LIM domain kinase

Overview
NameLIM domain kinase
Smed IDSMED30012833
Length (bp)1468
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM domain kinase (SMED30012833) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM domain kinase (SMED30012833) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM domain kinase (SMED30012833) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM domain kinase (SMED30012833) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012833

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012833SMESG000037707.1 Contig4627GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012833SMESG000018804.1 Contig4627GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30012833SMESG000018804.1 dd_Smed_v4_9329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012833SMESG000018804.1 dd_Smed_v4_9329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012833SMESG000037707.1 Contig4627GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012833SMESG000018804.1 Contig4627GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM domain kinase vs. Ensembl Human
Match: LIMK1 (LIM domain kinase 1 [Source:HGNC Symbol;Acc:HGNC:6613])

HSP 1 Score: 196.438 bits (498), Expect = 2.217e-55
Identity = 121/419 (28.88%), Postives = 204/419 (48.69%), Query Frame = 3
Query:  156 SNPTIKNGGNSSNLKRHQ----TCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            S+P     G + +  R +    +CSID S     P      S       L R+ S  + +  P ++   +D    EVLG+G FG+AIKV + +TG   VMKE++   +E + + +KEV ++R L+H N+L  +G++ K+KR+  +TE + GG+L+  I+ ++      Q++ F +DIA+GM +LH  +I+HRDL S NCL+R+N  VVV+DFGL++ +                         ++E  +   LR + +  + + +  V N   +  E  N                                        G++Y+  VD++SFGI+ CE+  R++A P++L R   D  ++ + F+++       NCP     I  +CC  DP+KRP+F  +  WLE +   L+ +L L
Sbjct:  240 SSPAYTPSGEAGSSARQKPVLRSCSIDRS-----PGAGSLGSPASQRKDLGRSESLRV-VCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLM-------------------------VDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMIN----------------------------------------GRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPR-TMDFGLNVRGFLDRYCPP---NCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPL 583          
BLAST of LIM domain kinase vs. Ensembl Human
Match: LIMK1 (LIM domain kinase 1 [Source:HGNC Symbol;Acc:HGNC:6613])

HSP 1 Score: 196.823 bits (499), Expect = 4.327e-55
Identity = 121/419 (28.88%), Postives = 204/419 (48.69%), Query Frame = 3
Query:  156 SNPTIKNGGNSSNLKRHQ----TCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            S+P     G + +  R +    +CSID S     P      S       L R+ S  + +  P ++   +D    EVLG+G FG+AIKV + +TG   VMKE++   +E + + +KEV ++R L+H N+L  +G++ K+KR+  +TE + GG+L+  I+ ++      Q++ F +DIA+GM +LH  +I+HRDL S NCL+R+N  VVV+DFGL++ +                         ++E  +   LR + +  + + +  V N   +  E  N                                        G++Y+  VD++SFGI+ CE+  R++A P++L R   D  ++ + F+++       NCP     I  +CC  DP+KRP+F  +  WLE +   L+ +L L
Sbjct:  304 SSPAYTPSGEAGSSARQKPVLRSCSIDRS-----PGAGSLGSPASQRKDLGRSESLRV-VCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLM-------------------------VDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMIN----------------------------------------GRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPR-TMDFGLNVRGFLDRYCPP---NCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPL 647          
BLAST of LIM domain kinase vs. Ensembl Human
Match: LIMK1 (LIM domain kinase 1 [Source:HGNC Symbol;Acc:HGNC:6613])

HSP 1 Score: 196.438 bits (498), Expect = 4.645e-55
Identity = 121/419 (28.88%), Postives = 204/419 (48.69%), Query Frame = 3
Query:  156 SNPTIKNGGNSSNLKRHQ----TCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            S+P     G + +  R +    +CSID S     P      S       L R+ S  + +  P ++   +D    EVLG+G FG+AIKV + +TG   VMKE++   +E + + +KEV ++R L+H N+L  +G++ K+KR+  +TE + GG+L+  I+ ++      Q++ F +DIA+GM +LH  +I+HRDL S NCL+R+N  VVV+DFGL++ +                         ++E  +   LR + +  + + +  V N   +  E  N                                        G++Y+  VD++SFGI+ CE+  R++A P++L R   D  ++ + F+++       NCP     I  +CC  DP+KRP+F  +  WLE +   L+ +L L
Sbjct:  274 SSPAYTPSGEAGSSARQKPVLRSCSIDRS-----PGAGSLGSPASQRKDLGRSESLRV-VCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLM-------------------------VDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMIN----------------------------------------GRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPR-TMDFGLNVRGFLDRYCPP---NCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPL 617          
BLAST of LIM domain kinase vs. Ensembl Human
Match: LIMK2 (LIM domain kinase 2 [Source:HGNC Symbol;Acc:HGNC:6614])

HSP 1 Score: 188.734 bits (478), Expect = 2.096e-52
Identity = 119/378 (31.48%), Postives = 190/378 (50.26%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNL-QLKMKSPKDMD 1427
            R+ S   +  + +++    D    EVLG+G FG+AIKV +  TG   VMKE++   +E +++ + EV ++RSL H N+L  +G++ K+K++ LLTE + GG+L+  ++ ++      QK+ F + IA+GM +LH   I+HRDL S NCL++ + TVVV+DFGLS+ +  E    R+P                      T  R + +N + + +  V N                                        P+WMAPEML GK+Y+  VD++SFGI+ CE+  ++ A P+ L R   D  ++ K F EK       +CP     +   CC+ +P+ RP F    S LED    LS  L +L +  P +++
Sbjct:  290 RSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMDP-FPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEE--RKRAPME-----------------KATTKKRTLRKNDRKKRYTVVGN----------------------------------------PYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPR-TLDFGLNVKLFWEKFVP---TDCPPAFFPLAAICCRLEPESRPAF----SKLEDSFEALSLYLGELGIPLPAELE 599          
BLAST of LIM domain kinase vs. Ensembl Human
Match: LIMK2 (LIM domain kinase 2 [Source:HGNC Symbol;Acc:HGNC:6614])

HSP 1 Score: 188.348 bits (477), Expect = 3.810e-52
Identity = 118/378 (31.22%), Postives = 190/378 (50.26%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNL-QLKMKSPKDMD 1427
            R+ S   +  + +++    D    EVLG+G FG+AIKV +  TG   VMKE++   +E +++ + EV ++RSL H N+L  +G++ K+K++ LLTE + GG+L+  ++ ++      QK+ F + IA+GM +LH   I+HRDL S NCL++ + TVVV+DFGLS+ +  E    R+P                      T  R + +N + + +  V N                                        P+WMAPEML GK+Y+  VD++SFGI+ CE+  ++ A P+ L R   D  ++ K F EK       +CP     +   CC+ +P+ RP F+     LED    LS  L +L +  P +++
Sbjct:  311 RSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMDP-FPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEE--RKRAPME-----------------KATTKKRTLRKNDRKKRYTVVGN----------------------------------------PYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPR-TLDFGLNVKLFWEKFVP---TDCPPAFFPLAAICCRLEPESRPAFSK----LEDSFEALSLYLGELGIPLPAELE 620          
BLAST of LIM domain kinase vs. Ensembl Celegans
Match: T25B9.4 (Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;Acc:Q22765])

HSP 1 Score: 95.5153 bits (236), Expect = 8.637e-21
Identity = 48/144 (33.33%), Postives = 80/144 (55.56%), Query Frame = 3
Query:  375 LGQGAFGRAIKVQYLK-----TGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSK 791
            +G+GA+G   K    +      GA   M++ +    E  + ++ E  L+RSL H NI+ C G+ + E+ + ++ E ++GG L S ++   Q +T+ QK       A G+ F+H + I+HRD+ + NCL    N V +SDFGLS+
Sbjct:  138 VGKGAYGEVFKGTVTRGNKTFNGAIKAMRKDLDAGNEKMKEVMAEARLMRSLNHPNIVRCRGIAVLEQPVYIVIEFINGGGLDSYLKKNSQTLTMDQKNRMAISAAWGIEFMHSHDIIHRDIAARNCLYDNKNLVKLSDFGLSR 281          
BLAST of LIM domain kinase vs. Ensembl Celegans
Match: kin-21 (Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;Acc:G5EBM6])

HSP 1 Score: 86.6557 bits (213), Expect = 6.185e-18
Identity = 49/143 (34.27%), Postives = 78/143 (54.55%), Query Frame = 3
Query:  375 LGQGAFGRAIKVQYLKTGAYY----VMKEVVSHSKENE-ESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLS 788
            LG+GAFG  IK +Y+  GA       +K ++  +K  +      E +++  L+H NI+   G    ++ I L+ E + GG L+  +Q    + +  Q I F  +IA+GM  L   +++HRDL + NCL+ K   V +SDFGLS
Sbjct:  182 LGRGAFGEVIKAKYVPMGATVPTEVAVKRLIGDAKRPQLVDFCNEANIMTLLEHKNIVALYGFASLQQPIMLVIEFVPGGDLRKYLQRTPNVPS-KQIIKFAMEIASGMKHLSSKNVIHRDLAARNCLITKELNVKISDFGLS 323          
BLAST of LIM domain kinase vs. Ensembl Celegans
Match: K09B11.5 (Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;Acc:Q9U3B5])

HSP 1 Score: 86.6557 bits (213), Expect = 6.666e-18
Identity = 51/145 (35.17%), Postives = 78/145 (53.79%), Query Frame = 3
Query:  372 VLGQGAFGRAIKVQYLK----TGAYYVMKEVVSHS-KENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLL-RKNNTVVVSDFGLS 788
            +LG GAFG  +K +Y+      G    +K V+  + +E  +    E  ++ +LKH+N++   G+   E+ I L+ EL+ GG L+  +Q    I    Q I F  DIA GM  L    ++HRDL + NCL+ R    V +SDFGL+
Sbjct:  122 ILGNGAFGEVLKARYIPRGHTNGVEVAVKRVIGTAQREQMQEFCHEAQIMGTLKHDNVVKLYGIASLEQPIMLVMELITGGDLKKYLQSTPSIPN-RQLIAFALDIANGMRHLVIKKVIHRDLAARNCLISRPTLQVKISDFGLA 265          
BLAST of LIM domain kinase vs. Ensembl Celegans
Match: K09B11.5 (Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;Acc:Q9U3B5])

HSP 1 Score: 86.6557 bits (213), Expect = 7.118e-18
Identity = 51/145 (35.17%), Postives = 78/145 (53.79%), Query Frame = 3
Query:  372 VLGQGAFGRAIKVQYLK----TGAYYVMKEVVSHS-KENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLL-RKNNTVVVSDFGLS 788
            +LG GAFG  +K +Y+      G    +K V+  + +E  +    E  ++ +LKH+N++   G+   E+ I L+ EL+ GG L+  +Q    I    Q I F  DIA GM  L    ++HRDL + NCL+ R    V +SDFGL+
Sbjct:  186 ILGNGAFGEVLKARYIPRGHTNGVEVAVKRVIGTAQREQMQEFCHEAQIMGTLKHDNVVKLYGIASLEQPIMLVMELITGGDLKKYLQSTPSIPN-RQLIAFALDIANGMRHLVIKKVIHRDLAARNCLISRPTLQVKISDFGLA 329          
BLAST of LIM domain kinase vs. Ensembl Celegans
Match: T06C10.3 (Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;Acc:Q22243])

HSP 1 Score: 85.5001 bits (210), Expect = 1.755e-17
Identity = 50/153 (32.68%), Postives = 84/153 (54.90%), Query Frame = 3
Query:  351 TDFEEKEVLGQGAFGRAIKVQY-LKTG-----AYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSK 791
            +D    +VLG+GAFG+       LK G     A  + K     SK   + ++ E   +R+  H N++   G+   E+ + +L EL+ GGSLQ  ++  +  +++ +KI F      G+ +LHQN+ +HRD+ + NCLL +   V ++DFGLS+
Sbjct:  261 SDVTVGKVLGEGAFGKVCSGTLKLKDGTNVDVAIKMTKVSAFLSKMKIKEMMNEARFIRNFNHKNVVRLYGVAHHEQPLYILLELVKGGSLQDHMKKEKGAVSIVEKIKFCSGAGRGIEYLHQNNCIHRDIAARNCLLHEKE-VKITDFGLSR 412          
BLAST of LIM domain kinase vs. Ensembl Fly
Match: LIMK1 (gene:FBgn0283712 transcript:FBtr0301831)

HSP 1 Score: 135.961 bits (341), Expect = 1.271e-33
Identity = 65/170 (38.24%), Postives = 112/170 (65.88%), Query Frame = 3
Query:  291 LPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLN 800
            L RT S  + +  P+++   TD    E LG+G FG+  KV + ++G   V+KE+    +E + + IKEV++LR L H ++L  +G++ K+K++ ++TE + GG L+  I D  Q++   Q++   RDIA GM++LH  +I+HRDL S NCL+R++ +V+V+DFGL++ ++
Sbjct:  166 LSRTQSCRV-VQKPQRIFRATDLVIGEKLGEGFFGKVFKVTHRQSGEVMVLKELHRADEEAQRNFIKEVAVLRLLDHRHVLKFIGVLYKDKKLHMVTEYVAGGCLKELIHDPAQVLPWPQRVRLARDIACGMSYLHSMNIIHRDLNSMNCLVREDRSVIVADFGLARSVD 334          

HSP 2 Score: 106.686 bits (265), Expect = 5.628e-24
Identity = 49/123 (39.84%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 1056 HTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLKMKSPKDM 1424
            +TVVGNP+WMAPEM+ G  Y+  VD++SFGI+ CE+  R+ A P+F+ R N D S++ ++F    ++K    CPE  + +   CC  +PD RP F T+  WL+    RL+++L      P+ +
Sbjct:  376 YTVVGNPYWMAPEMMKGLKYDEKVDVFSFGIMLCEIIGRVEADPDFMPR-NSDFSLNQQEF----REKFCAQCPEPFVKVAFVCCDLNPDMRPCFETLHVWLQ----RLADDLAADRVPPERL 489          
BLAST of LIM domain kinase vs. Ensembl Fly
Match: LIMK1 (gene:FBgn0283712 transcript:FBtr0073660)

