heterogeneous nuclear ribonucleoprotein A1 A2/B1

Overview
Nameheterogeneous nuclear ribonucleoprotein A1 A2/B1 (AKG62107.1)
Smed IDSMED30012822
Length (bp)1191
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of heterogeneous nuclear ribonucleoprotein A1 A2/B1 (SMED30012822) t-SNE clustered cells

Violin plots show distribution of expression levels for heterogeneous nuclear ribonucleoprotein A1 A2/B1 (SMED30012822) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of heterogeneous nuclear ribonucleoprotein A1 A2/B1 (SMED30012822) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for heterogeneous nuclear ribonucleoprotein A1 A2/B1 (SMED30012822) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012822

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012822SMESG000081075.1 SmedASXL_018805SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012822SMESG000081075.1 SmedASXL_018805SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30012822SMESG000081075.1 dd_Smed_v4_986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012822SMESG000081075.1 dd_Smed_v4_986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012822SMESG000081075.1 dd_Smed_v4_986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012822SMESG000081075.1 dd_Smed_v4_986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012822SMESG000081075.1 dd_Smed_v4_986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012822SMESG000081075.1 dd_Smed_v4_986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012822SMESG000081075.1 dd_Smed_v4_986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012822SMESG000081075.1 dd_Smed_v4_986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012822SMESG000081075.1 dd_Smed_v4_986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012822SMESG000081075.1 Contig35566uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012822SMESG000081075.1 Contig35566newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 183.726 bits (465), Expect = 4.821e-55
Identity = 89/179 (49.72%), Postives = 124/179 (69.27%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSN 611
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R + + +
Sbjct:   18 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQED 196          

HSP 2 Score: 65.855 bits (159), Expect = 1.543e-11
Identity = 28/90 (31.11%), Postives = 53/90 (58.89%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATV 359
            KKLF+GG+   T E  L+ ++ ++G+I  + ++ D Q+GK RGFGFVT+ D   VD     + H ++G   + ++A+ +++   +    +
Sbjct:  112 KKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEDLEVAI 201          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 185.267 bits (469), Expect = 1.341e-54
Identity = 89/175 (50.86%), Postives = 122/175 (69.71%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R +
Sbjct:    6 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE 180          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 185.267 bits (469), Expect = 1.341e-54
Identity = 89/175 (50.86%), Postives = 122/175 (69.71%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R +
Sbjct:    6 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE 180          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 185.267 bits (469), Expect = 1.702e-54
Identity = 89/175 (50.86%), Postives = 122/175 (69.71%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R +
Sbjct:   18 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE 192          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Human
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 185.267 bits (469), Expect = 1.702e-54
Identity = 89/175 (50.86%), Postives = 122/175 (69.71%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R +
Sbjct:   18 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE 192          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 166.777 bits (421), Expect = 6.686e-48
Identity = 77/172 (44.77%), Postives = 121/172 (70.35%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            +K+F+GGL   TT++ ++ FYSQ+GEI D++VMRDP T +SRGFGFVT+S  + VD A   RPH +DG  VD KRA+P++D +  E + +  RL+V  ++ +   D L +YF +YGT+  + +I++ +  + RGFGFVTFDD DSVD+ ++ + H ++G+  +V+K L +D+
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDE 194          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 166.777 bits (421), Expect = 6.686e-48
Identity = 77/172 (44.77%), Postives = 121/172 (70.35%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            +K+F+GGL   TT++ ++ FYSQ+GEI D++VMRDP T +SRGFGFVT+S  + VD A   RPH +DG  VD KRA+P++D +  E + +  RL+V  ++ +   D L +YF +YGT+  + +I++ +  + RGFGFVTFDD DSVD+ ++ + H ++G+  +V+K L +D+
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDE 194          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 166.777 bits (421), Expect = 6.851e-48
Identity = 77/172 (44.77%), Postives = 121/172 (70.35%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            +K+F+GGL   TT++ ++ FYSQ+GEI D++VMRDP T +SRGFGFVT+S  + VD A   RPH +DG  VD KRA+P++D +  E + +  RL+V  ++ +   D L +YF +YGT+  + +I++ +  + RGFGFVTFDD DSVD+ ++ + H ++G+  +V+K L +D+
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDE 194          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Celegans
Match: hrp-1 (Heterogeneous nuclear ribonucleoprotein A1 [Source:UniProtKB/Swiss-Prot;Acc:Q22037])

HSP 1 Score: 166.777 bits (421), Expect = 6.851e-48
Identity = 77/172 (44.77%), Postives = 121/172 (70.35%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            +K+F+GGL   TT++ ++ FYSQ+GEI D++VMRDP T +SRGFGFVT+S  + VD A   RPH +DG  VD KRA+P++D +  E + +  RL+V  ++ +   D L +YF +YGT+  + +I++ +  + RGFGFVTFDD DSVD+ ++ + H ++G+  +V+K L +D+
Sbjct:   23 RKIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMKQRPHIIDGKTVDPKRAVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTKSEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKDE 194          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Celegans
Match: msi-1 (MuSashI (Fly neural) family; Neural RNA-binding protein MSI-1 [Source:UniProtKB/TrEMBL;Acc:G5EFS2])

HSP 1 Score: 154.836 bits (390), Expect = 1.060e-43
Identity = 71/169 (42.01%), Postives = 110/169 (65.09%), Query Frame = 3
Query:   93 KLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVII-NNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRD 596
            K+FIGGL  +TT E+L+ ++ ++GE+ + +VMRDP T ++RGFGF+T+ D SSVD   +NR HE+DG K+D K A PK  T  +      ++F+G L      +D++QYF  YG + DA+++ + +    RGFGFVTFD  +  DK+     H+++G  +E KKA P++
Sbjct:   46 KMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKR-TQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKE 213          

HSP 2 Score: 71.633 bits (174), Expect = 1.085e-13
Identity = 33/86 (38.37%), Postives = 50/86 (58.14%), Query Frame = 3
Query:   84 RGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSP 341
            + KK+FIGGL   +T E +K ++  +G++ D ++M D  T + RGFGFVT+      D       HE++G  V+ K+A PKE   P
Sbjct:  132 KTKKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVMLP 217          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Fly
Match: Hrb98DE (gene:FBgn0001215 transcript:FBtr0085299)

HSP 1 Score: 193.741 bits (491), Expect = 6.039e-58
Identity = 91/178 (51.12%), Postives = 129/178 (72.47%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKS 608
            E  +KLFIGGL  +TT+E+LK  + +WG IVDVVVM+DP+T +SRGFGF+TYS SS +D+AQ +RPH++DG  V+ KRA+P++D  SP   ATV +LFVG LK +     +R YF  +G I D  ++I+   G+ RGF FV FDD D VDK+++ + HQL+G  ++VKKALP+ +++ 
Sbjct:   23 EHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQNDQQ 200          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Fly
Match: Hrb98DE (gene:FBgn0001215 transcript:FBtr0085298)

HSP 1 Score: 193.741 bits (491), Expect = 6.996e-58
Identity = 91/178 (51.12%), Postives = 129/178 (72.47%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKS 608
            E  +KLFIGGL  +TT+E+LK  + +WG IVDVVVM+DP+T +SRGFGF+TYS SS +D+AQ +RPH++DG  V+ KRA+P++D  SP   ATV +LFVG LK +     +R YF  +G I D  ++I+   G+ RGF FV FDD D VDK+++ + HQL+G  ++VKKALP+ +++ 
Sbjct:   27 EHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKQNDQQ 204          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Fly
Match: Hrb98DE (gene:FBgn0001215 transcript:FBtr0085302)

HSP 1 Score: 193.356 bits (490), Expect = 8.527e-58
Identity = 91/173 (52.60%), Postives = 126/173 (72.83%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPR 593
            E  +KLFIGGL  +TT+E+LK  + +WG IVDVVVM+DP+T +SRGFGF+TYS SS +D+AQ +RPH++DG  V+ KRA+P++D  SP   ATV +LFVG LK +     +R YF  +G I D  ++I+   G+ RGF FV FDD D VDK+++ + HQL+G  ++VKKALP+
Sbjct:   24 EHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 196          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Fly
Match: Hrb98DE (gene:FBgn0001215 transcript:FBtr0085303)

