS--YFQQICGSFERLIYPEKIIHNSSLYVDCANGIGARHLSSIIQFLQPHLNY-IHVCNSDPTGNIINLKCGADFIKSKMQFPIIHNGDVSDINENDRWASIDGDADRLIYFFKNN-GKLCILDGDKQAVLIAKFLKELLASIGNWNPEDIKLGVVQTAYANFNCTKTLIENIGVPVVCVPTGVKYLHHTGKELDIRIYFETNGHGSILLSKRARIYLNKYLDSEHPLRFILLNGLINEAVGDSFSILLLIEHILSCYNLSLNSWFDMYHEYPSSLLQVKIRDRRAISTTNCERTVSKPVKLQQNINEKML-EFGKGFM-SRVFVRPSGTEDIVRVYAESENQEVAALVATEVARLV 537          
The following BLAST results are available for this feature:
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGM39.269e-12943.27phosphoglucomutase 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
PGM32.268e-12843.27phosphoglucomutase 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
PGM33.940e-12843.27phosphoglucomutase 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
PGM31.032e-12242.94phosphoglucomutase 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
PGM31.032e-12242.94phosphoglucomutase 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F21D5.11.676e-11538.59Phosphoacetylglucosamine mutase [Source:UniProtKB... [more]
back to top
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nst9.775e-13342.13gene:FBgn0036298 transcript:FBtr0075967[more]
back to top
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgm32.791e-13641.87phosphoglucomutase 3 [Source:ZFIN;Acc:ZDB-GENE-041... [more]
back to top
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pgm31.046e-13043.13phosphoglucomutase 3 [Source:NCBI gene;Acc:1001585... [more]
pgm31.074e-13043.10phosphoglucomutase 3 [Source:NCBI gene;Acc:1001585... [more]
pgm33.098e-10639.31phosphoglucomutase 3 [Source:NCBI gene;Acc:1001585... [more]
pgm31.488e-10438.93phosphoglucomutase 3 [Source:NCBI gene;Acc:1001585... [more]
pgm31.212e-10341.67phosphoglucomutase 3 [Source:NCBI gene;Acc:1001585... [more]
back to top
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pgm37.113e-13042.05phosphoglucomutase 3 [Source:MGI Symbol;Acc:MGI:97... [more]
Pgm36.755e-10638.54phosphoglucomutase 3 [Source:MGI Symbol;Acc:MGI:97... [more]
back to top
BLAST of Phosphoacetylglucosamine mutase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CYR6|AGM1_MOUSE4.975e-12942.05Phosphoacetylglucosamine mutase OS=Mus musculus OX... [more]
sp|Q09687|AGM1_SCHPO8.169e-12943.21Phosphoacetylglucosamine mutase 1 OS=Schizosacchar... [more]
sp|O95394|AGM1_HUMAN4.451e-12843.27Phosphoacetylglucosamine mutase OS=Homo sapiens OX... [more]
sp|F1RQM2|AGM1_PIG3.459e-12742.50Phosphoacetylglucosamine mutase OS=Sus scrofa OX=9... [more]
sp|Q9P4V2|AGM1_CANAX5.044e-11038.87Phosphoacetylglucosamine mutase OS=Candida albican... [more]
back to top
BLAST of Phosphoacetylglucosamine mutase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QVE88.606e-14345.61Phosphoacetylglucosamine mutase OS=Crassostrea gig... [more]
A0A1A8EAY12.153e-13741.94Phosphoacetylglucosamine mutase OS=Nothobranchius ... [more]
A0A1A8BCS82.200e-13741.94Phosphoacetylglucosamine mutase OS=Nothobranchius ... [more]
A0A1A8V2183.820e-13741.94Phosphoacetylglucosamine mutase OS=Nothobranchius ... [more]