HSP 1 Score: 135.961 bits (341), Expect = 1.273e-33
Identity = 74/213 (34.74%), Postives = 124/213 (58.22%), Query Frame = 3
Query:  162 PTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLN 800
            P        + LK  + CS  LS         Q+ S       L RT S  + +  P+++   TD    E LG+G FG+  KV + ++G   V+KE+    +E + + IKEV++LR L H ++L  +G++ K+K++ ++TE + GG L+  I D  Q++   Q++   RDIA GM++LH  +I+HRDL S NCL+R++ +V+V+DFGL++ ++
Sbjct:  338 PPAAGATAMTQLKEKERCS-SLSKLLDEQHQAQQHSAHPQLYDLSRTQSCRV-VQKPQRIFRATDLVIGEKLGEGFFGKVFKVTHRQSGEVMVLKELHRADEEAQRNFIKEVAVLRLLDHRHVLKFIGVLYKDKKLHMVTEYVAGGCLKELIHDPAQVLPWPQRVRLARDIACGMSYLHSMNIIHRDLNSMNCLVREDRSVIVADFGLARSVD 548          

HSP 2 Score: 105.916 bits (263), Expect = 9.679e-24
Identity = 49/123 (39.84%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 1056 HTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLKMKSPKDM 1424
            +TVVGNP+WMAPEM+ G  Y+  VD++SFGI+ CE+  R+ A P+F+ R N D S++ ++F    ++K    CPE  + +   CC  +PD RP F T+  WL+    RL+++L      P+ +
Sbjct:  590 YTVVGNPYWMAPEMMKGLKYDEKVDVFSFGIMLCEIIGRVEADPDFMPR-NSDFSLNQQEF----REKFCAQCPEPFVKVAFVCCDLNPDMRPCFETLHVWLQ----RLADDLAADRVPPERL 703          
BLAST of LIM domain kinase vs. Ensembl Fly
Match: LIMK1 (gene:FBgn0283712 transcript:FBtr0073661)

HSP 1 Score: 135.961 bits (341), Expect = 1.301e-33
Identity = 74/213 (34.74%), Postives = 124/213 (58.22%), Query Frame = 3
Query:  162 PTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLN 800
            P        + LK  + CS  LS         Q+ S       L RT S  + +  P+++   TD    E LG+G FG+  KV + ++G   V+KE+    +E + + IKEV++LR L H ++L  +G++ K+K++ ++TE + GG L+  I D  Q++   Q++   RDIA GM++LH  +I+HRDL S NCL+R++ +V+V+DFGL++ ++
Sbjct:  133 PPAAGATAMTQLKEKERCS-SLSKLLDEQHQAQQHSAHPQLYDLSRTQSCRV-VQKPQRIFRATDLVIGEKLGEGFFGKVFKVTHRQSGEVMVLKELHRADEEAQRNFIKEVAVLRLLDHRHVLKFIGVLYKDKKLHMVTEYVAGGCLKELIHDPAQVLPWPQRVRLARDIACGMSYLHSMNIIHRDLNSMNCLVREDRSVIVADFGLARSVD 343          

HSP 2 Score: 106.686 bits (265), Expect = 5.602e-24
Identity = 49/123 (39.84%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 1056 HTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLKMKSPKDM 1424
            +TVVGNP+WMAPEM+ G  Y+  VD++SFGI+ CE+  R+ A P+F+ R N D S++ ++F    ++K    CPE  + +   CC  +PD RP F T+  WL+    RL+++L      P+ +
Sbjct:  385 YTVVGNPYWMAPEMMKGLKYDEKVDVFSFGIMLCEIIGRVEADPDFMPR-NSDFSLNQQEF----REKFCAQCPEPFVKVAFVCCDLNPDMRPCFETLHVWLQ----RLADDLAADRVPPERL 498          
BLAST of LIM domain kinase vs. Ensembl Fly
Match: LIMK1 (gene:FBgn0283712 transcript:FBtr0073659)

HSP 1 Score: 135.576 bits (340), Expect = 1.575e-33
Identity = 74/213 (34.74%), Postives = 124/213 (58.22%), Query Frame = 3
Query:  162 PTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLN 800
            P        + LK  + CS  LS         Q+ S       L RT S  + +  P+++   TD    E LG+G FG+  KV + ++G   V+KE+    +E + + IKEV++LR L H ++L  +G++ K+K++ ++TE + GG L+  I D  Q++   Q++   RDIA GM++LH  +I+HRDL S NCL+R++ +V+V+DFGL++ ++
Sbjct:  316 PPAAGATAMTQLKEKERCS-SLSKLLDEQHQAQQHSAHPQLYDLSRTQSCRV-VQKPQRIFRATDLVIGEKLGEGFFGKVFKVTHRQSGEVMVLKELHRADEEAQRNFIKEVAVLRLLDHRHVLKFIGVLYKDKKLHMVTEYVAGGCLKELIHDPAQVLPWPQRVRLARDIACGMSYLHSMNIIHRDLNSMNCLVREDRSVIVADFGLARSVD 526          

HSP 2 Score: 105.916 bits (263), Expect = 9.272e-24
Identity = 49/123 (39.84%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 1056 HTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLKMKSPKDM 1424
            +TVVGNP+WMAPEM+ G  Y+  VD++SFGI+ CE+  R+ A P+F+ R N D S++ ++F    ++K    CPE  + +   CC  +PD RP F T+  WL+    RL+++L      P+ +
Sbjct:  568 YTVVGNPYWMAPEMMKGLKYDEKVDVFSFGIMLCEIIGRVEADPDFMPR-NSDFSLNQQEF----REKFCAQCPEPFVKVAFVCCDLNPDMRPCFETLHVWLQ----RLADDLAADRVPPERL 681          
BLAST of LIM domain kinase vs. Ensembl Fly
Match: LIMK1 (gene:FBgn0283712 transcript:FBtr0301830)

HSP 1 Score: 135.576 bits (340), Expect = 1.575e-33
Identity = 74/213 (34.74%), Postives = 124/213 (58.22%), Query Frame = 3
Query:  162 PTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLN 800
            P        + LK  + CS  LS         Q+ S       L RT S  + +  P+++   TD    E LG+G FG+  KV + ++G   V+KE+    +E + + IKEV++LR L H ++L  +G++ K+K++ ++TE + GG L+  I D  Q++   Q++   RDIA GM++LH  +I+HRDL S NCL+R++ +V+V+DFGL++ ++
Sbjct:  316 PPAAGATAMTQLKEKERCS-SLSKLLDEQHQAQQHSAHPQLYDLSRTQSCRV-VQKPQRIFRATDLVIGEKLGEGFFGKVFKVTHRQSGEVMVLKELHRADEEAQRNFIKEVAVLRLLDHRHVLKFIGVLYKDKKLHMVTEYVAGGCLKELIHDPAQVLPWPQRVRLARDIACGMSYLHSMNIIHRDLNSMNCLVREDRSVIVADFGLARSVD 526          

HSP 2 Score: 105.916 bits (263), Expect = 9.272e-24
Identity = 49/123 (39.84%), Postives = 76/123 (61.79%), Query Frame = 3
Query: 1056 HTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLKMKSPKDM 1424
            +TVVGNP+WMAPEM+ G  Y+  VD++SFGI+ CE+  R+ A P+F+ R N D S++ ++F    ++K    CPE  + +   CC  +PD RP F T+  WL+    RL+++L      P+ +
Sbjct:  568 YTVVGNPYWMAPEMMKGLKYDEKVDVFSFGIMLCEIIGRVEADPDFMPR-NSDFSLNQQEF----REKFCAQCPEPFVKVAFVCCDLNPDMRPCFETLHVWLQ----RLADDLAADRVPPERL 681          
BLAST of LIM domain kinase vs. Ensembl Zebrafish
Match: limk1a (LIM domain kinase 1a [Source:ZFIN;Acc:ZDB-GENE-061212-3])

HSP 1 Score: 140.198 bits (352), Expect = 3.160e-35
Identity = 64/154 (41.56%), Postives = 105/154 (68.18%), Query Frame = 3
Query:  336 KLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            ++   +D    EVLG G FG+AIKV + +TG   VMKE++   +E + + +KEV ++R L H N+L  +G++ K+KR+  + E + GG+L+  I++++      Q++ F +DIA+GM +LH  +I+HRDL S NCL+R+N +VVV+DFGLS+ +
Sbjct:  336 RIFRASDLIHGEVLGTGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLDHPNVLKFIGVLYKDKRLNFIAEYIKGGTLRDIIKNMDSNYPWGQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKSVVVADFGLSRLM 489          

HSP 2 Score: 112.849 bits (281), Expect = 4.162e-26
Identity = 58/150 (38.67%), Postives = 88/150 (58.67%), Query Frame = 3
Query:  963 ITKERQNTIADDSFRR----DEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            + + +   +AD    R    D   E+RK+ + R+++TVVGNP+WMAPEM+ GK+Y+  VDL+SFGI+ CE+  R++A P++L R   D  ++   F+E++      +CP     I   CC  D +KRP F  + SWLED+   L   L L
Sbjct:  472 VRENKSVVVADFGLSRLMVEDRSVERRKA-DRRKRYTVVGNPYWMAPEMIHGKSYDEKVDLFSFGIMLCEIIGRVNADPDYLPR-ALDFGLNTAVFLEEHCPA---DCPAAFFPIAALCCDLDAEKRPAFTKLESWLEDLKMHLELGLHL 616          
BLAST of LIM domain kinase vs. Ensembl Zebrafish
Match: limk2 (LIM domain kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040718-398])

HSP 1 Score: 138.658 bits (348), Expect = 8.556e-35
Identity = 66/148 (44.59%), Postives = 104/148 (70.27%), Query Frame = 3
Query:  354 DFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            D    E+LG+G FG+AIKV +  TG   VMKE++   +E +++ +KEV ++RSL H ++L  +G++ K+KR+ L+TE + GG+L+  I+D +      Q++ F + IA+GM +LH  SI+HRDL S NCL++ +NTVVV+DFGLS+ +
Sbjct:  336 DLIHGEILGKGFFGQAIKVTHKATGEVMVMKELIRCDEETQKTFLKEVKVMRSLDHTHVLKFIGVLYKDKRLNLITEFIEGGTLKDFIRDTDS-FPWEQRVSFAKSIASGMAYLHSMSIIHRDLNSHNCLVKLDNTVVVADFGLSRLI 482          

HSP 2 Score: 102.064 bits (253), Expect = 1.676e-22
Identity = 51/132 (38.64%), Postives = 77/132 (58.33%), Query Frame = 3
Query: 1032 KSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLKMKSPKDMD 1427
            + ++ ++++TVVGNP+WMAPEML GK Y+  VD++SFGI+ CE+  ++ A PE L R   D  ++ + FIEK   +   +CP     +   CC   PD RP F      LED    L+ N +L +  P ++D
Sbjct:  503 RRIDRKKRYTVVGNPYWMAPEMLNGKRYDEKVDIFSFGIVLCEIIGQVYADPECLPR-TLDFGLNVRTFIEKFLPE---HCPPAFFALAVACCDLTPDNRPAFQK----LEDCFEALTFNQELNIPLPAELD 626          
BLAST of LIM domain kinase vs. Ensembl Zebrafish
Match: limk1b (LIM domain kinase 1b [Source:ZFIN;Acc:ZDB-GENE-110411-106])

HSP 1 Score: 135.191 bits (339), Expect = 1.248e-33
Identity = 72/204 (35.29%), Postives = 127/204 (62.25%), Query Frame = 3
Query:  207 QTCSID----LSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPE 806
            ++CSID    L        +R++++  ES         F+ N D  +++   +D    E+LG+G FG+AIKV +L+TG   V+KE++   +E +++ +KEV ++R L+H N+L  +G++ K+KR+ L++E + GG+L+  I  +      + ++ + +DIA GM +LH  +++HRDL S NC +R+N TVVV+DFGL++ +  E
Sbjct:  254 RSCSIDKVPCLQRHAALLSHRRDINRSESLR-------FDAN-DKTQRIFRPSDLIYGEILGKGCFGQAIKVTHLETGEVMVIKELLQFDEETQKTFLKEVKVMRCLEHPNVLKFIGILYKDKRLNLISEYVQGGTLRDTILKMASDHPWNLRVSYAKDIAAGMAYLHSMNVIHRDLNSHNCFVRENQTVVVADFGLAQLVKDE 449          

HSP 2 Score: 110.538 bits (275), Expect = 2.427e-25
Identity = 49/125 (39.20%), Postives = 77/125 (61.60%), Query Frame = 3
Query: 1026 KRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            K   +  ++++TVVGNP+WMAPEM+ GK Y+  VD++SFGI+ CE+  R+ A P+FL R  ++  ++ K+F+E+   K   +CP     I   CC  + +KRP F  +  WLE+++  L   L L
Sbjct:  459 KLNKLGRKKRYTVVGNPYWMAPEMINGKIYDERVDIFSFGIVLCEIIGRVYADPDFLPR-TQEYGLNVKEFLERCWSK---DCPAAFFPIAVLCCALEAEKRPVFAKLEEWLENVMMHLEMGLPL 579          
BLAST of LIM domain kinase vs. Ensembl Zebrafish
Match: zgc:113162 (zgc:113162 [Source:ZFIN;Acc:ZDB-GENE-050522-530])

HSP 1 Score: 101.293 bits (251), Expect = 3.497e-23
Identity = 50/108 (46.30%), Postives = 72/108 (66.67%), Query Frame = 3
Query: 1050 RKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELI-NCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDI 1370
            RK ++VG+ FWMAPEML G+ Y+  VD++SFGI+ CE+ ARI A PE L R  KD  +D + F      +EL+  CPE ++++   CCQ D  +RP+F+ ++  LEDI
Sbjct:  217 RKLSLVGSAFWMAPEMLRGEPYDRKVDVFSFGIMLCEILARIPADPEVLPR-TKDYGLDVQAF------RELVQGCPERVLELSASCCQMDAFRRPSFSELLDELEDI 317          