HSP 1 Score: 193.356 bits (490), Expect = 8.527e-58
Identity = 91/173 (52.60%), Postives = 126/173 (72.83%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPR 593
            E  +KLFIGGL  +TT+E+LK  + +WG IVDVVVM+DP+T +SRGFGF+TYS SS +D+AQ +RPH++DG  V+ KRA+P++D  SP   ATV +LFVG LK +     +R YF  +G I D  ++I+   G+ RGF FV FDD D VDK+++ + HQL+G  ++VKKALP+
Sbjct:   24 EHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 196          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Fly
Match: Hrb98DE (gene:FBgn0001215 transcript:FBtr0085300)

HSP 1 Score: 193.356 bits (490), Expect = 9.981e-58
Identity = 91/173 (52.60%), Postives = 126/173 (72.83%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPR 593
            E  +KLFIGGL  +TT+E+LK  + +WG IVDVVVM+DP+T +SRGFGF+TYS SS +D+AQ +RPH++DG  V+ KRA+P++D  SP   ATV +LFVG LK +     +R YF  +G I D  ++I+   G+ RGF FV FDD D VDK+++ + HQL+G  ++VKKALP+
Sbjct:   28 EHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 200          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 182.185 bits (461), Expect = 7.657e-55
Identity = 90/182 (49.45%), Postives = 124/182 (68.13%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINN-SNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQ 620
            E+ +KLFIGGL  +TTE+SL+  + QWG++ D VVMRDP   +SRGFGFVTYS  S VD A + RPH+VDG  V+ KRA+ +ED+  P  H TV ++FVG +K +     +R+YF  YG I    I+   S G+ RGF FVTFDD D+VDKI+  + H ++ +  EV+KALP+ + +S+S Q
Sbjct:   10 EQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQSSSNQ 191          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Zebrafish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1a [Source:ZFIN;Acc:ZDB-GENE-040426-1546])

HSP 1 Score: 185.652 bits (470), Expect = 2.199e-54
Identity = 87/175 (49.71%), Postives = 124/175 (70.86%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGES-RGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TT+ESL+  + QWG + D VVMRDP T +SRGFGFVTYS    VD A   RPH+VDG  V+ KRA+ +ED+S P  H+TV ++FVG +K +   + LR+YFG++G I +  I+   N +  RGF F+TFDD D+VD+I++ + H ++G+  EV+KAL R++
Sbjct:   12 EQLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYSSVGEVDAAMDARPHKVDGRAVEPKRAVSREDSSKPGAHSTVKKMFVGGIKEDTDEEHLREYFGQFGKIDEVNIMTEKNSDKRRGFAFITFDDHDAVDRIVIQKYHTVNGHNCEVRKALSREE 186          

HSP 2 Score: 77.411 bits (189), Expect = 4.014e-15
Identity = 36/96 (37.50%), Postives = 58/96 (60.42%), Query Frame = 3
Query:  318 MPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGE-SRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDN 602
            M KE  +P     + +LF+G L      + LR +F ++GT+ D V++ + N + SRGFGFVT+     VD  +  RPH++DG  +E K+A+ R+D+
Sbjct:    1 MSKEQQTPREPEQLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYSSVGEVDAAMDARPHKVDGRAVEPKRAVSREDS 96          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 182.185 bits (461), Expect = 5.958e-54
Identity = 90/182 (49.45%), Postives = 124/182 (68.13%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINN-SNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQ 620
            E+ +KLFIGGL  +TTE+SL+  + QWG++ D VVMRDP   +SRGFGFVTYS  S VD A + RPH+VDG  V+ KRA+ +ED+  P  H TV ++FVG +K +     +R+YF  YG I    I+   S G+ RGF FVTFDD D+VDKI+  + H ++ +  EV+KALP+ + +S+S Q
Sbjct:   10 EQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQSSSNQ 191          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Zebrafish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:ZFIN;Acc:ZDB-GENE-060224-1])

HSP 1 Score: 182.185 bits (461), Expect = 1.305e-53
Identity = 90/182 (49.45%), Postives = 124/182 (68.13%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINN-SNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQ 620
            E+ +KLFIGGL  +TTE+SL+  + QWG++ D VVMRDP   +SRGFGFVTYS  S VD A + RPH+VDG  V+ KRA+ +ED+  P  H TV ++FVG +K +     +R+YF  YG I    I+   S G+ RGF FVTFDD D+VDKI+  + H ++ +  EV+KALP+ + +S+S Q
Sbjct:    9 EQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPANKRSRGFGFVTYSSVSEVDAAMTARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFECYGKIETIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQSSSNQ 190          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Zebrafish
Match: hnrnpa1b (heterogeneous nuclear ribonucleoprotein A1b [Source:ZFIN;Acc:ZDB-GENE-030912-14])

HSP 1 Score: 172.94 bits (437), Expect = 2.034e-49
Identity = 82/175 (46.86%), Postives = 121/175 (69.14%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEF-HATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TT++SL+  + QWG + D VVM+DP T +SRGFGFVTYS    V+ +   RPH+VDG  V+ KRA+ +ED+S  F H TV ++FVG +K +   + LR YF ++G I    +++++  G  RGF FVTFDD DSVD+I++ + H ++G+  EV+KAL + +
Sbjct:   11 EQLRKLFIGGLSFETTDDSLRAHFEQWGTLTDCVVMKDPNTKRSRGFGFVTYSSVDEVNASMDARPHKVDGRLVEPKRAVSREDSSKPFAHTTVKKIFVGGIKDDTEENHLRDYFDQFGKIEVVEIMVDHKTGNKRGFAFVTFDDHDSVDRIVIQKYHTVNGHNCEVRKALSKQE 185          

HSP 2 Score: 75.8702 bits (185), Expect = 1.200e-14
Identity = 45/131 (34.35%), Postives = 72/131 (54.96%), Query Frame = 3
Query:  306 SKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGE-SRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTPR---GGYSNSTASNN 686
            SK   P+E   PE    + +LF+G L      D LR +F ++GT+ D V++ + N + SRGFGFVT+   D V+  +  RPH++DG  +E K+A+ R+D+      S P  + +  +   GG  + T  N+
Sbjct:    2 SKEGQPRE---PE---QLRKLFIGGLSFETTDDSLRAHFEQWGTLTDCVVMKDPNTKRSRGFGFVTYSSVDEVNASMDARPHKVDGRLVEPKRAVSREDS------SKPFAHTTVKKIFVGGIKDDTEENH 120          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 183.341 bits (464), Expect = 6.339e-54
Identity = 89/189 (47.09%), Postives = 127/189 (67.20%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNK 641
            E+ +KLFIGGL  +TTE+SL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S    VD + + RPH +DG  V+ KRA+ +E+++ P  H TV +LFVG +K +     LR+YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL + + +      N  G K
Sbjct:    6 EQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQNTRNSRGGK 194          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 182.57 bits (462), Expect = 1.688e-53
Identity = 91/195 (46.67%), Postives = 129/195 (66.15%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTPRGG 659
            E+ +KLFIGGL  +TTE+SL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S    VD + + RPH +DG  V+ KRA+ +E+++ P  H TV +LFVG +K +     LR+YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL +       ++   V N    RGG
Sbjct:    6 EQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSK-------QEMQDVQNTRNSRGG 193          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 181.8 bits (460), Expect = 1.913e-53
Identity = 90/189 (47.62%), Postives = 128/189 (67.72%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD-----NKSNSKQSN 626
            E+ +KLFIGGL  +TTE+SL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S    VD + + RPH +DG  V+ KRA+ +E+++ P  H TV +LFVG +K +     LR+YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL + +     N  NS+  N
Sbjct:    6 EQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQEMQDVQNTRNSRGGN 194          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Xenopus
Match: hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:NCBI gene;Acc:549680])

HSP 1 Score: 181.8 bits (460), Expect = 3.659e-53
Identity = 86/175 (49.14%), Postives = 123/175 (70.29%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTE+SL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S    VD + + RPH +DG  V+ KRA+ +E+++ P  H TV +LFVG +K +     LR+YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL + +
Sbjct:    6 EQFRKLFIGGLSFETTEDSLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMDEVDASMAARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESIEIITDKQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSKQE 180          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Xenopus
Match: deup1 (deuterosome assembly protein 1 [Source:Xenbase;Acc:XB-GENE-5961526])