A0A1C9CW414.683e-13743.68Phosphoacetylglucosamine mutase OS=Bombyx mori OX=... [more]
back to top
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PCM13.981e-10638.39Essential N-acetylglucosamine-phosphate mutase; co... [more]
back to top
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO421085.452e-11539.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphoacetylglucosamine mutase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgm32.558e-13343.07phosphoglucomutase 3 [Source:NCBI gene;Acc:1011574... [more]
back to top
BLAST of Phosphoacetylglucosamine mutase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000058605.10.000e+099.44SMESG000058605.1[more]
SMESG000058605.10.000e+099.44SMESG000058605.1[more]
SMESG000058604.12.450e-11939.63SMESG000058604.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012839 ID=SMED30012839|Name=Phosphoacetylglucosamine mutase|organism=Schmidtea mediterranea sexual|type=transcript|length=1691bp
GGCATTTTGAAAAAGTTATTTTAAAAAAAATATACCTTAAAGATGTCATT
GAATGATAAACTAAACCAAATTATAAATTCGAATGATATTCATGATTCGT
TCAAGTGCCTGCCTTATGGAACAGCAGGTTATAGAATGAATTCAAAATAT
TTAAATGGGTTTACTGTTCGAATGAGCTTTCTCGCTGCAATGAGATCGAT
GTATAAGGCTAAAACTGTTGGGATTATGATAACAGCTTCTCATAATCCGG
AATGTGACAATGGAATTAAATTAGTTGACCCAGATGGTGAAATGCTTATT
AGGGAATGGGAATTCATTGCAATGGAATTTGTCGAATGGATTTCAAGCGA
ATTTTTCAATAAATTCATTACAAAATGTTCGGATCTAAAAGTCGATTTAA
ACAGTAAATATAAAGGTAATGTCCTGATTGGATTTGATACCAGAAACAGT
AGCCCTCTTTTAGCCGAACTTACGACATCTGTATTAAAAGAAATTGGATG
TGAATATTTCTTGTTTGAATACATTACTACTCCTCAGTTGCATTTTTTCG
TTAAATATTATAATGAAAATCCGAATACAATCTATAATAATCTAACTGAG
CATTATTTTGAAAAACTATCTAGCGCATTTTGTATGAATAAATCAAATTC
GGAAGCACCGCCAGTTTTAAATGTGGATTGTGCCAATGGAGTTGGAGCGA
AACATTTGGAACGCTTGTCAAAATTAGTTTCTAAACAATTGAACTTAAAA
TTACATAATATTTCTCAGGAAAATCTCAACTTTGACTGTGGAGCTGATCA
TGTTAAGATCAAGCAATCAGTTCCAATCATTCATAATGGCGATTGCAGTG
AATTAGTTCCGGGCAGTCGTTGGTGCTCAATTGATGGAGATGCAGATCGA
ATTGTTTATTTTTCCATTAATCATCTGAATCAGATGCAACTGTTCGATGG
AGATAAAATTGCTGTTTTGATGGCCGATTATTTGACGGATATTTTGAAAA
CTGAATTGGAATTGAATCATTTTTCAATGGCTATTATTCAGACTGCTTAT
GCTAATTCGGCCAGCACTGAATATATCGAAAATCAATTGAAAATTAAAAC
AGAATGTGTTCCAACTGGAGTCAAATATTTACACAAAGCAGCCAAAAAAT
ACGATATTGGGATTTATTTTGAGGCAAATGGTCATGGAACAGTTTTATTT
TCTGAGAAGTTGAGAAATTATGCTGCACTATTAACTCATAATAATGAATT
GTGTCGTTTTATTAACATTATCAATGAGGCAGATGGTGATGCCATTTCAG
ATCTATTAATTATCGAACATATACTTTCTGTGCGAAATTGGGACTTAGAA
CATTGGTCTGTGCTATATACCGATTATCCTAGCCGTCAATTGAAAGTAAC
AGTGCCAGATAGAAATGTCTTCATTACCACTGACGCAGAAAGGAAATTAG
AATCACCAATAAGTTTACAAAATGCTATTGATAAAGCGATTCAAAATCAA
CTAACTATGGGTTTCAAACATTCCCGGGCGTTCGTTCGACCATCGGGAAC
TGAAGATATCGTTCGAATTTATGTAGAATCTTCGAATCAAGAAGCCGCTG
ATAAATTGGCACATTCAATAGAAAAATTGATCAATGAAATGACCAGATAT
TAATTATATTTCGGCTTTGGATCAATTGGTTTTTACTGGAC
back to top

protein sequence of SMED30012839-orf-1

>SMED30012839-orf-1 ID=SMED30012839-orf-1|Name=SMED30012839-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=537bp
MSLNDKLNQIINSNDIHDSFKCLPYGTAGYRMNSKYLNGFTVRMSFLAAM
RSMYKAKTVGIMITASHNPECDNGIKLVDPDGEMLIREWEFIAMEFVEWI