HSP 2 Score: 94.3597 bits (233), Expect = 8.005e-21
Identity = 63/190 (33.16%), Postives = 104/190 (54.74%), Query Frame = 3
Query:  231 DKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLR---KNNTVVVSDFGLSK 791
            D+T  P +   LS  EST    +T+ ++      +KL    DF   E++G G F +  KV +  T    V+K  +  +  ++ S+++E+SLL+ L H NI+  LG+ +KE ++  + E + GG L+  +   +  +   +KI    DI+ GM +LH  +I HRDL S NCL+R   +    VV+DFGL++
Sbjct:   21 DETTEPVSPTLLS--ESTDTYCQTDCWHPLRTTVRKLEFWEDFS-AELIGTGFFSKVYKVMHGTTKKVMVVK--IYKNDVDQNSIVREISLLQKLSHPNIVRYLGICVKENKLYPILEYVSGGCLEELLARADVSLCWREKIELGCDISRGMAYLHYKNIYHRDLNSKNCLIRMSSRGREAVVTDFGLAR 205          
BLAST of LIM domain kinase vs. Ensembl Zebrafish
Match: si:dkeyp-75h12.2 (si:dkeyp-75h12.2 [Source:ZFIN;Acc:ZDB-GENE-030131-7512])

HSP 1 Score: 96.6709 bits (239), Expect = 7.681e-21
Identity = 60/169 (35.50%), Postives = 95/169 (56.21%), Query Frame = 3
Query:  294 PRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNN---TVVVSDFGLSK 791
            PR +S+         L  + DF   E +G G F    KVQ+  TG    +K  ++    N+ +++KEV L+  L+H NIL  +G+ + E  +  LTE ++GG+L+ ++ + + +++   +I    DIA G+ +LH   I HRDLTS NCL+R  N   T VV DFGL++
Sbjct:   28 PRPSSYRALRSAVSSLARLDDFI-CEKIGSGFFSEVFKVQHRSTGQVMALK--MNTMASNKANMLKEVQLMNRLRHPNILRFVGVCVHEGHLHALTEYINGGNLE-QLLNSDVLLSWSVRINLSLDIARGLQYLHSKGIFHRDLTSKNCLVRWENGHCTAVVGDFGLAE 192          

HSP 2 Score: 92.4337 bits (228), Expect = 2.201e-19
Identity = 46/113 (40.71%), Postives = 67/113 (59.29%), Query Frame = 3
Query: 1059 TVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQ 1397
             VVG+P+WMAPE+L G+ YN  VD++++GII CE+  RI A P+FL R  +D  +D + F    +D     CP    ++   CC   PD RP F+ +++ LE    R S+ LQ
Sbjct:  207 AVVGSPYWMAPEVLRGERYNEKVDVFAYGIILCEIIGRIQADPDFLPR-TEDFGLDVEAFRLMVED-----CPAHFFNLAVVCCGMSPDSRPCFSEVVAELEK---RESDELQ 310          
BLAST of LIM domain kinase vs. Ensembl Xenopus
Match: exoc6 (exocyst complex component 6 [Source:Xenbase;Acc:XB-GENE-1013433])

HSP 1 Score: 160.999 bits (406), Expect = 1.464e-43
Identity = 109/366 (29.78%), Postives = 169/366 (46.17%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL---NPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLS 1385
            R+ S    +   +++    +    E LG+G FGRAIKV +  TG   VMKE++   ++ +++ + EV ++RSL H N+L  +G++ K+ R+ LLTE +  G+L+  ++D        QK+ F +DIA GM +LH  SI+HRDL S NCL++ + T VV+DFGLS+ +    P     R P                      T  R + +N + + +  V N   +  E  N                                        GK Y+  VD++SFGI+ CE+  ++ A P+ L R   D  ++ + F EK   K   +CP     +   CC  +PD+RP F      L D L  LS
Sbjct:  115 RSESLRCGVGGAQQIFRPCELLHGEELGKGFFGRAIKVTHRATGRVMVMKELIQFDEQTQKNFLTEVKVMRSLDHPNVLRFIGVLYKDGRLNLLTEFIECGTLKDYLRD---YCPWQQKVSFAKDIACGMAYLHSMSIIHRDLNSHNCLIKLDGTTVVADFGLSRLIVEEKPLPAPDRPP----------------------TKKRTLRKNNRKKRYTVVGNPYWMAPEMLN----------------------------------------GKDYDEKVDIFSFGIVLCEIIGQVYADPDCLPR-TLDFGLNVRLFWEKFVPK---DCPPGFFPLATSCCHLEPDQRPDF----PHLHDALTALS 407          
BLAST of LIM domain kinase vs. Ensembl Xenopus
Match: exoc6 (exocyst complex component 6 [Source:Xenbase;Acc:XB-GENE-1013433])

HSP 1 Score: 158.688 bits (400), Expect = 3.502e-42
Identity = 108/366 (29.51%), Postives = 168/366 (45.90%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL---NPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLS 1385
            R+ S    +   +++    +    E LG+G FGRAIKV +  TG   VMKE++   ++ +++ + EV ++RSL H N+L  +G++ K+ R+ LLTE +  G+L+  ++         QK+ F +DIA GM +LH  SI+HRDL S NCL++ + T VV+DFGLS+ +    P     R P                      T  R + +N + + +  V N   +  E  N                                        GK Y+  VD++SFGI+ CE+  ++ A P+ L R   D  ++ + F EK   K   +CP     +   CC  +PD+RP F      L D L  LS
Sbjct:  186 RSESLRCGVGGAQQIFRPCELLHGEELGKGFFGRAIKVTHRATGRVMVMKELIQFDEQTQKNFLTEVKVMRSLDHPNVLRFIGVLYKDGRLNLLTEFIECGTLKDYLR--ADYCPWQQKVSFAKDIACGMAYLHSMSIIHRDLNSHNCLIKLDGTTVVADFGLSRLIVEEKPLPAPDRPP----------------------TKKRTLRKNNRKKRYTVVGNPYWMAPEMLN----------------------------------------GKDYDEKVDIFSFGIVLCEIIGQVYADPDCLPR-TLDFGLNVRLFWEKFVPK---DCPPGFFPLATSCCHLEPDQRPDF----PHLHDALTALS 479          
BLAST of LIM domain kinase vs. Ensembl Xenopus
Match: exoc6 (exocyst complex component 6 [Source:Xenbase;Acc:XB-GENE-1013433])

HSP 1 Score: 159.458 bits (402), Expect = 3.669e-42
Identity = 117/405 (28.89%), Postives = 181/405 (44.69%), Query Frame = 3
Query:  216 SIDLSDKTYRPQNRQEL--SNIESTSP----------LPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL---NPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLS 1385
            SI+    T  P  R  +  SN  + SP          + R+ S    +   +++    +    E LG+G FGRAIKV +  TG   VMKE++   ++ +++ + EV ++RSL H N+L  +G++ K+ R+ LLTE +  G+L+  ++         QK+ F +DIA GM +LH  SI+HRDL S NCL++ + T VV+DFGLS+ +    P     R P                      T  R + +N + + +  V N   +  E  N                                        GK Y+  VD++SFGI+ CE+  ++ A P+ L R   D  ++ + F EK   K   +CP     +   CC  +PD+RP F      L D L  LS
Sbjct:  192 SIEARGSTEGPMKRSSIRRSNSNTRSPGTCCPKDPRSVSRSESLRCGVGGAQQIFRPCELLHGEELGKGFFGRAIKVTHRATGRVMVMKELIQFDEQTQKNFLTEVKVMRSLDHPNVLRFIGVLYKDGRLNLLTEFIECGTLKDYLR--ADYCPWQQKVSFAKDIACGMAYLHSMSIIHRDLNSHNCLIKLDGTTVVADFGLSRLIVEEKPLPAPDRPP----------------------TKKRTLRKNNRKKRYTVVGNPYWMAPEMLN----------------------------------------GKDYDEKVDIFSFGIVLCEIIGQVYADPDCLPR-TLDFGLNVRLFWEKFVPK---DCPPGFFPLATSCCHLEPDQRPDF----PHLHDALTALS 524          
BLAST of LIM domain kinase vs. Ensembl Xenopus
Match: exoc6 (exocyst complex component 6 [Source:Xenbase;Acc:XB-GENE-1013433])

HSP 1 Score: 158.303 bits (399), Expect = 4.780e-42
Identity = 108/366 (29.51%), Postives = 168/366 (45.90%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL---NPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLS 1385
            R+ S    +   +++    +    E LG+G FGRAIKV +  TG   VMKE++   ++ +++ + EV ++RSL H N+L  +G++ K+ R+ LLTE +  G+L+  ++         QK+ F +DIA GM +LH  SI+HRDL S NCL++ + T VV+DFGLS+ +    P     R P                      T  R + +N + + +  V N   +  E  N                                        GK Y+  VD++SFGI+ CE+  ++ A P+ L R   D  ++ + F EK   K   +CP     +   CC  +PD+RP F      L D L  LS
Sbjct:  182 RSESLRCGVGGAQQIFRPCELLHGEELGKGFFGRAIKVTHRATGRVMVMKELIQFDEQTQKNFLTEVKVMRSLDHPNVLRFIGVLYKDGRLNLLTEFIECGTLKDYLR--ADYCPWQQKVSFAKDIACGMAYLHSMSIIHRDLNSHNCLIKLDGTTVVADFGLSRLIVEEKPLPAPDRPP----------------------TKKRTLRKNNRKKRYTVVGNPYWMAPEMLN----------------------------------------GKDYDEKVDIFSFGIVLCEIIGQVYADPDCLPR-TLDFGLNVRLFWEKFVPK---DCPPGFFPLATSCCHLEPDQRPDF----PHLHDALTALS 475          
BLAST of LIM domain kinase vs. Ensembl Xenopus
Match: limk1 (LIM domain kinase 1 [Source:NCBI gene;Acc:780362])

HSP 1 Score: 145.976 bits (367), Expect = 2.357e-37
Identity = 83/230 (36.09%), Postives = 137/230 (59.57%), Query Frame = 3
Query:  141 DFDFQSNPTIKNGGNSSNLKRHQ----TCSIDLSDKTY---RPQ-NRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPE 806
            + D    PT+ +      ++R +    +CSID S  +     P  +R+++S  ES     RT +    I  P  L+P       EVLG+G FG+AIKV +  TG   VMKE++   +E + + +KEV ++R L+H N+L  +G++ K+KR+  +TE + GG+L+  I+ ++     +Q++ F RDIA GM +LH  +I+HRDL S NCL+R++ ++VV+DFGL++ +  E
Sbjct:  203 EHDPHETPTLPSPCTEITVRRQRPIMRSCSIDRSPGSSCVGSPSCSRRDMSRSESV----RTVTGVHRIFRPSDLMP------GEVLGRGCFGQAIKVTHRVTGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIPGGTLRRVIKSMDAHYPWNQRVSFARDIAAGMTYLHSMNIIHRDLNSHNCLVREDGSLVVADFGLARLVTDE 422          

HSP 2 Score: 100.908 bits (250), Expect = 4.160e-22
Identity = 48/119 (40.34%), Postives = 74/119 (62.18%), Query Frame = 3
Query: 1056 HTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLKMKS 1412
            +TVVGNP+WMAPEM+ G++Y+  VD++S GI+ CE+  R++A P++L R   D  ++ + F+++       NCP         CC  DP+KRP F+ +  WL+ +L  L  NLQL + S
Sbjct:  434 YTVVGNPYWMAPEMINGRSYDESVDVFSCGIVICEIIGRVNADPDYLPR-TMDFGLNVRAFLDRFCPP---NCPPGFFPSAVLCCDLDPEKRPRFSQLQLWLDSLLRHL--NLQLPLSS 546          
BLAST of LIM domain kinase vs. Ensembl Mouse
Match: Limk1 (LIM-domain containing, protein kinase [Source:MGI Symbol;Acc:MGI:104572])

HSP 1 Score: 229.18 bits (583), Expect = 1.970e-67
Identity = 131/419 (31.26%), Postives = 218/419 (52.03%), Query Frame = 3
Query:  156 SNPTIKNGGNSSNLKRHQ----TCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            S+P     G +++  R +    +CSID S     P      S       L R+ S  + +  P ++   +D    EVLG+G FG+AIKV + +TG   VMKE++   +E + + +KEV ++R L+H N+L  +G++ K+KR+  +TE + GG+L+  I++++      Q++ F +DIA+GM +LH  +I+HRDL S NCL+R+N  VVV+DFGL++ +                         ++E N++ +LR + +  + + +                                        TVVGNP+WMAPEM+ G++Y+  VD++SFGI+ CE+  R++A P++L R   D  ++ + F+++       NCP     I  +CC  DP+KRP+F  +  WLE +   LS +L L
Sbjct:  266 SSPVHTPSGQAASSARQKPVLRSCSIDTS-----PGTSSLASPASQRKDLGRSESLRV-VCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKNMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFGLARLM-------------------------IDEKNQSEDLRSLKKPDRKKRY----------------------------------------TVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPR-TMDFGLNVRGFLDRYCPP---NCPPSFFPITVRCCDLDPEKRPSFVKLEQWLETLRMHLSGHLPL 609          
BLAST of LIM domain kinase vs. Ensembl Mouse
Match: Limk1 (LIM-domain containing, protein kinase [Source:MGI Symbol;Acc:MGI:104572])