HSP 1 Score: 182.57 bits (462), Expect = 3.769e-53
Identity = 92/182 (50.55%), Postives = 126/182 (69.23%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQ 620
            E+ +KLFIGGL  +TT++SL+  + QWG++ D VVMRDPQT +SRGFGFVTYS    VD A S RPH+VDG  V+ KRA+ +ED++ P  H TV ++FVG +K +     LR YF  YG I    V+ +  +G+ RGF FVTFDD D+VDKI+V + H ++G+  EVKKAL + + ++ S Q
Sbjct:   24 EQLRKLFIGGLSFETTDDSLREHFEQWGKLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMSARPHKVDGRVVEPKRAVSREDSARPGAHLTVKKIFVGGIKEDTEEYHLRDYFQSYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQTASAQ 205          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 185.267 bits (469), Expect = 2.710e-55
Identity = 89/175 (50.86%), Postives = 122/175 (69.71%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R +
Sbjct:    6 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE 180          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 185.267 bits (469), Expect = 2.710e-55
Identity = 89/175 (50.86%), Postives = 122/175 (69.71%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R +
Sbjct:    6 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE 180          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 185.267 bits (469), Expect = 2.710e-55
Identity = 89/175 (50.86%), Postives = 122/175 (69.71%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R +
Sbjct:    6 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE 180          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 185.267 bits (469), Expect = 9.205e-55
Identity = 89/175 (50.86%), Postives = 122/175 (69.71%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R +
Sbjct:    6 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE 180          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Mouse
Match: Hnrnpa2b1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:MGI Symbol;Acc:MGI:104819])

HSP 1 Score: 185.267 bits (469), Expect = 9.205e-55
Identity = 89/175 (50.86%), Postives = 122/175 (69.71%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R +
Sbjct:    6 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE 180          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. UniProt/SwissProt
Match: sp|P21522|ROA1_SCHAM (Heterogeneous nuclear ribonucleoprotein A1, A2/B1 homolog OS=Schistocerca americana OX=7009 GN=HNRNP PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 1.240e-58
Identity = 97/173 (56.07%), Postives = 127/173 (73.41%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPK-EDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIAD-AVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPR 593
            E  +KLFIGGL  +TT+ESLK  + QWGEIVDVVVM+DP+T +SRGFGF+TYS +  VDDAQ+ RPH+VDG  V+ KRA+P+ E   PE  ATV +LFVG +K  +  +DLR YF +YGT+   A++++    + RGF FV FDD D VDKI ++R HQ+ G  I+VKKALP+
Sbjct:   14 EHVRKLFIGGLDYRTTDESLKQHFEQWGEIVDVVVMKDPKTKRSRGFGFITYSRAHMVDDAQNARPHKVDGRVVEPKRAVPRTEIGRPEAGATVKKLFVGGIKEEMEENDLRDYFKQYGTVVSAAIVVDKETRKKRGFAFVEFDDYDPVDKICLSRNHQIRGKHIDVKKALPK 186          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. UniProt/SwissProt
Match: sp|P07909|ROA1_DROME (Heterogeneous nuclear ribonucleoprotein A1 OS=Drosophila melanogaster OX=7227 GN=Hrb98DE PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.001e-56
Identity = 91/173 (52.60%), Postives = 126/173 (72.83%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPR 593
            E  +KLFIGGL  +TT+E+LK  + +WG IVDVVVM+DP+T +SRGFGF+TYS SS +D+AQ +RPH++DG  V+ KRA+P++D  SP   ATV +LFVG LK +     +R YF  +G I D  ++I+   G+ RGF FV FDD D VDK+++ + HQL+G  ++VKKALP+
Sbjct:   28 EHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPK 200          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. UniProt/SwissProt
Match: sp|Q9TTV2|ROA2_SAGOE (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Saguinus oedipus OX=9490 GN=HNRNPA2B1 PE=1 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.707e-54
Identity = 89/175 (50.86%), Postives = 122/175 (69.71%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R +
Sbjct:    6 EQFRKLFIGGLSFQTTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFAEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQE 180          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. UniProt/SwissProt
Match: sp|P51990|RO22_XENLA (Heterogeneous nuclear ribonucleoprotein A2 homolog 2 OS=Xenopus laevis OX=8355 PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.976e-54
Identity = 89/175 (50.86%), Postives = 125/175 (71.43%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ FY QWG++ D VVMRDP + +SRGFGFVT+S  + VD A S RPH +DG  V+ KRA+ +E+++ P  H TV +LFVG +K +     LR+YF EYG I +  +I +  +G+ RGFGFVTF+D D VDKI++ + H ++G+  EV+KAL + +
Sbjct:    6 EQFRKLFIGGLSFETTEESLRNFYEQWGQLTDCVVMRDPASKRSRGFGFVTFSCMNEVDAAMSARPHTIDGRVVEPKRAVAREESAKPGAHVTVKKLFVGGIKEDTEEHHLREYFEEYGKIESTEIITDKQSGKKRGFGFVTFNDHDPVDKIVLQKYHTINGHNAEVRKALSKQE 180          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. UniProt/SwissProt
Match: sp|Q5RBU8|ROA2_PONAB (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Pongo abelii OX=9601 GN=HNRNPA2B1 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 5.347e-54
Identity = 89/175 (50.86%), Postives = 122/175 (69.71%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+ +Y QWG++ D VVMRDP + +SRGFGFVT+S  + VD A + RPH +DG  V+ KRA+ +E++  P  H TV +LFVG +K +     LR YF EYG I    +I +  +G+ RGFGFVTFDD D VDKI++ + H ++G+  EV+KAL R +
Sbjct:   18 EQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKHHTINGHNAEVRKALSRQE 192          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. TrEMBL
Match: A0A0F7GXY5 (Heterogeneous nuclear ribonucleoprotein A1 A2/B1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 314/314 (100.00%), Postives = 314/314 (100.00%), Query Frame = 3
Query:   48 NLSETMRGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTPRGGYSNSTASNNRXXXXXXXXXXXXXXXXANSTYNNRNYGTSFNQGYSQNYSSNKFSNNRLSESFENETSYSQPTYGNETNYSYGQYDTPNXXXXXXXXXXXXXAMGEYNQRQ 989
            NLSETMRGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTPRGGYSNSTASNNRYSQQDDYSSSYGSYPSANSTYNNRNYGTSFNQGYSQNYSSNKFSNNRLSESFENETSYSQPTYGNETNYSYGQYDTPNPPSSRYGYPPYSSAMGEYNQRQ
Sbjct:    1 NLSETMRGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTPRGGYSNSTASNNRYSQQDDYSSSYGSYPSANSTYNNRNYGTSFNQGYSQNYSSNKFSNNRLSESFENETSYSQPTYGNETNYSYGQYDTPNPPSSRYGYPPYSSAMGEYNQRQ 314          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. TrEMBL
Match: H2KT13 (Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Clonorchis sinensis OX=79923 GN=HNRNPA2B1 PE=4 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 3.520e-73
Identity = 110/178 (61.80%), Postives = 146/178 (82.02%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD-NKSNSK 617
            KKLF+GGL+ KT EESL+ +YSQWGEI DVVVM+DP++ KSRGFGFVT+ +++SVD AQ+NRPH++DG +VDSKRAMP+E+TSPE HA V ++FVG LK++V  DDL +YFG+YGT+ DA +++      SRGF FVTFDDTDSVDK+I+ RPH ++G+  +V+KAL R++ NK  SK
Sbjct:   13 KKLFVGGLNPKTNEESLRSYYSQWGEITDVVVMKDPRSNKSRGFGFVTFKEAASVDKAQANRPHKLDGKEVDSKRAMPREETSPEVHAAVKKIFVGGLKKDVTNDDLAEYFGQYGTVTDAQIVMAKDTNTSRGFAFVTFDDTDSVDKVILARPHTINGHKADVRKALSREEMNKVRSK 190          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. TrEMBL
Match: A0A1S8WK60 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_09385 PE=4 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 4.739e-73
Identity = 110/178 (61.80%), Postives = 146/178 (82.02%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD-NKSNSK 617
            KKLF+GGL+ KT EESL+ +YSQWGEI DVVVM+DP++ KSRGFGFVT+ +++SVD AQ+NRPH++DG +VDSKRAMP+E+TSPE HA V ++FVG LK++V  DDL +YFG+YGT+ DA +++      SRGF FVTFDDTDSVDK+I+ RPH ++G+  +V+KAL R++ NK  SK
Sbjct:   13 KKLFVGGLNPKTNEESLRSYYSQWGEITDVVVMKDPRSNKSRGFGFVTFKEAASVDKAQANRPHKLDGKEVDSKRAMPREETSPEVHAAVKKIFVGGLKKDVTNDDLAEYFGQYGTVTDAQIVMAKDTNTSRGFAFVTFDDTDSVDKVILARPHTINGHKADVRKALSREEMNKVRSK 190          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. TrEMBL
Match: A0A4S2LTP6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004961 PE=4 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 5.248e-73
Identity = 110/178 (61.80%), Postives = 146/178 (82.02%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD-NKSNSK 617
            KKLF+GGL+ KT EESL+ +YSQWGEI DVVVM+DP++ KSRGFGFVT+ +++SVD AQ+NRPH++DG +VDSKRAMP+E+TSPE HA V ++FVG LK++V  DDL +YFG+YGT+ DA +++      SRGF FVTFDDTDSVDK+I+ RPH ++G+  +V+KAL R++ NK  SK
Sbjct:   13 KKLFVGGLNPKTNEESLRSYYSQWGEITDVVVMKDPRSNKSRGFGFVTFKEAASVDKAQANRPHKLDGKEVDSKRAMPREETSPEVHAAVKKIFVGGLKKDVTNDDLAEYFGQYGTVTDAQIVMAKDTNTSRGFAFVTFDDTDSVDKVILARPHTINGHKADVRKALSREEMNKVRSK 190          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. TrEMBL
Match: A0A5K3EK81 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 2.107e-72
Identity = 107/171 (62.57%), Postives = 140/171 (81.87%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            KKLF+GGLH  TTE  L+ FYSQWGEI DVVVM+D +TGKSRGFGFVT+++SSSVD AQ+ RPH +DG  +DSKRAMP+E+TSPE HA V ++FVG LK++V  DDL QYF ++GT+ DA V+++    ESRGF FVTFDDTD+VDK+I+++PH ++ N I+V+KAL +D+
Sbjct:   13 KKLFVGGLHHSTTENQLREFYSQWGEITDVVVMKDQRTGKSRGFGFVTFAESSSVDAAQAARPHTIDGKTIDSKRAMPREETSPEVHAAVKKIFVGALKKDVTDDDLSQYFSQFGTVTDASVVMSKDRNESRGFAFVTFDDTDAVDKVILSKPHSINENKIDVRKALSKDE 183          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Cavefish
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:103035058])