SSEFFNKFITKCSDLKVDLNSKYKGNVLIGFDTRNSSPLLAELTTSVLKE
IGCEYFLFEYITTPQLHFFVKYYNENPNTIYNNLTEHYFEKLSSAFCMNK
SNSEAPPVLNVDCANGVGAKHLERLSKLVSKQLNLKLHNISQENLNFDCG
ADHVKIKQSVPIIHNGDCSELVPGSRWCSIDGDADRIVYFSINHLNQMQL
FDGDKIAVLMADYLTDILKTELELNHFSMAIIQTAYANSASTEYIENQLK
IKTECVPTGVKYLHKAAKKYDIGIYFEANGHGTVLFSEKLRNYAALLTHN
NELCRFINIINEADGDAISDLLIIEHILSVRNWDLEHWSVLYTDYPSRQL
KVTVPDRNVFITTDAERKLESPISLQNAIDKAIQNQLTMGFKHSRAFVRP
SGTEDIVRIYVESSNQEAADKLAHSIEKLINEMTRY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006048UDP-N-acetylglucosamine biosynthetic process
GO:0005975carbohydrate metabolic process
GO:0071704organic substance metabolic process
Vocabulary: molecular function
TermDefinition
GO:0016853isomerase activity
GO:0016868intramolecular transferase activity, phosphotransferases
GO:0004610phosphoacetylglucosamine mutase activity
GO:0000287magnesium ion binding
GO:0046872metal ion binding
Vocabulary: INTERPRO
TermDefinition
IPR036900A-D-PHexomutase_C_sf
IPR005846A-D-PHexomutase_a/b/a-III
IPR005843A-D-PHexomutase_C
IPR016055A-D-PHexomutase_a/b/a-I/II/III
IPR016657PAGM
IPR005844A-D-PHexomutase_a/b/a-I
IPR016066A-D-PHexomutase_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005843Alpha-D-phosphohexomutase, C-terminalPFAMPF00408PGM_PMM_IVcoord: 483..530
e-value: 2.0E-8
score: 34.3
NoneNo IPR availableGENE3DG3DSA:3.30.310.50coord: 446..535
e-value: 6.3E-29
score: 102.0
NoneNo IPR availableGENE3DG3DSA:3.40.120.10coord: 301..383
e-value: 2.8E-9
score: 38.8
NoneNo IPR availableGENE3DG3DSA:3.40.120.10coord: 211..300
e-value: 2.8E-9
score: 38.8
NoneNo IPR availableGENE3DG3DSA:1.10.490.170coord: 2..179
e-value: 9.9E-51
score: 173.7
NoneNo IPR availablePANTHERPTHR45955FAMILY NOT NAMEDcoord: 22..534
IPR016657Phosphoacetylglucosamine mutasePIRSFPIRSF016408PAGMcoord: 1..536
e-value: 1.6E-171
score: 569.0
IPR016657Phosphoacetylglucosamine mutaseCDDcd03086PGM3coord: 25..530
e-value: 0.0
score: 622.306
IPR005846Alpha-D-phosphohexomutase, alpha/beta/alpha domain IIIPFAMPF02880PGM_PMM_IIIcoord: 302..385
e-value: 1.6E-5
score: 25.0
IPR005844Alpha-D-phosphohexomutase, alpha/beta/alpha domain IPFAMPF02878PGM_PMM_Icoord: 57..88
e-value: 3.7E-8
score: 33.2
coord: 122..174
e-value: 5.7E-9
score: 35.8
IPR016066Alpha-D-phosphohexomutase, conserved sitePROSITEPS00710PGM_PMMcoord: 60..69
IPR016055Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/IIISUPERFAMILYSSF53738Phosphoglucomutase, first 3 domainscoord: 282..384
IPR016055Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/IIISUPERFAMILYSSF53738Phosphoglucomutase, first 3 domainscoord: 23..108
IPR016055Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/IIISUPERFAMILYSSF53738Phosphoglucomutase, first 3 domainscoord: 185..290
IPR016055Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/IIISUPERFAMILYSSF53738Phosphoglucomutase, first 3 domainscoord: 122..175
IPR036900Alpha-D-phosphohexomutase, C-terminal domain superfamilySUPERFAMILYSSF55957Phosphoglucomutase, C-terminal domaincoord: 433..533