HSP 1 Score: 228.794 bits (582), Expect = 2.788e-67
Identity = 131/419 (31.26%), Postives = 218/419 (52.03%), Query Frame = 3
Query:  156 SNPTIKNGGNSSNLKRHQ----TCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            S+P     G +++  R +    +CSID S     P      S       L R+ S  + +  P ++   +D    EVLG+G FG+AIKV + +TG   VMKE++   +E + + +KEV ++R L+H N+L  +G++ K+KR+  +TE + GG+L+  I++++      Q++ F +DIA+GM +LH  +I+HRDL S NCL+R+N  VVV+DFGL++ +                         ++E N++ +LR + +  + + +                                        TVVGNP+WMAPEM+ G++Y+  VD++SFGI+ CE+  R++A P++L R   D  ++ + F+++       NCP     I  +CC  DP+KRP+F  +  WLE +   LS +L L
Sbjct:  274 SSPVHTPSGQAASSARQKPVLRSCSIDTS-----PGTSSLASPASQRKDLGRSESLRV-VCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKNMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFGLARLM-------------------------IDEKNQSEDLRSLKKPDRKKRY----------------------------------------TVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPR-TMDFGLNVRGFLDRYCPP---NCPPSFFPITVRCCDLDPEKRPSFVKLEQWLETLRMHLSGHLPL 617          
BLAST of LIM domain kinase vs. Ensembl Mouse
Match: Limk2 (LIM motif-containing protein kinase 2 [Source:MGI Symbol;Acc:MGI:1197517])

HSP 1 Score: 198.749 bits (504), Expect = 9.874e-58
Identity = 126/379 (33.25%), Postives = 203/379 (53.56%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNL-QLKMKSPKDMDN 1430
            R+ S   +  + +++    D    EVLG+G FG+AIKV +  TG   VMKE++   +E +++ + EV ++RSL H N+L  +G++ K+K++ LLTE + GG+L+  ++ ++      QK+ F + I++GM +LH   I+HRDL S NCL++ + TVVV+DFGLS+                                      +V+E K+      VE   + TK+R       + R+ +    RK     +++TVVGNP+WMAPEML GK+Y+  VD++SFGI+ CE+  ++ A P+ L R   D  ++ K F EK       +CP     +   CC+ +P+ RP F    S LED    LS  L +L +  P ++++
Sbjct:  124 RSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSVDP-FPWQQKVRFAKGISSGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRL-------------------------------------IVEERKR----PPVEK--ATTKKR-------TLRKSD----RK-----KRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEIIGQVYADPDCLPR-TLDFGLNVKLFWEKFVP---TDCPPAFFPLAAICCKLEPESRPAF----SKLEDSFEALSLFLGELAIPLPAELED 434          
BLAST of LIM domain kinase vs. Ensembl Mouse
Match: Limk2 (LIM motif-containing protein kinase 2 [Source:MGI Symbol;Acc:MGI:1197517])

HSP 1 Score: 198.749 bits (504), Expect = 2.581e-56
Identity = 126/379 (33.25%), Postives = 203/379 (53.56%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNL-QLKMKSPKDMDN 1430
            R+ S   +  + +++    D    EVLG+G FG+AIKV +  TG   VMKE++   +E +++ + EV ++RSL H N+L  +G++ K+K++ LLTE + GG+L+  ++ ++      QK+ F + I++GM +LH   I+HRDL S NCL++ + TVVV+DFGLS+                                      +V+E K+      VE   + TK+R       + R+ +    RK     +++TVVGNP+WMAPEML GK+Y+  VD++SFGI+ CE+  ++ A P+ L R   D  ++ K F EK       +CP     +   CC+ +P+ RP F    S LED    LS  L +L +  P ++++
Sbjct:  290 RSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSVDP-FPWQQKVRFAKGISSGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRL-------------------------------------IVEERKR----PPVEK--ATTKKR-------TLRKSD----RK-----KRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEIIGQVYADPDCLPR-TLDFGLNVKLFWEKFVP---TDCPPAFFPLAAICCKLEPESRPAF----SKLEDSFEALSLFLGELAIPLPAELED 600          
BLAST of LIM domain kinase vs. Ensembl Mouse
Match: Limk2 (LIM motif-containing protein kinase 2 [Source:MGI Symbol;Acc:MGI:1197517])

HSP 1 Score: 198.749 bits (504), Expect = 4.111e-56
Identity = 126/379 (33.25%), Postives = 203/379 (53.56%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNL-QLKMKSPKDMDN 1430
            R+ S   +  + +++    D    EVLG+G FG+AIKV +  TG   VMKE++   +E +++ + EV ++RSL H N+L  +G++ K+K++ LLTE + GG+L+  ++ ++      QK+ F + I++GM +LH   I+HRDL S NCL++ + TVVV+DFGLS+                                      +V+E K+      VE   + TK+R       + R+ +    RK     +++TVVGNP+WMAPEML GK+Y+  VD++SFGI+ CE+  ++ A P+ L R   D  ++ K F EK       +CP     +   CC+ +P+ RP F    S LED    LS  L +L +  P ++++
Sbjct:  311 RSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSVDP-FPWQQKVRFAKGISSGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRL-------------------------------------IVEERKR----PPVEK--ATTKKR-------TLRKSD----RK-----KRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEIIGQVYADPDCLPR-TLDFGLNVKLFWEKFVP---TDCPPAFFPLAAICCKLEPESRPAF----SKLEDSFEALSLFLGELAIPLPAELED 621          
BLAST of LIM domain kinase vs. UniProt/SwissProt
Match: sp|P53668|LIMK1_MOUSE (LIM domain kinase 1 OS=Mus musculus OX=10090 GN=Limk1 PE=1 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.950e-66
Identity = 131/419 (31.26%), Postives = 218/419 (52.03%), Query Frame = 3
Query:  156 SNPTIKNGGNSSNLKRHQ----TCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            S+P     G +++  R +    +CSID S     P      S       L R+ S  + +  P ++   +D    EVLG+G FG+AIKV + +TG   VMKE++   +E + + +KEV ++R L+H N+L  +G++ K+KR+  +TE + GG+L+  I++++      Q++ F +DIA+GM +LH  +I+HRDL S NCL+R+N  VVV+DFGL++ +                         ++E N++ +LR + +  + + +                                        TVVGNP+WMAPEM+ G++Y+  VD++SFGI+ CE+  R++A P++L R   D  ++ + F+++       NCP     I  +CC  DP+KRP+F  +  WLE +   LS +L L
Sbjct:  274 SSPVHTPSGQAASSARQKPVLRSCSIDTS-----PGTSSLASPASQRKDLGRSESLRV-VCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKNMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFGLARLM-------------------------IDEKNQSEDLRSLKKPDRKKRY----------------------------------------TVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPR-TMDFGLNVRGFLDRYCPP---NCPPSFFPITVRCCDLDPEKRPSFVKLEQWLETLRMHLSGHLPL 617          
BLAST of LIM domain kinase vs. UniProt/SwissProt
Match: sp|P53669|LIMK1_RAT (LIM domain kinase 1 OS=Rattus norvegicus OX=10116 GN=Limk1 PE=1 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 1.593e-62
Identity = 124/414 (29.95%), Postives = 212/414 (51.21%), Query Frame = 3
Query:  159 NPTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
             P+ + G ++      ++CSID S     P     +S       L R+ S  + +  P ++   +D    EVLG+G FG+AIKV + +TG   VMKE++   +E + + +KEV ++R L+H N+L  +G++ K+KR+  +TE + GG+L+  I+ ++      Q++ F +DIA+GM +LH  +I+HRDL S NCL+R+N  VVV+DFGL++ +                         ++E  ++ +LR + +  + + +  V N                                        P+WMAPEM+ G++Y+  VD++SFGI+ CE+  R++A P++L R   D  ++ + F+++       NCP     I  +CC  DP+KRP+F  +  WLE +   L+ +L L
Sbjct:  279 TPSGQAGSSARQKPVLRSCSIDTS-----PGAGSLVSPASQRKDLGRSESLRV-VCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFGLARLM-------------------------IDEKGQSEDLRSLKKPDRKKRYTVVGN----------------------------------------PYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPR-TMDFGLNVRGFLDRYCPP---NCPPSFFPITVRCCDLDPEKRPSFVKLEQWLETLRMHLAGHLPL 617          
BLAST of LIM domain kinase vs. UniProt/SwissProt
Match: sp|Q8QFP8|LIMK1_CHICK (LIM domain kinase 1 OS=Gallus gallus OX=9031 GN=LIMK1 PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 2.260e-58
Identity = 112/350 (32.00%), Postives = 184/350 (52.57%), Query Frame = 3
Query:  351 TDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            +D    EVLG+G FG+AIKV + +TG   VMKE++   +E + + +KEV ++R L+H N+L  +G++ KEKR+  +TE + GG+L+  I+ ++      Q++ F +DIA GM +LH  +I+HRDL S NCL+R+N +VVV+DFGL++ +                                     VDE  +  +   ++N+    ++++ T+  + +                         WMAPEM+ G++Y+  VD++SFGI+ CE+  R+SA P++L R   D  ++ + F+E+        CP     I   CC  DP+KRP+F+ +  WLE +   L   L L
Sbjct:  344 SDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKEKRLNFITEYIKGGTLRGLIKSMDSHYPWSQRVSFAKDIAAGMAYLHSMNIIHRDLNSHNCLVRENKSVVVADFGLARLM-------------------------------------VDEKNQPEH---LQNLKKPDRKKRYTVVGNPY-------------------------WMAPEMINGRSYDEKVDIFSFGIVLCEIIGRVSADPDYLPR-TTDFGLNVRGFLERYCPPA---CPPSFFPIAACCCDLDPEKRPSFSKLEQWLETLRMHLDIRLPL 624          
BLAST of LIM domain kinase vs. UniProt/SwissProt
Match: sp|Q32L23|LIMK2_BOVIN (LIM domain kinase 2 OS=Bos taurus OX=9913 GN=LIMK2 PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 6.623e-56
Identity = 128/379 (33.77%), Postives = 202/379 (53.30%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNL-QLKMKSPKDMDN 1430
            R+ S   +    +++    D    EVLG+G FG+AIKV +  TG   VM E++   +E +++ + EV ++RSL H N+L  +G++ K+K++ LLTE + GG+L+  +++++      QK+ F + IA+GM +LH   I+HRDL S NCL++ + TVVV+DFGLS+                                      +V+E KK      VE   + TK+R                 RKS + ++++TVVGNP+WMAPEML GK+Y+  VD++SFGI+ CE+  ++ A P+ L R   D  ++ K F EK   +E   CP     +   CC+ +P+ RP F    S LED    LS  L +L +  P ++++
Sbjct:  311 RSESLRCSSSCSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMNELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRNVDP-FPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRL-------------------------------------IVEERKK----PPVEK--ATTKKRT---------------LRKS-DRKKRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEIIGQVYADPDCLPR-TLDFGLNVKLFWEKFVPEE---CPPAFFPLAAICCRLEPESRPAF----SKLEDFFEALSLYLGELGIPLPTELED 621          
BLAST of LIM domain kinase vs. UniProt/SwissProt
Match: sp|P53670|LIMK2_RAT (LIM domain kinase 2 OS=Rattus norvegicus OX=10116 GN=Limk2 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 8.903e-56
Identity = 127/378 (33.60%), Postives = 203/378 (53.70%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNL-QLKMKSPKDMD 1427
            R+ S   +  + +++    D    EVLG+G FG+AIKV +  TG   VMKE++   +E +++ + EV ++RSL H N+L  +G++ K+K++ LLTE + GG+L+  +++++      QK+ F + IA+GM +LH   I+HRDL S NCL++ + TVVV+DFGLS+                                      +V+E K+      VE   + TK+R       + R+ +    RK     +++TVVGNP+WMAPEML GK+Y+  VD++SFGI+ CE+  ++ A P+ L R   D  ++ K F EK       +CP     +   CC+ +P+ RP F    S LED    LS  L +L +  P +++
Sbjct:  311 RSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRNVDP-FPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRL-------------------------------------IVEERKR----PPVEK--AATKKR-------TLRKSD----RK-----KRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEIIGQVYADPDCLPR-TLDFGLNVKLFWEKFVP---TDCPPAFFPLAAICCKLEPESRPAF----SKLEDSFEALSLFLGELAIPLPAELE 620          
BLAST of LIM domain kinase vs. TrEMBL
Match: A0A504YNM2 (LIM domain kinase 1 OS=Fasciola gigantica OX=46835 GN=FGIG_05175 PE=4 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 3.554e-71
Identity = 137/360 (38.06%), Postives = 204/360 (56.67%), Query Frame = 3
Query:  330 PKKLLPITDFEEKEVLGQ---GAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQD-LEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKN---KDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSN 1388
            P ++ P  D  + E LG    GAFGRA+KV++ +     V+KEV++  KE+E +L+ E+SL+ SLKH NIL C+G+V ++++ICLLTE +  G L + + D L   ++   ++ F +DIA GM+FLHQ++++HRDLT+ NCL+R++N+VVVSDFGLSK                              + +    R++ + +      +     S     ++TI   +FRR  +  KR        HTVVG+PFWMAPEMLA K Y+  VD+YSFGII C++ AR  A P+ + R +  MSVD + F+      KD+     P+ L+ +  +C   DPD RPTF   +  LED L  L+ 
Sbjct:   52 PTEMPPYVDESKLEFLGSIGTGAFGRALKVRHRELDCLLVLKEVLTECKEDEAALVHEISLICSLKHPNILGCMGVVTRKRKICLLTEYIPRGCLHNLVVDPLRHPLSWSLRVSFAKDIAAGMDFLHQHNLLHRDLTTLNCLVRQDNSVVVSDFGLSKL-----------------------------VCQPRGFRLIGKEQ------TRAPSDSGNPTEESTIKPTNFRRHGVRPKR--------HTVVGSPFWMAPEMLADKPYDNAVDVYSFGIILCQLLARCDADPDHIPRDHNCMSVDMQQFLAAELVPKDR-----PDVLVALATQCVALDPDSRPTFLDCLERLEDCLLHLTT 363          
BLAST of LIM domain kinase vs. TrEMBL
Match: A0A4S2LTL7 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004944 PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 4.440e-70
Identity = 143/377 (37.93%), Postives = 217/377 (57.56%), Query Frame = 3
Query:  288 PLPRTNSFNLNIDFPKKLL----PIT---DFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDL--EQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNN 1391
            P P  N   L  ++  +LL    P+      E  E +  GAFGRA+KV++ + G + V+KEV+++SKENE++LI+EVS+LR+LKH NILTCL +V++ KR+CL+TE +  GS+   + D   EQ  +   ++ F RDIATGM F+H+N+I+HRDLT+ NCL R++ +VVVSDFGLSK + P+     S    +   Q   S E   E+N+N+ +                + S+++  R+       FR              R HTVVG+PF MAPEMLAGK Y+  VD+YSFG+I C++ A   + P+ + R +  + +D   F+  + +  L + P  LI+   +C    P  RP+FN+   WL++ L  L++ 
Sbjct:   28 PSPERNRSGLCREYSVRLLEELPPVLKELQLEILETIAAGAFGRAVKVRHRQLGCHLVVKEVLNNSKENEQTLIREVSVLRNLKHPNILTCLAIVVRNKRLCLVTEYIDRGSVHQILLDSPEEQPPSFCTRVSFARDIATGMAFIHENNIVHRDLTTHNCLARQDGSVVVSDFGLSKIIQPDPPHDWSLEQATHKNQIHLSYEEETELNKNSEM--------------TNSGSNLSNGRRR-----PFR-------------SRCHTVVGSPFSMAPEMLAGKPYDQSVDVYSFGVIICQLLALCDSDPDHIPRCSDTLCIDVDAFMATHSNI-LKDGPPVLINAARQCLSFQPADRPSFNSCRDWLDECLLYLTSG 371          
BLAST of LIM domain kinase vs. TrEMBL
Match: A0A4S2LTK0 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004944 PE=4 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 5.994e-70
Identity = 143/377 (37.93%), Postives = 217/377 (57.56%), Query Frame = 3
Query:  288 PLPRTNSFNLNIDFPKKLL----PIT---DFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDL--EQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNN 1391
            P P  N   L  ++  +LL    P+      E  E +  GAFGRA+KV++ + G + V+KEV+++SKENE++LI+EVS+LR+LKH NILTCL +V++ KR+CL+TE +  GS+   + D   EQ  +   ++ F RDIATGM F+H+N+I+HRDLT+ NCL R++ +VVVSDFGLSK + P+     S    +   Q   S E   E+N+N+ +                + S+++  R+       FR              R HTVVG+PF MAPEMLAGK Y+  VD+YSFG+I C++ A   + P+ + R +  + +D   F+  + +  L + P  LI+   +C    P  RP+FN+   WL++ L  L++ 
Sbjct:   55 PSPERNRSGLCREYSVRLLEELPPVLKELQLEILETIAAGAFGRAVKVRHRQLGCHLVVKEVLNNSKENEQTLIREVSVLRNLKHPNILTCLAIVVRNKRLCLVTEYIDRGSVHQILLDSPEEQPPSFCTRVSFARDIATGMAFIHENNIVHRDLTTHNCLARQDGSVVVSDFGLSKIIQPDPPHDWSLEQATHKNQIHLSYEEETELNKNSEM--------------TNSGSNLSNGRRR-----PFR-------------SRCHTVVGSPFSMAPEMLAGKPYDQSVDVYSFGVIICQLLALCDSDPDHIPRCSDTLCIDVDAFMATHSNI-LKDGPPVLINAARQCLSFQPADRPSFNSCRDWLDECLLYLTSG 398          
BLAST of LIM domain kinase vs. TrEMBL
Match: A0A3R7GPJ4 (LIM domain kinase 1 OS=Clonorchis sinensis OX=79923 GN=Limk1 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.300e-68
Identity = 142/376 (37.77%), Postives = 214/376 (56.91%), Query Frame = 3
Query:  294 PRTNSFNLNIDFPKKLL----PI---TDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDL--EQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTN-LRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNN 1391
            P  N   L  ++  +LL    P+   +  E  E +  GAFGRA+KV++ + G   V+KEV+++SKENEE+L++EVS+LR+L H NILTCL +V++ KR+CL+TE +  GS+   + D   EQ  ++  ++ F RDIATGM F+H+N+I+HRDLT+ NCL R++ +VVVSDFGLSK + P+     S                L +     N + + DE          E  ++   E  N+ ++ S  R   +         R HTVVG+PF MAPEMLAGK Y+  VD+YSFG+I C++ A   + P+ + R +  + VD   F+  + D  L + P  LI+   +C    P  RP+FN+   WL++ L  L++ 
Sbjct:  105 PEQNRSGLCREYSVRLLEEVPPVLNESQLEILETIAAGAFGRAMKVRHRQLGCLLVVKEVLNNSKENEETLVREVSVLRNLTHPNILTCLAIVVRNKRLCLVTEYIDRGSIHQILLDSPEEQPPSICTRVSFARDIATGMAFIHENNIIHRDLTTHNCLARQDGSVVVSDFGLSKIIQPDPPHDWS----------------LEQAKHKMNQMHLSDEE---------ETETNKDSEMSNSGSNLSNGRRRPFRP-------RCHTVVGSPFSMAPEMLAGKPYDQSVDVYSFGVILCQLLALCDSDPDHIPRCSDTLCVDVDAFMATHSDI-LKDGPPLLINAARQCLSFQPADRPSFNSCRDWLDECLLYLTSG 447          
BLAST of LIM domain kinase vs. TrEMBL
Match: A0A074ZYU3 (Protein kinase domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_01312 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 4.310e-66
Identity = 146/406 (35.96%), Postives = 214/406 (52.71%), Query Frame = 3
Query:  288 PLPRTNSFNLNIDFPKKLL----PI---TDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKE-------------------------VSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDL--EQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEIL----NEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNN 1391
            P P  N   L  ++  +LL    P+   +  E  E +  GAFGRA+KV++ + G   V+KEV+++SKENEE+LI+E                         VS+LR+LKH NILTCL +V++ KR+CL+TE +  GS+   + +   EQ  +   ++ F RDIATGM F+H+N+I+HRDLT+ NCL R++ +VVVSDFGLSK + P+      PY  S+   +   +++      E   N NL + D    L N                               R+     R HTVVG+PF MAPEMLAGK Y+  VD+YSFG+I C++ A   + P+ + R +  + VD   F+  + D  L + P  LI+   +C    P  RP+FNT   WL++ L  L++ 
Sbjct:   37 PSPERNRSGLCREYSVRLLEELPPVLKESQLEILETIAAGAFGRAVKVRHRQFGCLLVVKEVLNNSKENEETLIRELPDRNKTVFLVLSDFSFLCGIPFEKVSVLRNLKHPNILTCLAIVVRNKRLCLVTEYIDRGSIHQILLNSPEEQPPSFCTRVSFARDIATGMAFIHENNIIHRDLTTHNCLARQDGSVVVSDFGLSKIIQPD-----PPYDWSLEQAKHKMNQMHLSDEEETETNKNLEMTDSGSNLSN------------------------------GRRRPVRPRCHTVVGSPFSMAPEMLAGKPYDQSVDVYSFGVIICQLLALCDSDPDHIPRCSDTLCVDVNAFMATHSDI-LKDGPPVLINAARQCLSFQPADRPSFNTCRDWLDECLLYLTSG 406          
BLAST of LIM domain kinase vs. Ensembl Cavefish
Match: limk1b (LIM domain kinase 1-like [Source:NCBI gene;Acc:103039384])