HSP 1 Score: 177.563 bits (449), Expect = 9.398e-52
Identity = 88/182 (48.35%), Postives = 122/182 (67.03%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNS-NGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQ 620
            E+ +KLFIGGL  +TTE+SL+  + QWG++ D VVMRDP   +SRGFGFVTYS  S VD A   RPH+VDG  V+ KRA+ +ED++ P  H TV ++FVG +K +     +R+YF  YG I    I+     G+ RGF FVTFDD D+VDKI+  + H ++ +  EV+KALP+ + ++ S Q
Sbjct:   10 EQLRKLFIGGLSFETTEDSLRAHFEQWGKLTDCVVMRDPGNKRSRGFGFVTYSCVSEVDAAMGARPHKVDGRIVEPKRAVSREDSNRPGAHLTVKKIFVGGIKEDTEEYHIREYFEHYGKIESIDIMEERPTGKKRGFCFVTFDDHDTVDKIVAQKYHTINSHNCEVRKALPKQEMQAASNQ 191          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Cavefish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1-like [Source:NCBI gene;Acc:103021383])

HSP 1 Score: 177.563 bits (449), Expect = 1.468e-51
Identity = 83/180 (46.11%), Postives = 128/180 (71.11%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEF-HATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNS 614
            E+ +KLFIGGL  +TT++SL+ ++ QWG + D VVM+DP + +SRGFGFVTY++   VD A + RPH+VDG  V+ KRA+ +ED++  F H TV ++FVG +K +     LR YF ++G I A  ++++  +G+ RGF FVTF D DSVD+I++ + H ++G+  EV+KAL R + +++S
Sbjct:   11 EQLRKLFIGGLSFETTDDSLRAYFEQWGTLTDCVVMKDPNSKRSRGFGFVTYANVEEVDAAMNARPHKVDGRLVEPKRAVSREDSNKPFAHMTVKKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTINGHNSEVRKALSRQEMQNSS 190          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Cavefish
Match: hnrnpa1a (heterogeneous nuclear ribonucleoprotein A1-like [Source:NCBI gene;Acc:103021383])

HSP 1 Score: 177.563 bits (449), Expect = 1.468e-51
Identity = 83/180 (46.11%), Postives = 128/180 (71.11%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEF-HATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNS 614
            E+ +KLFIGGL  +TT++SL+ ++ QWG + D VVM+DP + +SRGFGFVTY++   VD A + RPH+VDG  V+ KRA+ +ED++  F H TV ++FVG +K +     LR YF ++G I A  ++++  +G+ RGF FVTF D DSVD+I++ + H ++G+  EV+KAL R + +++S
Sbjct:   11 EQLRKLFIGGLSFETTDDSLRAYFEQWGTLTDCVVMKDPNSKRSRGFGFVTYANVEEVDAAMNARPHKVDGRLVEPKRAVSREDSNKPFAHMTVKKIFVGGIKEDTEESHLRDYFDQFGRIEAIEIMVDRGSGKKRGFAFVTFSDHDSVDRIVIQKYHTINGHNSEVRKALSRQEMQNSS 190          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Cavefish
Match: ENSAMXT00000025677.2 (pep primary_assembly:Astyanax_mexicanus-2.0:24:39015044:39015955:-1 gene:ENSAMXG00000024951.2 transcript:ENSAMXT00000025677.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.918 bits (398), Expect = 3.077e-45
Identity = 77/174 (44.25%), Postives = 117/174 (67.24%), Query Frame = 3
Query:   93 KLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKS 608
            KLF+GGL+++TT+E L+  + Q+G++ D VV+++ Q  +SR FGFVTY+     D A S RPH +DG  V+ KRA+ +ED   PE  A V ++FVG LK ++    L + F ++G++  A VI++   G+ RGFGFV FDD DS DK +V + H ++G+ +EVKKAL + + +S
Sbjct:    7 KLFVGGLNVQTTDEGLRKHFEQYGQLTDCVVVQNQQLKRSRCFGFVTYTSPEEADAAMSARPHVLDGNNVEIKRAVAREDAGKPEALAKVKKIFVGGLKDDIEDSHLIECFSQFGSVEKAEVIMDKDTGKKRGFGFVYFDDNDSADKAVVLKFHTINGHKVEVKKALTKQEMQS 180          

HSP 2 Score: 64.6994 bits (156), Expect = 2.132e-11
Identity = 32/82 (39.02%), Postives = 49/82 (59.76%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT 335
            KK+F+GGL     +  L   +SQ+G +    V+ D  TGK RGFGFV + D+ S D A   + H ++G KV+ K+A+ K++ 
Sbjct:   97 KKIFVGGLKDDIEDSHLIECFSQFGSVEKAEVIMDKDTGKKRGFGFVYFDDNDSADKAVVLKFHTINGHKVEVKKALTKQEM 178          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Cavefish
Match: ENSAMXT00000047970.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:13999011:14001608:-1 gene:ENSAMXG00000037730.1 transcript:ENSAMXT00000047970.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 156.762 bits (395), Expect = 4.117e-44
Identity = 78/171 (45.61%), Postives = 115/171 (67.25%), Query Frame = 3
Query:   93 KLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            KLF+GGL+++TT E L+  + Q+G++ D VV+++ Q  +SR FGFVTYS +   D A + RPH VDG  V+ KRA+ +ED   PE  A V ++FVG LK ++  ++L +YF ++G I  + VI +   G+ RGFGFV F+D DS DK +V + H + G+ +EVKKAL R +
Sbjct:   17 KLFVGGLNVQTTNEGLRAHFEQYGKLTDCVVVQNEQLQRSRCFGFVTYSSAEEADAAMAARPHVVDGKNVELKRAVAREDAGRPEALAKVKKIFVGGLKEDIEENELNEYFSQFGVIEKSEVITDKDTGKKRGFGFVHFEDNDSADKAVVLKFHTIKGHKVEVKKALTRQE 187          

HSP 2 Score: 67.0106 bits (162), Expect = 6.653e-12
Identity = 33/81 (40.74%), Postives = 49/81 (60.49%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKED 332
            KK+F+GGL     E  L  ++SQ+G I    V+ D  TGK RGFGFV + D+ S D A   + H + G KV+ K+A+ +++
Sbjct:  107 KKIFVGGLKEDIEENELNEYFSQFGVIEKSEVITDKDTGKKRGFGFVHFEDNDSADKAVVLKFHTIKGHKVEVKKALTRQE 187          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 179.874 bits (455), Expect = 1.192e-54
Identity = 84/177 (47.46%), Postives = 120/177 (67.80%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKS 608
            E+ +KLFIGGL  +TTEESL+ +Y QWG IVD VVM+DP + +SRGFGF+TYS    V+ A   RPH VDG  V++KRA+P++D+ P    TV +LFVG +K N     LR YF ++G +    ++ +   G+ RGF FVTFDD D VD+I+  + H ++ + +EV+KAL R + ++
Sbjct:   11 EQMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDSRPGIQVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKALSRHEMET 187          

HSP 2 Score: 80.8777 bits (198), Expect = 1.000e-17
Identity = 39/97 (40.21%), Postives = 62/97 (63.92%), Query Frame = 3
Query:  318 MPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINN-SNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNK 605
            MPKE   PE    + +LF+G L      + LR+Y+ ++GTI D V++ + S+  SRGFGF+T+   + V+  +  RPH +DG  +E K+A+PRDD++
Sbjct:    6 MPKE---PE---QMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDSR 96          

HSP 3 Score: 62.7734 bits (151), Expect = 1.482e-11
Identity = 31/89 (34.83%), Postives = 52/89 (58.43%), Query Frame = 3
Query:   66 RGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKED 332
            R  I    KKLF+GG+   T E  L+ ++S++G +  V ++ D QTGK RGF FVT+ D   VD     + H ++  K++ ++A+ + +
Sbjct:   96 RPGIQVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKALSRHE 184          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 181.8 bits (460), Expect = 5.576e-54
Identity = 88/179 (49.16%), Postives = 121/179 (67.60%), Query Frame = 3
Query:   78 DERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKS 608
            DE+ +KLFIGGL  +TTEES++  + QWG + D VVMRDP T +SRGFGFVTY  +  VD A   RPH +DG  V++KRA+ +ED+  P  H  V ++FVG +K N   D LR YF EYG +    V+ +  +G+ RGFGFVTF D D+VDK++V + H ++G+  EV+KAL + +  S
Sbjct:   29 DEQQRKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYMSAEEVDAAMEVRPHHLDGRVVEAKRAISREDSLKPGAHLKVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTINGHKAEVRKALSKQEMNS 207          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.096 bits (440), Expect = 1.460e-52
Identity = 83/175 (47.43%), Postives = 121/175 (69.14%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLF+GGL  +TTEE L+ ++ QWG + D VVM+D Q+ +SRGFGFVT+S  S VD A S RPH++DG  V+ KRA+ +ED+  P  H +V ++FVG +K +   + LR YF +YG I    V+    +G+ RGF FVTF+D D VDKI+V + H ++G+  E++KALP+ +
Sbjct:    8 EQFRKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSREDSMRPGAHLSVKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQE 182          

HSP 2 Score: 67.781 bits (164), Expect = 2.149e-13
Identity = 32/92 (34.78%), Postives = 56/92 (60.87%), Query Frame = 3
Query:   57 ETMRGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKED 332
            ++MR       KK+F+GG+   T EE L+ ++ ++G I  V VM + ++GK RGF FVT++D   VD     + H ++G   + ++A+PK++
Sbjct:   91 DSMRPGAHLSVKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQE 182          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 173.326 bits (438), Expect = 1.560e-52
Identity = 85/178 (47.75%), Postives = 120/178 (67.42%), Query Frame = 3
Query:   72 NIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTI-ADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            N DE+ +KLFIGGL  +TTE+S++  + QWG + D VVMRDP T +SRGFGFVTY+    VD A   RPH +D   V++KRA+ +ED+  P  H  V ++FVG ++ +     LR+YF  YG + A  V+ + S G+ RGFGFVTF D D+VDK+IV + H ++G+  EV+KAL + +
Sbjct:    3 NGDEQQRKLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAKRAISREDSLKPGAHLKVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVRKALSKQE 180          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009806.1 (pep scaffold:Pmarinus_7.0:GL479354:9188:12030:-1 gene:ENSPMAG00000008859.1 transcript:ENSPMAT00000009806.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 1.167e-21
Identity = 59/180 (32.78%), Postives = 95/180 (52.78%), Query Frame = 3
Query:   78 DERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSK 617
            + R   L + GL   TTE+ LK ++S +G +V   +  DP TGKS+G+GFV ++D  S   A   R H + G   D+K  +P+    P      NR+FVGR   ++  +DLR +FG++G + D  I        R FGFVTF + + V + +  +   + G  + +  A P++  K +S+
Sbjct:  107 EPRVSDLVVLGLPWTTTEDELKDYFSAFGSVVLSQIKTDPATGKSKGYGFVRFADHESQLKAMGMR-HMIGGRWCDAK--LPQSKMYPT-DPDRNRIFVGRCPEDITPEDLRSFFGQFGDVTDVYIPK----PFRSFGFVTFAN-EHVAQSLCGQDVIVKGASVHIASAEPKNQLKRSSR 277          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 140.969 bits (354), Expect = 1.026e-37
Identity = 65/180 (36.11%), Postives = 115/180 (63.89%), Query Frame = 3
Query:   57 ETMRGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPR 593
            E  + ++ +   K+FIGGL+  TTE++L+ ++ ++G + D+ +M+DP TG+SRGFGF+++   SSVD+    + H +DG  +D KRA+P+++          ++FVG +  +V   +  ++F ++GTI DA ++++   G+SRGFGFVT+D  D+VD++   +        IE+K+A PR
Sbjct:  148 ERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQ-HILDGKVIDPKRAIPRDE-----QDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPR 321          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 75.0998 bits (183), Expect = 3.922e-15
Identity = 57/191 (29.84%), Postives = 93/191 (48.69%), Query Frame = 3
Query:   96 LFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSS-SVDDAQSNRPHEVDGIKVDSKRAMPKED----TSPEFHA----------TVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQL-DGNPIEVKKALPRDDNKSNSKQ 620
            L++  ++ +TT+E  +  ++++G IV   + +D   GK +GFGFV Y     +V   ++    E++G K+   RA  K +       ++ A           VN LFV  L  +V  + L + F  YGTI  A ++   NG+S+GFGFV F   +   K I  +  Q+  G P+ V  A  +D  +S   Q
Sbjct:  221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVN-LFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQ 409          

HSP 2 Score: 55.8398 bits (133), Expect = 6.295e-9
Identity = 42/173 (24.28%), Postives = 83/173 (47.98%), Query Frame = 3
Query:   96 LFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVD---DAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDD-TDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            +FI  LH     ++L   +S +G+I+   +  D + GKS+GFGFV + +  +     DA +        I V    +  + D+   E  A    L+V  +      +  ++ F ++G I  A +  +++G+ +GFGFV ++   D+V  +      +L+G  + V +A  +++
Sbjct:  128 IFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNE 299          