HSP 1 Score: 218.779 bits (556), Expect = 6.957e-64
Identity = 128/403 (31.76%), Postives = 215/403 (53.35%), Query Frame = 3
Query:  201 RH--QTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLN-IDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            RH  ++CSID S     P +   L  +     + R+ S  ++ ID  +++   +D    EVLG+G FG+AIKV + +TG   VMKE++   +E +++ +KEV ++R L H N+L  +G++ K+KR+ L++E + GG+L+  I+ ++     + ++ + +DI+ GM +LH  +++HRDL S NCL+++N TVVV+DFGL+                                      R+V E+K  R   + E IS+ T ++                       ++++TVVGNP+WMAPEM+ G +Y+  VD++SFGII CE+  R+ A P++L R   +  +   +F+E+    E   CP     +   CC ++ +KRPTF  +  WLE++L  L   L +
Sbjct:  249 RHILRSCSIDKS-----PCSHSHLPLLSHRRDINRSESLRIDPIDKTQRIFRPSDLINGEVLGKGFFGQAIKVTHQETGEVMVMKELLRFDEETQQTFLKEVKVMRCLDHPNVLKFIGILFKDKRLNLISEYVPGGTLRETIEKMDSNYPWNLRVSYAKDISAGMAYLHSMNVIHRDLNSHNCLVKENKTVVVADFGLA--------------------------------------RLVMEDKPQRRNSTPEQISTGTLKKPQR--------------------KKRYTVVGNPYWMAPEMMRGISYDERVDIFSFGIILCEIIGRVYADPDYLPR-TMEFGLGVNEFLERYYPTE---CPPSFFPLAALCCDTETEKRPTFAKLEEWLENLLMHLDIRLPV 584          
BLAST of LIM domain kinase vs. Ensembl Cavefish
Match: limk1a (LIM domain kinase 1 [Source:NCBI gene;Acc:103047204])

HSP 1 Score: 141.354 bits (355), Expect = 8.960e-36
Identity = 66/167 (39.52%), Postives = 110/167 (65.87%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            R+ S  +  +   ++   +D    EVLG+G FG+AIKV + +TG   VMKE++    E + + +KEV ++R L H N+L  +G++ K+KR+  + E + GG+L+  I+ ++      Q++ F +DIA+GM +LH  +I+HRDL S NCL+R+NN+VVV+DFGL++ +
Sbjct:  326 RSESLRVVTNRTHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDDETQMTFLKEVKVMRCLDHPNVLKFIGVLYKDKRLNFIAEYIKGGTLRDIIKKMDSNYPWIQRVSFAKDIASGMTYLHSMNIIHRDLNSHNCLVRENNSVVVADFGLARLM 492          

HSP 2 Score: 105.145 bits (261), Expect = 1.263e-23
Identity = 48/123 (39.02%), Postives = 75/123 (60.98%), Query Frame = 3
Query: 1032 KSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            K  + R+++TVVGNP+WMAPEM+ GK+Y+  VD++SFGI+ CE+  R++A P++L R   D  ++ K F+E    ++   CP     +   CC  D +KRP F  +  WLE++   L   L +
Sbjct:  508 KKPDRRKRYTVVGNPYWMAPEMIHGKSYDEKVDIFSFGIMLCEIIGRVNADPDYLPR-AMDFGLNVKGFLEHYYPQD---CPSTFFPMAALCCDLDAEKRPAFAKLEEWLENLKMHLEMRLPV 626          
BLAST of LIM domain kinase vs. Ensembl Cavefish
Match: limk1a (LIM domain kinase 1 [Source:NCBI gene;Acc:103047204])

HSP 1 Score: 141.354 bits (355), Expect = 8.960e-36
Identity = 66/167 (39.52%), Postives = 110/167 (65.87%), Query Frame = 3
Query:  297 RTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            R+ S  +  +   ++   +D    EVLG+G FG+AIKV + +TG   VMKE++    E + + +KEV ++R L H N+L  +G++ K+KR+  + E + GG+L+  I+ ++      Q++ F +DIA+GM +LH  +I+HRDL S NCL+R+NN+VVV+DFGL++ +
Sbjct:  326 RSESLRVVTNRTHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDDETQMTFLKEVKVMRCLDHPNVLKFIGVLYKDKRLNFIAEYIKGGTLRDIIKKMDSNYPWIQRVSFAKDIASGMTYLHSMNIIHRDLNSHNCLVRENNSVVVADFGLARLM 492          

HSP 2 Score: 105.145 bits (261), Expect = 1.263e-23
Identity = 48/123 (39.02%), Postives = 75/123 (60.98%), Query Frame = 3
Query: 1032 KSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            K  + R+++TVVGNP+WMAPEM+ GK+Y+  VD++SFGI+ CE+  R++A P++L R   D  ++ K F+E    ++   CP     +   CC  D +KRP F  +  WLE++   L   L +
Sbjct:  508 KKPDRRKRYTVVGNPYWMAPEMIHGKSYDEKVDIFSFGIMLCEIIGRVNADPDYLPR-AMDFGLNVKGFLEHYYPQD---CPSTFFPMAALCCDLDAEKRPAFAKLEEWLENLKMHLEMRLPV 626          
BLAST of LIM domain kinase vs. Ensembl Cavefish
Match: limk2 (LIM domain kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040718-398])

HSP 1 Score: 141.354 bits (355), Expect = 1.017e-35
Identity = 73/188 (38.83%), Postives = 122/188 (64.89%), Query Frame = 3
Query:  234 KTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            K+  P + +EL ++     + R+ S   +     ++    D    EVLG+G FG+AIKV +  TG   VMKE++   +E +++ +KEV ++RSL H N+L  +G++ K+KR+ L+TE + GG+L+  I+D++    + Q++ F + IA+GM +LH  +I+HRDL S NCL++ +NTVVV+DFGLS+ +
Sbjct:  297 KSPGPTSPKELPSLNRD--IGRSESLRASSSCSHRIFRPCDLIHGEVLGKGFFGQAIKVTHKATGEVMVMKELIRCDEETQKTFLKEVKVMRSLDHPNVLRFIGVLYKDKRLNLITEFIEGGTLKDFIRDMDPFPWM-QRVSFAKGIASGMAYLHSVNIIHRDLNSHNCLVKLDNTVVVADFGLSRLV 481          
BLAST of LIM domain kinase vs. Ensembl Cavefish
Match: limk2 (LIM domain kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040718-398])