HSP 3 Score: 51.9878 bits (123), Expect = 8.333e-8
Identity = 47/178 (26.40%), Postives = 79/178 (44.38%), Query Frame = 3
Query:   96 LFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAM-PKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKII-VTRPHQLDGNPIEVKKALPRDDNKSNSKQS 623
            L++G L    +E  L   +S  G +  + V RD  T  S G+ +V ++D  +   A     +    IK    R M  + D S     + N +F+  L  ++    L   F  +G I  + I  + NG+S+GFGFV F++  +  + I       L+G  I V   L R +  S  +++
Sbjct:   40 LYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNY--TPIKGRLCRIMWSQRDPSLRKKGSGN-IFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEET 214          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 60.077 bits (144), Expect = 1.841e-10
Identity = 47/180 (26.11%), Postives = 85/180 (47.22%), Query Frame = 3
Query:   96 LFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDA-QSNRPHEVDG--IKVDSKRAMPK--EDTSPEFHATVNR----LFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGES-RGFGFVTFDDTDSVDKII-VTRPHQLDGNPIEVKKALPRDDN 602
            +F+G L     +E LK  +   G ++   V+ +  T +SRG+G+V + + S  + A Q  +  E+DG  I  D   + P    D + +F  T +     LF+G L  N   D + + F ++G +    I  +   E  +GFG+V F + +   K +   +   +D  P+ +  + PR +N
Sbjct:  170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPRPNN 349          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 57.7658 bits (138), Expect = 1.039e-9
Identity = 50/172 (29.07%), Postives = 85/172 (49.42%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDA-QSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGT-IADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQ-LDGNPIEVKKALPRD 596
            + L++G L    TE+ LK ++   G I ++ +M D +  K+  + FV Y  S   + A Q+    +++   V    A   + +S +   T N LFVG L  NV  + LR  F ++ + ++  V+ +   G SRG+GFV+F   D     + +   Q L+G P+ +  A  RD
Sbjct:   75 RVLYVGNLDKAITEDILKQYFQVGGPIANIKIMID-KNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSD--DTFN-LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD 242          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Yeast
Match: NOP4 (Nucleolar protein; essential for processing and maturation of 27S pre-rRNA and large ribosomal subunit biogenesis; constituent of 66S pre-ribosomal particles; contains four RNA recognition motifs (RRMs) [Source:SGD;Acc:S000005964])

HSP 1 Score: 53.9138 bits (128), Expect = 2.582e-8
Identity = 32/96 (33.33%), Postives = 54/96 (56.25%), Query Frame = 3
Query:  366 LFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFD-DTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTP 650
            LFV  + ++V  + L  +F  +  I  AV++ ++N  SRGFGFV+F  + D+ + +   R  + +G+ + V  A  RD     SK+++ V  KSTP
Sbjct:   28 LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKARKTKFNGHILRVDIAKRRD----RSKKTSEVVEKSTP 119          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Nematostella
Match: EDO39879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S5])

HSP 1 Score: 139.813 bits (351), Expect = 8.459e-40
Identity = 67/169 (39.64%), Postives = 109/169 (64.50%), Query Frame = 3
Query:   93 KLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVII-NNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRD 596
            K+FIGGL  +TT E L+  + ++GE+ + VVMRDP T +SRGFGF+T+ D  +VD   ++   E+DG K+D K A+PK   + +   T  ++F+G L  N   +D+++YF ++G I + +++ + +    RGFGFVTF+  +S DK   T+ H ++   +EVKKA P++
Sbjct:    1 KMFIGGLSWQTTAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKIDPKLAVPKRAPA-KMVTTTKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKE 168          

HSP 2 Score: 76.6406 bits (187), Expect = 1.531e-16
Identity = 36/80 (45.00%), Postives = 54/80 (67.50%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKE 329
            KK+FIGGL   T+EE +K ++SQ+G+I + ++M D  T + RGFGFVT+   +S D A   + H ++  KV+ K+A PKE
Sbjct:   89 KKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKE 168          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Nematostella
Match: EDO49349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG33])

HSP 1 Score: 131.339 bits (329), Expect = 1.082e-36
Identity = 68/176 (38.64%), Postives = 109/176 (61.93%), Query Frame = 3
Query:   93 KLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEY------GTIADAVIINNSN--GESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPR 593
            K+FIGGL+  TTEE LK ++SQWG IVD V+M+  + G+SRGFGFVTY  S SV++    + H +D  +++ KR++P++++ +PE  +   ++FVG L    V +D+++YF         G + D  +  + +     RGF FVTFD+ + V+K+   + H++     EVKKA P+
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMK--RDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 174          

HSP 2 Score: 77.0258 bits (188), Expect = 8.620e-17
Identity = 38/108 (35.19%), Postives = 66/108 (61.11%), Query Frame = 3
Query:  363 RLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTPRGGYSNSTASNN 686
            ++F+G L  N   + L+ YF ++GTI D VI+   +G SRGFGFVT++ +DSV++++  + H LD   IE K+++PRD++ +    S     +    GG +++T   +
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKR-DGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSK---TRKIFVGGLASTTVEED 104          

HSP 3 Score: 50.447 bits (119), Expect = 1.451e-7
Identity = 28/86 (32.56%), Postives = 48/86 (55.81%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQW------GEIVDVVVMRDPQTGKS-RGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPK 326
            +K+F+GGL   T EE +K +++        GE++DV + RD    K  RGF FVT+ +   V+   + + HE+   + + K+A P+
Sbjct:   89 RKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 174          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Nematostella
Match: EDO38417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX6])

HSP 1 Score: 130.568 bits (327), Expect = 5.916e-35
Identity = 71/171 (41.52%), Postives = 104/171 (60.82%), Query Frame = 3
Query:   93 KLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNR-PHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGE-YGTIADA-VIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRD 596
            KLF+GGL  +TT+ESLK ++S++GE+V V +  D  TG+ RGF FV +   S  D   +   PH +DG  +D K A P        H  V ++FVG LK     + +R+YFG+ Y  + +   I  +S+   RGF FV+FD  D+VDKI  T+ H ++GN +EVK+ALP++
Sbjct:   30 KLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVDPHVLDGRTIDPKPAAPIGKPP---HLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPKE 197          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Nematostella
Match: EDO36522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF0])

HSP 1 Score: 123.635 bits (309), Expect = 1.295e-33
Identity = 62/176 (35.23%), Postives = 100/176 (56.82%), Query Frame = 3
Query:   93 KLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSD----SSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQ----YFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRD 596
            KLF+GGL+ +TT E+L+ ++  +GE+ DVVV+ D  T KSRGFG+VT++D     + + D   N  H +DG +V+ KRA+P++D S   H    ++FVG L  +   +D+++       E     D ++      + RGF FV  ++ D  D++   +   + G  +E KKA PRD
Sbjct:   15 KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDDNSATSHEKTKKIFVGGLPEDATKEDIQEAIESLLEEKVDKVDLIMKKEDETKHRGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPRD 190          

HSP 2 Score: 75.0998 bits (183), Expect = 5.207e-16
Identity = 38/91 (41.76%), Postives = 56/91 (61.54%), Query Frame = 3
Query:  363 RLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNS-NGESRGFGFVTFDDTDSVDKIIVTR----PHQLDGNPIEVKKALPRDDNKSNSKQ 620
            +LFVG L R    + LR+YF  YG + D V+I +S   +SRGFG+VTF D      ++  +     H++DG  +EVK+A+PRDDN + S +
Sbjct:   15 KLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDDNSATSHE 105          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Nematostella
Match: EDO42151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2H6])

HSP 1 Score: 121.709 bits (304), Expect = 4.046e-33
Identity = 64/169 (37.87%), Postives = 107/169 (63.31%), Query Frame = 3
Query:   90 KKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSN-RPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGE---YGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKA 584
            KKL++GGL  +TTEE+++  + Q+GEI ++ ++R P+ GKS+GF FV++SDS SVD+   N   H +DG K++ KRA+P+ DT+P  H    +LFVG LK     +D++    E   +   +  ++ +    + +G+ FV F++   VDK+ + R  ++ G P+E+KKA
Sbjct:   10 KKLYVGGLKEETTEENIREHFQQYGEITELNLVRTPE-GKSKGFCFVSFSDSDSVDNILFNFESHSLDGKKIEVKRAIPRGDTNPLAHVRTKKLFVGGLKNEQTEEDIKTALAEMVPFPPESIKLMKDKMTNKFKGYAFVNFNNEHIVDKLYIIRKAEVAGLPVELKKA 177          

HSP 2 Score: 78.9518 bits (193), Expect = 1.845e-17
Identity = 41/108 (37.96%), Postives = 64/108 (59.26%), Query Frame = 3
Query:  357 VNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVT-RPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTPR---GGYSN 668
            + +L+VG LK     +++R++F +YG I +  ++    G+S+GF FV+F D+DSVD I+     H LDG  IEVK+A+PR D       +NP+ +  T +   GG  N
Sbjct:    9 IKKLYVGGLKEETTEENIREHFQQYGEITELNLVRTPEGKSKGFCFVSFSDSDSVDNILFNFESHSLDGKKIEVKRAIPRGD-------TNPLAHVRTKKLFVGGLKN 109          