HSP 1 Score: 140.969 bits (354), Expect = 1.320e-35
Identity = 73/188 (38.83%), Postives = 122/188 (64.89%), Query Frame = 3
Query:  234 KTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            K+  P + +EL ++     + R+ S   +     ++    D    EVLG+G FG+AIKV +  TG   VMKE++   +E +++ +KEV ++RSL H N+L  +G++ K+KR+ L+TE + GG+L+  I+D++    + Q++ F + IA+GM +LH  +I+HRDL S NCL++ +NTVVV+DFGLS+ +
Sbjct:  297 KSPGPTSPKELPSLNRD--IGRSESLRASSSCSHRIFRPCDLIHGEVLGKGFFGQAIKVTHKATGEVMVMKELIRCDEETQKTFLKEVKVMRSLDHPNVLRFIGVLYKDKRLNLITEFIEGGTLKDFIRDMDPFPWM-QRVSFAKGIASGMAYLHSVNIIHRDLNSHNCLVKLDNTVVVADFGLSRLV 481          
BLAST of LIM domain kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000175.1 (pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 gene:ENSPMAG00000000155.1 transcript:ENSPMAT00000000175.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 4.840e-19
Identity = 48/150 (32.00%), Postives = 80/150 (53.33%), Query Frame = 3
Query:  360 EEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSN--CLLRKNNTVVVSDFGLSKFLNP 803
            ++K+VLG G FGR  K     +G     K + +   + ++ +  E+S++  LKHNN+L        +    L+ E +HGG L  +I   +  +T    I+F+R I  G++++HQ  I+H DL   N  C+ RK N + + DFGL++   P
Sbjct:   34 KQKDVLGGGRFGRVHKCVERTSGMTLAAKVIKAKGVKEKDEVNNEISIMNQLKHNNLLQLYDAYESKNDFVLIMEYIHGGELFDRIVSEDYNLTELDAIIFIRQICEGIHYMHQQYILHLDLKPENILCVNRKGNQIKIIDFGLARRYKP 183          
BLAST of LIM domain kinase vs. Ensembl Sea Lamprey
Match: EPHB2 (EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393])

HSP 1 Score: 88.5817 bits (218), Expect = 7.037e-19
Identity = 50/148 (33.78%), Postives = 80/148 (54.05%), Query Frame = 3
Query:  366 KEVLGQGAFGRAIKVQYLKTG---AYYVMKEVVS-HSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            ++V+G G FG   + +    G    Y  +K + S ++++     + E S++    H NI+   G+V K + + ++TE M  GSL S ++  +   TV Q +  LR IA GM +L   + +HRDL + N L+  N    VSDFGLS+FL
Sbjct:  583 EQVIGSGEFGEVCRGRLRMPGKREMYVAIKTLKSAYTEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSDMNYVHRDLAARNILVNSNLVCKVSDFGLSRFL 730          
BLAST of LIM domain kinase vs. Ensembl Sea Lamprey
Match: mylka (myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8207])

HSP 1 Score: 87.4261 bits (215), Expect = 2.417e-18
Identity = 50/164 (30.49%), Postives = 89/164 (54.27%), Query Frame = 3
Query:  357 FEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSN--CLLRKNNTVVVSDFGLSK-----------FLNPEF 809
            ++ KE LG G FG+  K+   K+G  +  K + + + +++ES+ +E++L+ SL H  ++ C+     +  I ++ EL+ GG L  +I D +  +T  + I ++R I  G+ F+H+  I+H DL   N  CL +  N + + DFGL++           F  PEF
Sbjct: 1394 YDVKERLGTGRFGQVFKLVEKKSGKTFAGKFIKALTAKDKESIHQEIALMNSLHHPKLVQCVDAFESKTDIIMVLELISGGELFERIIDEDFELTERECIKYMRQIVEGVQFMHRQGIVHLDLKPENIMCLNQTGNRIKIIDFGLARKLENVKNLKVMFGTPEF 1557          
BLAST of LIM domain kinase vs. Ensembl Sea Lamprey
Match: ephb1 (EPH receptor B1 [Source:ZFIN;Acc:ZDB-GENE-070912-219])

HSP 1 Score: 85.8853 bits (211), Expect = 3.038e-18
Identity = 48/148 (32.43%), Postives = 77/148 (52.03%), Query Frame = 3
Query:  366 KEVLGQGAFGRA----IKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            ++V+G G FG      +K+   +  A  +      +++      + E S++    H N++   G+V K + + ++TE M  GSL S ++  +   TV Q +  LR IA GM +L   S +HRDL + N L+  N    VSDFGLS+FL
Sbjct:  358 EQVIGAGEFGEVCSGRLKLPGKREMAVAIKTLKAGYTERQRRDFLSEASIMGQFDHPNVIHLEGVVTKSRPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMSYVHRDLAARNILVNSNLVCKVSDFGLSRFL 505          
BLAST of LIM domain kinase vs. Ensembl Sea Lamprey
Match: mylk3 (myosin light chain kinase 3 [Source:NCBI gene;Acc:561635])

HSP 1 Score: 78.9518 bits (193), Expect = 1.610e-16
Identity = 51/174 (29.31%), Postives = 85/174 (48.85%), Query Frame = 3
Query:  294 PRTNSFNLNIDFPKKLLPITDFE--EKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSN--CLLRKNNTVVVSDFGLSKFLNP 803
            P    FN  I  P+ +   T F     +VLG G FGR ++ Q   +G     K +   S + +E +  E++++  L H N++           I L+ E + GG L ++I D +  ++    +LF+R I  G++++HQ  I+H DL   N  CL R    + + DFGL++   P
Sbjct:    4 PPPAPFNHRIVSPRSITVGTYFSLSHSDVLGGGRFGRVMRCQEKSSGLTLAAKVIRVKSPKEKEEVKNEINIMNQLNHVNLVQLFDAYESRSDITLIMEYVEGGELFNRIID-QSGLSELDTVLFVRQICEGVHYMHQQYILHLDLKPENILCLSRWGYQIKIIDFGLARRYKP 176          
BLAST of LIM domain kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 87.8113 bits (216), Expect = 9.756e-19
Identity = 46/148 (31.08%), Postives = 82/148 (55.41%), Query Frame = 3
Query:  357 FEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLN 800
            +  K+V+G+G++G   K     T     +KEVV  + E    ++ E+SLL++L HNNI+   G + K   + +L E    GSL+  I      ++ ++   ++     G+ +LH   ++HRD+ ++N LL  +NTV ++DFG+S  +N
Sbjct:   25 YHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVN 172          
BLAST of LIM domain kinase vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 75.485 bits (184), Expect = 8.364e-15
Identity = 50/152 (32.89%), Postives = 78/152 (51.32%), Query Frame = 3
Query:  369 EVLGQGAFGRAIKVQYLKTGAYYVMK--EVVSHSKENE------ESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQ---DLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSK 791
            E++G+G+FG       + TG    +K  EV  +S +NE      E+L  EVS L+ L H NI+  LG   K     L  E + GGS+ S I+     ++ +  H     L+    G+ +LH   I+HRD+ + N LL ++    +SDFG+S+
Sbjct: 1179 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLK----GLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISR 1326          

HSP 2 Score: 46.595 bits (109), Expect = 8.969e-6
Identity = 35/122 (28.69%), Postives = 56/122 (45.90%), Query Frame = 3
Query: 1017 IYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKT-YNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEK--------CCQSDPDKRPTFNTIIS 1355
            I  K K +      T+ G  FWMAPEM+  K  Y+  VD++S G I  E+ A         +R   ++ V      +  K K     PE+ + ++ +        C + +P+KRPT N ++S
Sbjct: 1324 ISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAG--------KRPWSNLEV-VAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLS 1436          
BLAST of LIM domain kinase vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 72.7886 bits (177), Expect = 1.215e-14
Identity = 46/152 (30.26%), Postives = 79/152 (51.97%), Query Frame = 3
Query:  351 TDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEES-LIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGG---SLQSK-IQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSK 791
            + F++ E LG G +    K     TG Y  +KEV   S+E   S  I+E+SL++ LKH NI+    ++  E ++ L+ E M       + S+ + +  + + ++    F   +  G+ F H+N I+HRDL   N L+ K   + + DFGL++
Sbjct:    5 SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLAR 156          
BLAST of LIM domain kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 73.559 bits (179), Expect = 2.932e-14
Identity = 47/153 (30.72%), Postives = 84/153 (54.90%), Query Frame = 3
Query:  357 FEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENE-ESLIKEVSLLRSLKH-NNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDL---EQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLN 800
            F+  EV+G+G FG   K   +KTG  Y +K +   S  +E E + +E+  L SLK  +NI    G  LK+  + ++ E   GGSL+S ++     E+ I V      +R++   +  +H+++++HRD+ ++N L+     V + DFG++  +N
Sbjct:   23 FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGKIDEKYIGV-----IMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVN 170          
BLAST of LIM domain kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 70.0922 bits (170), Expect = 1.750e-13
Identity = 43/154 (27.92%), Postives = 77/154 (50.00%), Query Frame = 3
Query:  348 ITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMK----EVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            + DF+    LG G+FGR   ++    G YY MK    E+V   K+ E +   E  +L  + H  I+   G     ++I ++ + + GG L S ++  ++      K  +  ++   + +LH   I++RDL   N LL KN  + ++DFG +K++
Sbjct:   84 LQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHT-NDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAK-FYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV 235          
BLAST of LIM domain kinase vs. Ensembl Nematostella
Match: EDO44183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWK9])

HSP 1 Score: 134.42 bits (337), Expect = 6.753e-34
Identity = 78/213 (36.62%), Postives = 128/213 (60.09%), Query Frame = 3
Query:  171 KNGGNSSNLKRHQTCSIDLSDKTYR-PQNRQELSNIESTSPLPRTNSFNLNIDFPKK--LLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNN--TVVVSDFGLSKF 794
            +N    SNL R +   +  S  T++ P  + E+    +  P+ R  S +    F K+   LP  D    EV+G+G FG+ +KV +  TG   V+KE++++  E +   +KEV+LL+SL+H N+L  +G++ K K + L+ E + GG+LQ  ++D  + ++  QK+   RDIA GM +LH+ ++MHRDL S+NCL+  +   TVVV+DFGL++ 
Sbjct:  259 RNTLPRSNLTRTKDNPVLSSTSTFKFPATKIEIPPTTTQRPIQRAKSVSY---FSKRAVFLP-KDLIVGEVIGRGFFGQVMKVTHKTTGEVMVLKELINYDDEAKAGFLKEVALLKSLQHPNVLHFIGILYKGKTLNLIVEYIPGGTLQRVLKDKSRPLSWAQKVKISRDIAAGMAYLHEMNVMHRDLNSNNCLVHNDEEMTVVVADFGLARL 467          

HSP 2 Score: 102.064 bits (253), Expect = 3.924e-23
Identity = 47/118 (39.83%), Postives = 67/118 (56.78%), Query Frame = 3
Query: 1047 RRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            ++++TVVG P+WMAPEM  G+ Y+  VD+++F I+ CE+  R+ A P++L R  KD +VD   F    + K    CP     +   C   DPDKRP F T+  WL+ I   L   L L
Sbjct:  482 KKRYTVVGTPYWMAPEMFNGRDYDHRVDIFAFCIVACEIIGRVEADPDYLPR-KKDFTVDEDSF----RMKFCAGCPAVFYKLAFLCGHLDPDKRPPFETVREWLDAIYLHLEVGLPL 594          
BLAST of LIM domain kinase vs. Ensembl Nematostella
Match: EDO46137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM9])

HSP 1 Score: 102.834 bits (255), Expect = 3.139e-23
Identity = 55/141 (39.01%), Postives = 86/141 (60.99%), Query Frame = 3
Query:  375 LGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNT---VVVSDFGLS 788
            L  G FG   K ++  T    V+KE  +H  E + SL+KEV  LR L H NI+  +G+ +K+ ++ L+TE ++GG+L+  + + E+ +    ++   RDIA+GM FLHQ   +HRDLTS NCL++  N     +V+D GL+
Sbjct:  103 LANGFFGEIFKAEHKITKKTMVIKEE-THCNE-DCSLLKEVDFLRRLSHPNIVRFIGICIKDNKVSLITEFVNGGNLEELLMNHEETLNWATRVYLARDIASGMAFLHQKRFLHRDLTSKNCLIKIANGERYGIVADLGLA 241          

HSP 2 Score: 79.337 bits (194), Expect = 9.054e-16
Identity = 40/106 (37.74%), Postives = 58/106 (54.72%), Query Frame = 3
Query: 1062 VVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFR 1379
             VG+P+ MAPE+L G+ YN   D++S+GII CE+  R+ A PE L R      +D + F     D     CP E +     CCQ DP  RP+F + +  L+ +L +
Sbjct:  254 TVGSPYNMAPEVLRGEMYNGKADVFSYGIILCEIIGRVLADPEELPRTGA-FGLDVEKFSTMVGD-----CPIEFVHTAICCCQMDPKSRPSFMSTVKHLDLVLLQ 353          
BLAST of LIM domain kinase vs. Ensembl Nematostella
Match: EDO47195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN18])

HSP 1 Score: 81.6481 bits (200), Expect = 3.139e-17
Identity = 46/155 (29.68%), Postives = 82/155 (52.90%), Query Frame = 3
Query:  351 TDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSL-----QSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLN 800
            T+   K  LG G +G   +  + K      +K +   + E EE  +KE S+++ +KH N++  LG+  +E    ++TE M  G+L       K +DL+ +  ++        + + M++L   + +HRDL + NCL+  NN V V+DFGLS+ ++
Sbjct:   12 TEIAMKHKLGGGQYGEVYEGTWKKYNKTVAVKTLREETMEVEE-FLKEASVMKGIKHQNLVQLLGVCTREPPFYIITEFMMNGNLLDYLRSPKGKDLDAVTLMYMAT----QVGSAMSYLESMNFIHRDLAARNCLVGDNNLVKVADFGLSRLVS 161          
BLAST of LIM domain kinase vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 80.4925 bits (197), Expect = 4.300e-17
Identity = 42/158 (26.58%), Postives = 85/158 (53.80%), Query Frame = 3
Query:  357 FEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEV--VSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRS 824
            +++ +++G+G FG A  V+  ++   Y +KE+   +   E+    + EV +L +LKH NI+       +  R  ++ E   GG L +KI+   +  +  + + +L  +   +  +H  +I+HRDL + N  L K++ V + DFG+++ L+   D +R+
Sbjct:    4 YQKIDIIGKGTFGSAWLVESRQSKRLYALKELNATAMPSEDRHLALNEVKILSTLKHRNIVRYRDAFEETGRFYIVMEYAEGGDLHTKIKQAVEPFSSERILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHART 161          
BLAST of LIM domain kinase vs. Ensembl Nematostella
Match: EDO41242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z6])