HSP 3 Score: 50.447 bits (119), Expect = 1.479e-7
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 3
Query:   84 RGKKLFIGGLHLKTTEESLKGFYSQWGEIV-----DVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRA 317
            R KKLF+GGL  + TEE +K   +   E+V      + +M+D  T K +G+ FV +++   VD     R  EV G+ V+ K+A
Sbjct:   98 RTKKLFVGGLKNEQTEEDIK---TALAEMVPFPPESIKLMKDKMTNKFKGYAFVNFNNEHIVDKLYIIRKAEVAGLPVELKKA 177          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Medaka
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:101164602])

HSP 1 Score: 176.022 bits (445), Expect = 2.134e-51
Identity = 87/175 (49.71%), Postives = 120/175 (68.57%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINN-SNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+  + QWG + D VVMRDP + +SRGFGFVTYS+ + VDDA   RPH+VDG  V+ KRA+ +ED+  P  H TV ++FVG +K +     +R+YF +YG I    I+   S G+ RGF FVTFDD D+VDKI+  + H ++ +  EV+KAL + +
Sbjct:   10 EQLRKLFIGGLSFETTEESLRAHFEQWGSLTDCVVMRDPNSKRSRGFGFVTYSNVTEVDDAMKARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFEKYGKIECIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHIINFHNCEVRKALSKQE 184          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Medaka
Match: hnrnpa3 (heterogeneous nuclear ribonucleoprotein A3 [Source:NCBI gene;Acc:101164602])

HSP 1 Score: 176.022 bits (445), Expect = 2.463e-51
Identity = 87/175 (49.71%), Postives = 120/175 (68.57%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINN-SNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +TTEESL+  + QWG + D VVMRDP + +SRGFGFVTYS+ + VDDA   RPH+VDG  V+ KRA+ +ED+  P  H TV ++FVG +K +     +R+YF +YG I    I+   S G+ RGF FVTFDD D+VDKI+  + H ++ +  EV+KAL + +
Sbjct:   19 EQLRKLFIGGLSFETTEESLRAHFEQWGSLTDCVVMRDPNSKRSRGFGFVTYSNVTEVDDAMKARPHKVDGRVVEPKRAVSREDSNKPGAHLTVKKIFVGGIKEDTEEYHIREYFEKYGKIECIDIMEERSTGKKRGFCFVTFDDHDTVDKIVAQKYHIINFHNCEVRKALSKQE 193          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Medaka
Match: ENSORLT00000010040.2 (heterogeneous nuclear ribonucleoprotein A1 [Source:NCBI gene;Acc:101174914])

HSP 1 Score: 175.252 bits (443), Expect = 3.131e-51
Identity = 86/178 (48.31%), Postives = 122/178 (68.54%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTS-PEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSN-GESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKS 608
            E+ +KLFIGGL  +TT+ESL+  + QWG + D VVMRDP + +SRGFGFVTYS    VD A S RPH+VDG  V+ KRA+ +ED++ P  H TV ++FVG +K +     LR YF ++G I    I+ + N G+ RGF FVTFDD DSVD+I++ + H ++ +  EV+KAL + + ++
Sbjct:   10 EQLRKLFIGGLSFETTDESLRAHFEQWGTLTDCVVMRDPNSKRSRGFGFVTYSSVQEVDAAMSARPHKVDGRVVEPKRAVSREDSNRPGAHITVKKIFVGGIKEDTEESHLRDYFQQFGKIEVIDIMTDRNTGKKRGFAFVTFDDHDSVDRIVIQKYHTINSHNCEVRKALTKQEMQT 187          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Medaka
Match: msi2a (musashi RNA binding protein 2 [Source:NCBI gene;Acc:101163923])

HSP 1 Score: 149.443 bits (376), Expect = 1.117e-41
Identity = 68/169 (40.24%), Postives = 113/169 (66.86%), Query Frame = 3
Query:   93 KLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVII-NNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRD 596
            K+FIGGL  +T+ +SL+ ++S++GEI + +VMRDP T +SRGFGFVT++D++SVD   + + HE+D   +D K A P+    P+      ++FVG L  N V +D++QYF ++G + DA+++ + +    RGFGF+TF+  D V+K+     H+++   +E KKA P++
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHELDSKTIDPKVAFPRR-AQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKAQPKE 189          

HSP 2 Score: 67.781 bits (164), Expect = 2.388e-12
Identity = 32/86 (37.21%), Postives = 50/86 (58.14%), Query Frame = 3
Query:   84 RGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSP 341
            R KK+F+GGL   T  E +K ++ Q+G++ D ++M D  T + RGFGF+T+     V+       HE++   V+ K+A PKE   P
Sbjct:  108 RTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMFP 193          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Medaka
Match: msi2a (musashi RNA binding protein 2 [Source:NCBI gene;Acc:101163923])

HSP 1 Score: 149.443 bits (376), Expect = 1.898e-41
Identity = 68/169 (40.24%), Postives = 113/169 (66.86%), Query Frame = 3
Query:   93 KLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVII-NNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRD 596
            K+FIGGL  +T+ +SL+ ++S++GEI + +VMRDP T +SRGFGFVT++D++SVD   + + HE+D   +D K A P+    P+      ++FVG L  N V +D++QYF ++G + DA+++ + +    RGFGF+TF+  D V+K+     H+++   +E KKA P++
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFTDAASVDKVLAQQHHELDSKTIDPKVAFPRR-AQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKAQPKE 189          

HSP 2 Score: 67.781 bits (164), Expect = 3.156e-12
Identity = 32/86 (37.21%), Postives = 50/86 (58.14%), Query Frame = 3
Query:   84 RGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSP 341
            R KK+F+GGL   T  E +K ++ Q+G++ D ++M D  T + RGFGF+T+     V+       HE++   V+ K+A PKE   P
Sbjct:  108 RTKKIFVGGLSANTVVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFITFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMFP 193          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Planmine SMEST
Match: SMESG000081075.1 (SMESG000081075.1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 309/309 (100.00%), Postives = 309/309 (100.00%), Query Frame = 3
Query:   63 MRGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTPRGGYSNSTASNNRXXXXXXXXXXXXXXXXANSTYNNRNYGTSFNQGYSQNYSSNKFSNNRLSESFENETSYSQPTYGNETNYSYGQYDTPNXXXXXXXXXXXXXAMGEYNQRQ 989
            MRGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTPRGGYSNSTASNNRYSQQDDYSSSYGSYPSANSTYNNRNYGTSFNQGYSQNYSSNKFSNNRLSESFENETSYSQPTYGNETNYSYGQYDTPNPPSSRYGYPPYSSAMGEYNQRQ
Sbjct:    1 MRGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTPRGGYSNSTASNNRYSQQDDYSSSYGSYPSANSTYNNRNYGTSFNQGYSQNYSSNKFSNNRLSESFENETSYSQPTYGNETNYSYGQYDTPNPPSSRYGYPPYSSAMGEYNQRQ 309          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Planmine SMEST
Match: SMESG000025890.1 (SMESG000025890.1)

HSP 1 Score: 217.238 bits (552), Expect = 1.750e-67
Identity = 104/175 (59.43%), Postives = 134/175 (76.57%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIIN-NSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            E+ +KLFIGGL  +T E  L+ +Y QWGE+VD VVM+D +TG+SRGFGFVTY D   VD+AQ+NRPHEVDG  V++KRAMP+ED+ +PE H TVN+LFVG LK++V  + LR YF  YGTI D  I+    +GESRGFGFVTFDD D VDK I+ +PHQ+  + ++VKKAL +D+
Sbjct:   14 EQFRKLFIGGLTPQTDEIRLRKYYEQWGELVDFVVMKDNKTGRSRGFGFVTYRDPEMVDEAQNNRPHEVDGKIVEAKRAMPREDSNTPESHMTVNKLFVGGLKKDVTTEHLRHYFTSYGTITDCEIVTWKDSGESRGFGFVTFDDYDPVDKAILYKPHQIGSSRVDVKKALSKDE 188          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Planmine SMEST
Match: SMESG000050993.1 (SMESG000050993.1)