HSP 1 Score: 79.7221 bits (195), Expect = 1.037e-16
Identity = 42/151 (27.81%), Postives = 86/151 (56.95%), Query Frame = 3
Query:  354 DFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRK---NNTVVVSDFGLSKFL 797
            +++  E++G+G+F +  +    KTG  +  KE+     E++E + +E+++ + L+H NI++    + + + +CL+ E + GGSL  ++   +   +  Q  L  R +   + +LH   I+HRD+   N LL++   N T+ ++DFGL++ L
Sbjct:    4 NYDMLELIGEGSFAKVFRCIERKTGLEFAAKELRLTDVEDKEKIEQEIAVWKDLRHENIVSLYSSIREGETVCLIMEYVAGGSLFDEVIQ-QTYYSEKQARLVTRQLLNALEYLHSRRIVHRDIKPDNLLLKRTGNNVTIKLADFGLAQAL 153          
BLAST of LIM domain kinase vs. Ensembl Medaka
Match: limk1b (LIM domain kinase 1 [Source:NCBI gene;Acc:101162943])

HSP 1 Score: 227.639 bits (579), Expect = 3.001e-67
Identity = 128/403 (31.76%), Postives = 219/403 (54.34%), Query Frame = 3
Query:  195 LKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNI-DFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            L   ++CSID       P + + LS +     + R+ S  ++  +   ++   +D    EVLG+G FG+A+KV + +TG   VMKE++   +E + + +KEV ++R L H N+L  +GL  K+KRI  ++E + GG+L+  I  ++Q  +   ++ + +DIA GM +LH  +++HRDL S NCL+R+N++VVV+DFGL++ +  E + SR+                                            SS+ +  +  +++   RR          + R+++TVVGNP+WMAPEM+ GK+Y+  VD++SFGI+ CE+  R+SA P++L R N D  ++   F+++    E   CP   + +   CC  D DKRP+F+ +  WL++++  L+  L L
Sbjct:  239 LSSKRSCSIDKC-----PLSPRALSLLSQRKDMVRSESLRVDPGERTHRIFRPSDLIHGEVLGKGCFGQAVKVTHQETGEVMVMKELIRFDEETQRTFLKEVKVMRCLHHPNVLKFIGLFYKDKRIHFVSEYIQGGTLREAITKMDQDFSWTIRVGYAKDIAAGMAYLHSMNVIHRDLNSFNCLVRENHSVVVADFGLARLVMEEKNQSRT--------------------------------------------SSLERPAKGNLSE--LRRP---------DRRKRYTVVGNPYWMAPEMIHGKSYDERVDIFSFGIMICEIIGRVSADPDYLPRTN-DFGLNVPSFLQQYYPPE---CPSAFLPLAALCCDMDADKRPSFSKLEEWLDNVVMHLNIGLPL 577          
BLAST of LIM domain kinase vs. Ensembl Medaka
Match: limk1b (LIM domain kinase 1 [Source:NCBI gene;Acc:101162943])

HSP 1 Score: 225.713 bits (574), Expect = 2.114e-65
Identity = 128/399 (32.08%), Postives = 219/399 (54.89%), Query Frame = 3
Query:  207 QTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNI-DFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQL 1400
            ++CSID       P + + LS +     + R+ S  ++  +   ++   +D    EVLG+G FG+A+KV + +TG   VMKE++   +E + + +KEV ++R L H N+L  +GL  K+KRI  ++E + GG+L+  I  ++Q  +   ++ + +DIA GM +LH  +++HRDL S NCL+R+N++VVV+DFGL++ +  E + SR+                                            SS+ +  +  +++   RR    ++RK      ++TVVGNP+WMAPEM+ GK+Y+  VD++SFGI+ CE+  R+SA P++L R N D  ++   F+++    E   CP   + +   CC  D DKRP+F+ +  WL++++  L+  L L
Sbjct:  276 RSCSIDKC-----PLSPRALSLLSQRKDMVRSESLRVDPGERTHRIFRPSDLIHGEVLGKGCFGQAVKVTHQETGEVMVMKELIRFDEETQRTFLKEVKVMRCLHHPNVLKFIGLFYKDKRIHFVSEYIQGGTLREAITKMDQDFSWTIRVGYAKDIAAGMAYLHSMNVIHRDLNSFNCLVRENHSVVVADFGLARLVMEEKNQSRT--------------------------------------------SSLERPAKGNLSE--LRRP---DRRK------RYTVVGNPYWMAPEMIHGKSYDERVDIFSFGIMICEIIGRVSADPDYLPRTN-DFGLNVPSFLQQYYPPE---CPSAFLPLAALCCDMDADKRPSFSKLEEWLDNVVMHLNIGLPL 610          
BLAST of LIM domain kinase vs. Ensembl Medaka
Match: limk1a (LIM domain kinase 1-like [Source:NCBI gene;Acc:101168972])

HSP 1 Score: 144.436 bits (363), Expect = 9.410e-37
Identity = 86/247 (34.82%), Postives = 137/247 (55.47%), Query Frame = 3
Query:   69 SKAENQKNGKL----HYNAKSTSDMTEDDFDFQSNPTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            S+A  Q NG L      N   T  +T+        P + N  N  +    ++ SID S     P +    S I     + R+ S  +      ++   +D    EVLG+G FG+AIKV + +TG   VMKE++    E + + +KEV ++R L H N+L  +G++ K+KR+  + E + GG+L+  I+ ++     +Q++ F +DIA GM +LH  +I+HRDL S NCL+R++NTVVV+DFGLS+ +
Sbjct:  265 SEANEQTNGPLCSPQSENPSPTLPITQ--------PPLPNINNLKSRIITRSYSIDKS-----PGSSNAASPIAQRKEINRSESLRVVSSRTHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDDETQRTFLKEVKVMRCLDHPNVLKFIGVLYKDKRLNFIAEYIKGGTLREIIKKMDSNYPWNQRVSFAKDIAAGMAYLHSMNIIHRDLNSYNCLVREDNTVVVADFGLSRLM 498          

HSP 2 Score: 96.6709 bits (239), Expect = 6.548e-21
Identity = 49/124 (39.52%), Postives = 73/124 (58.87%), Query Frame = 3
Query: 1032 KSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLK 1403
            K  + R+++TVVGNP+WMAPEM+ GK+Y+  VD++SFGI+ CE+  R++A P++L R   D  ++   F+E     +   CP     +   CC  D DKRP F  +   LE++   L   L LK
Sbjct:  516 KRHDRRKRYTVVGNPYWMAPEMIHGKSYDERVDIFSFGIMLCEIIGRVNADPDYLPRAT-DFGLNISGFLEHFCPPD---CPPAFFPMAAVCCDLDADKRPPFLKLEELLENLKMHLDIGLPLK 635          
BLAST of LIM domain kinase vs. Ensembl Medaka
Match: limk1a (LIM domain kinase 1-like [Source:NCBI gene;Acc:101168972])

HSP 1 Score: 144.05 bits (362), Expect = 1.146e-36
Identity = 86/247 (34.82%), Postives = 137/247 (55.47%), Query Frame = 3
Query:   69 SKAENQKNGKL----HYNAKSTSDMTEDDFDFQSNPTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            S+A  Q NG L      N   T  +T+        P + N  N  +    ++ SID S     P +    S I     + R+ S  +      ++   +D    EVLG+G FG+AIKV + +TG   VMKE++    E + + +KEV ++R L H N+L  +G++ K+KR+  + E + GG+L+  I+ ++     +Q++ F +DIA GM +LH  +I+HRDL S NCL+R++NTVVV+DFGLS+ +
Sbjct:  271 SEANEQTNGPLCSPQSENPSPTLPITQ--------PPLPNINNLKSRIITRSYSIDKS-----PGSSNAASPIAQRKEINRSESLRVVSSRTHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDDETQRTFLKEVKVMRCLDHPNVLKFIGVLYKDKRLNFIAEYIKGGTLREIIKKMDSNYPWNQRVSFAKDIAAGMAYLHSMNIIHRDLNSYNCLVREDNTVVVADFGLSRLM 504          

HSP 2 Score: 95.9005 bits (237), Expect = 1.215e-20
Identity = 49/124 (39.52%), Postives = 73/124 (58.87%), Query Frame = 3
Query: 1032 KSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLK 1403
            K  + R+++TVVGNP+WMAPEM+ GK+Y+  VD++SFGI+ CE+  R++A P++L R   D  ++   F+E     +   CP     +   CC  D DKRP F  +   LE++   L   L LK
Sbjct:  522 KRHDRRKRYTVVGNPYWMAPEMIHGKSYDERVDIFSFGIMLCEIIGRVNADPDYLPRAT-DFGLNISGFLEHFCPPD---CPPAFFPMAAVCCDLDADKRPPFLKLEELLENLKMHLDIGLPLK 641          
BLAST of LIM domain kinase vs. Ensembl Medaka
Match: limk2 (LIM domain kinase 2 [Source:NCBI gene;Acc:101164484])

HSP 1 Score: 136.346 bits (342), Expect = 4.514e-34
Identity = 66/148 (44.59%), Postives = 104/148 (70.27%), Query Frame = 3
Query:  354 DFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            D    EVLG+G FG+AIKV +  TG   VMKE++   +E +++ +KEV ++RSL+H ++L  +G++ K+KR+ L+TE + GG+L+  I+D +      Q++ F + I +GM +LH  SI+HRDL S NCL++ +NTVVV+DFGLS+ +
Sbjct:  325 DLIHDEVLGKGFFGQAIKVIHKATGEVMVMKELIRCDEETQKTFLKEVKVMRSLEHPHVLRFIGVLYKDKRLNLITEYIEGGTLKDVIRDTDP-FPWEQRVNFAKGITSGMAYLHSMSIIHRDLNSHNCLVKLDNTVVVADFGLSRLI 471          

HSP 2 Score: 97.8265 bits (242), Expect = 3.584e-21
Identity = 48/132 (36.36%), Postives = 76/132 (57.58%), Query Frame = 3
Query: 1032 KSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLKMKSPKDMD 1427
            + ++ ++++TVVGNP+WMAPEML GK Y+  VD++S+GI+ CE+  ++ A PE L R   D  ++   F EK   +   +CP     +   CC   PD RP F  +  W E     LS N +L++  P +++
Sbjct:  491 RRIDRKKRYTVVGNPYWMAPEMLNGKRYDEKVDVFSYGIVLCEIIGKVYADPECLPR-TLDFGLNVCKFAEKFLPE---DCPPAFFPMAVACCDLIPDNRPPFQKLEDWFE----ALSLNQELRIPLPAELE 614          
BLAST of LIM domain kinase vs. Planmine SMEST
Match: SMESG000018804.1 (SMESG000018804.1)

HSP 1 Score: 941.414 bits (2432), Expect = 0.000e+0
Identity = 469/470 (99.79%), Postives = 469/470 (99.79%), Query Frame = 3
Query:   24 MTNPKAVWRNFLKYFSKAENQKNGKLHYNAKSTSDMTEDDFDFQSNPTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDGSRSPYXXXXXXXXXXXXEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLKMKSPKDMDNN 1433
            MTNPKAVWRNFLKYFSKAENQKNGKLHYNAKSTSDMTEDDFDFQSNPTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFD SRSPYSRSVTTQRSSSSEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLKMKSPKDMDNN
Sbjct:    1 MTNPKAVWRNFLKYFSKAENQKNGKLHYNAKSTSDMTEDDFDFQSNPTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNPEFDDSRSPYSRSVTTQRSSSSEILNEINRNTNLRVVDENKKLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGNPFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSVDFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDILFRLSNNLQLKMKSPKDMDNN 470          
BLAST of LIM domain kinase vs. Planmine SMEST
Match: SMESG000018804.1 (SMESG000018804.1)

HSP 1 Score: 330.872 bits (847), Expect = 1.047e-112
Identity = 157/158 (99.37%), Postives = 158/158 (100.00%), Query Frame = 3
Query:   24 MTNPKAVWRNFLKYFSKAENQKNGKLHYNAKSTSDMTEDDFDFQSNPTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEV 497
            MTNPKAVWRNFLKYFSKAENQKNGKLHYNAKSTSDMTEDDFDFQSNPTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKE+
Sbjct:    1 MTNPKAVWRNFLKYFSKAENQKNGKLHYNAKSTSDMTEDDFDFQSNPTIKNGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEI 158          
BLAST of LIM domain kinase vs. Planmine SMEST
Match: SMESG000077919.1 (SMESG000077919.1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.181e-17
Identity = 52/183 (28.42%), Postives = 97/183 (53.01%), Query Frame = 3
Query:  327 FPKKLLPITDFEEKEV----------LGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIKEVSLLRSLKHNNILTCLGLV--LKEKRICLLTELMHGGSLQSKI-QDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFLNP--EFDGSRSPY 830
            FP    P   F++ E+          +G G FG   + ++ +  AY V  +V++ +K      ++E  ++  L+H  I+  LG+    +E  I ++ E M  GSL+  +  D E+++ + + +  + DIA GM++L   +++HRDL + N L+  + TV V+DFGL++F +   E   +R P+
Sbjct:  201 FPDNYQPPIHFQDIEINRDNVNMLNEIGHGCFGSVYRAKWGR--AYEVAVKVMNSTKSERNIFLQEAKIMHKLRHRKIVELLGICSEPQESPILIILEFMKNGSLKHYLNSDKERLLDLSKMVHMMADIAEGMSYLESKNVVHRDLRADNILVDLDLTVKVADFGLTEFKDDKNEVKNTRFPF 381          
BLAST of LIM domain kinase vs. Planmine SMEST
Match: SMESG000029462.1 (SMESG000029462.1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.535e-17
Identity = 51/177 (28.81%), Postives = 91/177 (51.41%), Query Frame = 3
Query:  276 ESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIK---EVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            + +S L RTNS  +++   +  +P  + E  E+LG+G+F    K ++    A  +M   +    EN+  +     EV  L   +H N++  +G  ++  ++ ++T+L  G +L  ++      I V + I     +A GM +LH   I+H+DL S N  +  N+ VV+SDFGL  F+
Sbjct:  632 DESSHLSRTNS--ISVALKEWEIPYKNLELGELLGKGSFWTVFKGKWHGEVAVKIMN--IDPQDENDACMAAFKSEVGALHKTRHENLVLFMGACMEPPKLAIVTQLSQGETLFYQLHSRHLSIPVIRAINIASQVAKGMGYLHAKDILHKDLKSRNIFIESNSKVVISDFGLFDFV 804          
BLAST of LIM domain kinase vs. Planmine SMEST
Match: SMESG000029462.1 (SMESG000029462.1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.768e-17
Identity = 51/177 (28.81%), Postives = 91/177 (51.41%), Query Frame = 3
Query:  276 ESTSPLPRTNSFNLNIDFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKENEESLIK---EVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQDLEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVSDFGLSKFL 797
            + +S L RTNS  +++   +  +P  + E  E+LG+G+F    K ++    A  +M   +    EN+  +     EV  L   +H N++  +G  ++  ++ ++T+L  G +L  ++      I V + I     +A GM +LH   I+H+DL S N  +  N+ VV+SDFGL  F+
Sbjct:  636 DESSHLSRTNS--ISVALKEWEIPYKNLELGELLGKGSFWTVFKGKWHGEVAVKIMN--IDPQDENDACMAAFKSEVGALHKTRHENLVLFMGACMEPPKLAIVTQLSQGETLFYQLHSRHLSIPVIRAINIASQVAKGMGYLHAKDILHKDLKSRNIFIESNSKVVISDFGLFDFV 808          
The following BLAST results are available for this feature:
BLAST of LIM domain kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LIMK12.217e-5528.88LIM domain kinase 1 [Source:HGNC Symbol;Acc:HGNC:6... [more]
LIMK14.327e-5528.88LIM domain kinase 1 [Source:HGNC Symbol;Acc:HGNC:6... [more]
LIMK14.645e-5528.88LIM domain kinase 1 [Source:HGNC Symbol;Acc:HGNC:6... [more]
LIMK22.096e-5231.48LIM domain kinase 2 [Source:HGNC Symbol;Acc:HGNC:6... [more]
LIMK23.810e-5231.22LIM domain kinase 2 [Source:HGNC Symbol;Acc:HGNC:6... [more]
back to top
BLAST of LIM domain kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T25B9.48.637e-2133.33Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;... [more]
kin-216.185e-1834.27Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;... [more]
K09B11.56.666e-1835.17Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;... [more]
K09B11.57.118e-1835.17Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;... [more]
T06C10.31.755e-1732.68Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of LIM domain kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LIMK11.271e-3338.24gene:FBgn0283712 transcript:FBtr0301831[more]
LIMK11.273e-3334.74gene:FBgn0283712 transcript:FBtr0073660[more]
LIMK11.301e-3334.74gene:FBgn0283712 transcript:FBtr0073661[more]
LIMK11.575e-3334.74gene:FBgn0283712 transcript:FBtr0073659[more]
LIMK11.575e-3334.74gene:FBgn0283712 transcript:FBtr0301830[more]
back to top
BLAST of LIM domain kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
limk1a3.160e-3541.56LIM domain kinase 1a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
limk28.556e-3544.59LIM domain kinase 2 [Source:ZFIN;Acc:ZDB-GENE-0407... [more]
limk1b1.248e-3335.29LIM domain kinase 1b [Source:ZFIN;Acc:ZDB-GENE-110... [more]
zgc:1131623.497e-2346.30zgc:113162 [Source:ZFIN;Acc:ZDB-GENE-050522-530][more]
si:dkeyp-75h12.27.681e-2135.50si:dkeyp-75h12.2 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of LIM domain kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
exoc61.464e-4329.78exocyst complex component 6 [Source:Xenbase;Acc:XB... [more]
exoc63.502e-4229.51exocyst complex component 6 [Source:Xenbase;Acc:XB... [more]
exoc63.669e-4228.89exocyst complex component 6 [Source:Xenbase;Acc:XB... [more]
exoc64.780e-4229.51exocyst complex component 6 [Source:Xenbase;Acc:XB... [more]
limk12.357e-3736.09LIM domain kinase 1 [Source:NCBI gene;Acc:780362][more]
back to top
BLAST of LIM domain kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Limk11.970e-6731.26LIM-domain containing, protein kinase [Source:MGI ... [more]
Limk12.788e-6731.26LIM-domain containing, protein kinase [Source:MGI ... [more]
Limk29.874e-5833.25LIM motif-containing protein kinase 2 [Source:MGI ... [more]
Limk22.581e-5633.25LIM motif-containing protein kinase 2 [Source:MGI ... [more]
Limk24.111e-5633.25LIM motif-containing protein kinase 2 [Source:MGI ... [more]
back to top
BLAST of LIM domain kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53668|LIMK1_MOUSE1.950e-6631.26LIM domain kinase 1 OS=Mus musculus OX=10090 GN=Li... [more]
sp|P53669|LIMK1_RAT1.593e-6229.95LIM domain kinase 1 OS=Rattus norvegicus OX=10116 ... [more]
sp|Q8QFP8|LIMK1_CHICK2.260e-5832.00LIM domain kinase 1 OS=Gallus gallus OX=9031 GN=LI... [more]
sp|Q32L23|LIMK2_BOVIN6.623e-5633.77LIM domain kinase 2 OS=Bos taurus OX=9913 GN=LIMK2... [more]
sp|P53670|LIMK2_RAT8.903e-5633.60LIM domain kinase 2 OS=Rattus norvegicus OX=10116 ... [more]
back to top
BLAST of LIM domain kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YNM23.554e-7138.06LIM domain kinase 1 OS=Fasciola gigantica OX=46835... [more]
A0A4S2LTL74.440e-7037.93Protein kinase domain-containing protein OS=Opisth... [more]
A0A4S2LTK05.994e-7037.93Protein kinase domain-containing protein OS=Opisth... [more]
A0A3R7GPJ41.300e-6837.77LIM domain kinase 1 OS=Clonorchis sinensis OX=7992... [more]
A0A074ZYU34.310e-6635.96Protein kinase domain-containing protein OS=Opisth... [more]
back to top
BLAST of LIM domain kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
limk1b6.957e-6431.76LIM domain kinase 1-like [Source:NCBI gene;Acc:103... [more]
limk1a8.960e-3639.52LIM domain kinase 1 [Source:NCBI gene;Acc:10304720... [more]
limk1a8.960e-3639.52LIM domain kinase 1 [Source:NCBI gene;Acc:10304720... [more]
limk21.017e-3538.83LIM domain kinase 2 [Source:ZFIN;Acc:ZDB-GENE-0407... [more]
limk21.320e-3538.83LIM domain kinase 2 [Source:ZFIN;Acc:ZDB-GENE-0407... [more]
back to top
BLAST of LIM domain kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000175.14.840e-1932.00pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 g... [more]
EPHB27.037e-1933.78EPH receptor B2 [Source:HGNC Symbol;Acc:HGNC:3393][more]
mylka2.417e-1830.49myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-... [more]
ephb13.038e-1832.43EPH receptor B1 [Source:ZFIN;Acc:ZDB-GENE-070912-2... [more]
mylk31.610e-1629.31myosin light chain kinase 3 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of LIM domain kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC159.756e-1931.08Protein kinase of the Mitotic Exit Network; locali... [more]
BCK18.364e-1532.89MAPKKK acting in the protein kinase C signaling pa... [more]
PHO851.215e-1430.26Cyclin-dependent kinase; has ten cyclin partners; ... [more]
KIC12.932e-1430.72Protein kinase of the PAK/Ste20 family, required f... [more]
TPK11.750e-1327.92cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of LIM domain kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441836.753e-3436.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461373.139e-2339.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471953.139e-1729.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491384.300e-1726.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412421.037e-1627.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM domain kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
limk1b3.001e-6731.76LIM domain kinase 1 [Source:NCBI gene;Acc:10116294... [more]
limk1b2.114e-6532.08LIM domain kinase 1 [Source:NCBI gene;Acc:10116294... [more]
limk1a9.410e-3734.82LIM domain kinase 1-like [Source:NCBI gene;Acc:101... [more]
limk1a1.146e-3634.82LIM domain kinase 1-like [Source:NCBI gene;Acc:101... [more]
limk24.514e-3444.59LIM domain kinase 2 [Source:NCBI gene;Acc:10116448... [more]
back to top
BLAST of LIM domain kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018804.10.000e+099.79SMESG000018804.1[more]
SMESG000018804.11.047e-11299.37SMESG000018804.1[more]
SMESG000077919.13.181e-1728.42SMESG000077919.1[more]
SMESG000029462.13.535e-1728.81SMESG000029462.1[more]
SMESG000029462.13.768e-1728.81SMESG000029462.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012833 ID=SMED30012833|Name=LIM domain kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1468bp
CTATATAAATCTTATATGAATTAATGACAAATCCTAAAGCCGTTTGGAGG
AATTTTCTTAAATATTTTTCAAAAGCAGAAAATCAGAAAAATGGAAAGCT
GCATTACAATGCCAAGTCCACATCGGATATGACTGAAGATGATTTCGACT
TTCAGTCAAATCCGACAATAAAAAATGGTGGGAATTCAAGCAATCTTAAA
CGACATCAAACGTGTTCAATTGATCTGAGTGATAAAACATATCGTCCACA
AAACCGCCAGGAGTTATCCAATATTGAATCAACCTCCCCCTTGCCCAGAA
CAAACTCCTTTAATCTTAATATTGATTTTCCGAAAAAATTATTACCCATT
ACTGATTTCGAAGAAAAAGAAGTTTTAGGACAAGGTGCATTTGGTAGAGC
TATAAAAGTTCAATATCTGAAAACTGGCGCCTATTACGTCATGAAAGAAG
TCGTATCACATTCAAAAGAAAATGAAGAATCATTAATAAAAGAGGTTTCT
CTTCTAAGATCATTGAAACATAATAATATTCTAACTTGTTTGGGTTTAGT
TTTGAAAGAGAAAAGAATTTGTCTACTCACAGAGTTGATGCATGGTGGAT
CATTGCAGTCGAAAATTCAAGATTTAGAGCAAATCATTACTGTACATCAG
AAAATATTATTTCTCAGAGACATAGCAACAGGAATGAATTTTCTGCATCA
AAATTCCATAATGCATAGAGATTTAACCTCATCAAATTGTCTACTGAGAA
AGAATAATACTGTTGTCGTATCAGATTTCGGATTATCAAAATTTTTAAAT
CCAGAATTTGATGGCAGCAGATCACCATATTCAAGATCTGTAACCACTCA
ACGAAGCTCTTCGAGCGAAATACTAAATGAAATAAATAGGAATACGAATT
TAAGAGTGGTTGATGAAAACAAAAAATTAAGAAATTTTTTATCAGTAGAG
AATATCAGTTCTATTACAAAAGAAAGGCAAAACACCATAGCTGACGACAG
TTTTAGGCGCGACGAGATATATGAAAAGAGGAAATCGATGAATCTTCGGC
GTAAACATACAGTAGTTGGTAATCCTTTCTGGATGGCACCAGAAATGCTC
GCAGGTAAAACATATAATTGTCTCGTGGACCTATATTCATTTGGAATTAT
CGGTTGCGAAGTGACTGCTAGAATTTCTGCACATCCTGAATTTTTAGAAA
GACATAACAAAGATATGAGTGTAGATTTTAAAGATTTTATTGAGAAAAAC
AAAGATAAAGAGCTTATTAATTGCCCTGAAGAATTGATAGATATAGTAGA
GAAATGCTGTCAAAGTGATCCTGATAAAAGGCCCACATTCAATACAATTA
TTTCTTGGTTGGAGGATATTTTATTTCGATTATCAAACAATTTACAATTA
AAAATGAAGTCACCGAAAGACATGGATAATAATTAAATTGATTTTATTAT
TTTAATTGTCGGAGATCG
back to top

protein sequence of SMED30012833-orf-1

>SMED30012833-orf-1 ID=SMED30012833-orf-1|Name=SMED30012833-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=471bp
MTNPKAVWRNFLKYFSKAENQKNGKLHYNAKSTSDMTEDDFDFQSNPTIK
NGGNSSNLKRHQTCSIDLSDKTYRPQNRQELSNIESTSPLPRTNSFNLNI
DFPKKLLPITDFEEKEVLGQGAFGRAIKVQYLKTGAYYVMKEVVSHSKEN
EESLIKEVSLLRSLKHNNILTCLGLVLKEKRICLLTELMHGGSLQSKIQD
LEQIITVHQKILFLRDIATGMNFLHQNSIMHRDLTSSNCLLRKNNTVVVS
DFGLSKFLNPEFDGSRSPYSRSVTTQRSSSSEILNEINRNTNLRVVDENK
KLRNFLSVENISSITKERQNTIADDSFRRDEIYEKRKSMNLRRKHTVVGN
PFWMAPEMLAGKTYNCLVDLYSFGIIGCEVTARISAHPEFLERHNKDMSV
DFKDFIEKNKDKELINCPEELIDIVEKCCQSDPDKRPTFNTIISWLEDIL
FRLSNNLQLKMKSPKDMDNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR008266Tyr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0008270zinc ion binding
GO:0016301kinase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 179..262
e-value: 1.3E-6
score: 24.5
coord: 348..471
e-value: 2.5E-7
score: 26.8
coord: 97..196
e-value: 27.0
score: 0.3
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 104..189
e-value: 1.3E-20
score: 75.2
NoneNo IPR availablePANTHERPTHR46485FAMILY NOT NAMEDcoord: 32..463
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 315..445
e-value: 1.9E-14
score: 53.6
coord: 115..260
e-value: 1.7E-34
score: 119.3
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 230..242
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 119..142
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 113..452
score: 35.877
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 104..461