HSP 1 Score: 205.682 bits (522), Expect = 9.092e-64
Identity = 108/201 (53.73%), Postives = 140/201 (69.65%), Query Frame = 3
Query:   81 ERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMR-DPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIIN-NSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDNKS-NSKQS-NPVGNKSTPRGGYSN 668
            E+ +KLFIGGL   TTE++LK  + QWGE+VDVVVMR   + GKSRGFGFVTY D   VD AQ++RPH +D   V++KRAMP+++  S E H TV +LFVG LK+ VVADDLR YFG +G I +  II     GESRGFGFVT+DD D VDKI++ +PH +D    EVKKAL +++ +S  +K+S + +G    P    SN
Sbjct:   12 EQFRKLFIGGLSFVTTEDALKSHFEQWGELVDVVVMRMGGKNGKSRGFGFVTYKDPDMVDAAQASRPHIIDDRTVETKRAMPRDEANSAESHMTVKKLFVGALKKEVVADDLRDYFGRFGNITECEIITWRETGESRGFGFVTYDDYDPVDKILLLKPHYIDNKRCEVKKALSKEEARSLKAKESMSTIGKSKFPSMSQSN 212          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Planmine SMEST
Match: SMESG000080165.1 (SMESG000080165.1)

HSP 1 Score: 203.756 bits (517), Expect = 7.279e-62
Identity = 97/184 (52.72%), Postives = 133/184 (72.28%), Query Frame = 3
Query:   54 SETMRGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVIIN-NSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDD 599
            SE  +  I E+ +KLFIGGL   T+EE L+ +Y QWGE+VD VVM+D  +G+SRGFGFVTY +   VD+AQ+NRPHE+DG  V++KRAMP+ED+  PE H TV +LFVG LK+ +V  +L  YF +YG + +  I++    G+SRGFGFV FDD D VDK I+ +PH +  + I+VKKAL +++
Sbjct:    6 SEYDQERISEQFRKLFIGGLTPNTSEEKLRKYYQQWGELVDAVVMKDCNSGRSRGFGFVTYKEVFMVDEAQNNRPHEIDGKIVEAKRAMPREDSIHPEAHMTVTKLFVGGLKKEIVNQELVDYFTDYGIVIECEIVSWKDTGKSRGFGFVLFDDYDPVDKAILYKPHFIQSSKIDVKKALSKEE 189          

HSP 2 Score: 81.2629 bits (199), Expect = 1.103e-16
Identity = 35/81 (43.21%), Postives = 56/81 (69.14%), Query Frame = 3
Query:  363 RLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSN-GESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKALPRDDN 602
            +LF+G L  N   + LR+Y+ ++G + DAV++ + N G SRGFGFVT+ +   VD+    RPH++DG  +E K+A+PR+D+
Sbjct:   19 KLFIGGLTPNTSEEKLRKYYQQWGELVDAVVMKDCNSGRSRGFGFVTYKEVFMVDEAQNNRPHEIDGKIVEAKRAMPREDS 99          
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Planmine SMEST
Match: SMESG000038668.1 (SMESG000038668.1)

HSP 1 Score: 156.762 bits (395), Expect = 4.833e-44
Identity = 70/152 (46.05%), Postives = 106/152 (69.74%), Query Frame = 3
Query:  138 LKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDT-SPEFHATVNRLFVGRLKRNVVADDLRQYFGEYGTIADAVII-NNSNGESRGFGFVTFDDTDSVDKIIVTRPHQLDGNPIEVKKAL 587
            ++ ++S++G++ DVV MRD    KSRGFGFV + ++ SVD  Q+ RPH++ G  VD+KRAMPKE++ +P+ H    R+F+G ++R    DDL+ YF  +G I D  I  +N +G+SRGF F+TF D D VDK+I+++PH +    ++VKKAL
Sbjct:    1 MRQYFSKYGDVCDVVAMRDKTGNKSRGFGFVVFKEADSVDRCQAERPHQLLGKIVDTKRAMPKEESLNPDIHCNSKRIFIGGIRRFFTEDDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKAL 152          

HSP 2 Score: 80.4925 bits (197), Expect = 1.603e-16
Identity = 36/92 (39.13%), Postives = 58/92 (63.04%), Query Frame = 3
Query:   57 ETMRGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKSRGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKED 332
            E++  +I    K++FIGG+    TE+ LK ++S +GEIVD  + RD  +G+SRGF F+T++D   VD    ++PH +    VD K+A+  E+
Sbjct:   65 ESLNPDIHCNSKRIFIGGIRRFFTEDDLKDYFSNFGEIVDCTIKRDNVSGQSRGFAFITFTDRDIVDKVILSKPHAIRHCIVDVKKALSPEE 156          
The following BLAST results are available for this feature:
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPA2B14.821e-5549.72heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B11.341e-5450.86heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B11.341e-5450.86heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B11.702e-5450.86heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA2B11.702e-5450.86heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrp-16.686e-4844.77Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-16.686e-4844.77Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-16.851e-4844.77Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
hrp-16.851e-4844.77Heterogeneous nuclear ribonucleoprotein A1 [Sourc... [more]
msi-11.060e-4342.01MuSashI (Fly neural) family; Neural RNA-binding pr... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hrb98DE6.039e-5851.12gene:FBgn0001215 transcript:FBtr0085299[more]
Hrb98DE6.996e-5851.12gene:FBgn0001215 transcript:FBtr0085298[more]
Hrb98DE8.527e-5852.60gene:FBgn0001215 transcript:FBtr0085302[more]
Hrb98DE8.527e-5852.60gene:FBgn0001215 transcript:FBtr0085303[more]
Hrb98DE9.981e-5852.60gene:FBgn0001215 transcript:FBtr0085300[more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa37.657e-5549.45heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa1a2.199e-5449.71heterogeneous nuclear ribonucleoprotein A1a [Sourc... [more]
hnrnpa35.958e-5449.45heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa31.305e-5349.45heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa1b2.034e-4946.86heterogeneous nuclear ribonucleoprotein A1b [Sourc... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa2b16.339e-5447.09heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b11.688e-5346.67heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b11.913e-5347.62heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
hnrnpa2b13.659e-5349.14heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
deup13.769e-5350.55deuterosome assembly protein 1 [Source:Xenbase;Acc... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpa2b12.710e-5550.86heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b12.710e-5550.86heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b12.710e-5550.86heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b19.205e-5550.86heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
Hnrnpa2b19.205e-5550.86heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P21522|ROA1_SCHAM1.240e-5856.07Heterogeneous nuclear ribonucleoprotein A1, A2/B1 ... [more]
sp|P07909|ROA1_DROME1.001e-5652.60Heterogeneous nuclear ribonucleoprotein A1 OS=Dros... [more]
sp|Q9TTV2|ROA2_SAGOE1.707e-5450.86Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
sp|P51990|RO22_XENLA1.976e-5450.86Heterogeneous nuclear ribonucleoprotein A2 homolog... [more]
sp|Q5RBU8|ROA2_PONAB5.347e-5450.86Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GXY50.000e+0100.00Heterogeneous nuclear ribonucleoprotein A1 A2/B1 (... [more]
H2KT133.520e-7361.80Heterogeneous nuclear ribonucleoproteins A2/B1 OS=... [more]
A0A1S8WK604.739e-7361.80Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2LTP65.248e-7361.80Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5K3EK812.107e-7262.57Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa39.398e-5248.35heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa1a1.468e-5146.11heterogeneous nuclear ribonucleoprotein A1-like [S... [more]
hnrnpa1a1.468e-5146.11heterogeneous nuclear ribonucleoprotein A1-like [S... [more]
ENSAMXT00000025677.23.077e-4544.25pep primary_assembly:Astyanax_mexicanus-2.0:24:390... [more]
ENSAMXT00000047970.14.117e-4445.61pep primary_assembly:Astyanax_mexicanus-2.0:24:139... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPA2B11.192e-5447.46heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA05.576e-5449.16heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
ENSPMAT00000004893.11.460e-5247.43pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
HNRNPA01.560e-5247.75heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
ENSPMAT00000009806.11.167e-2132.78pep scaffold:Pmarinus_7.0:GL479354:9188:12030:-1 g... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRP11.026e-3736.11Subunit of cleavage factor I; cleavage factor I is... [more]
PAB13.922e-1529.84Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NSR11.841e-1026.11Nucleolar protein that binds nuclear localization ... [more]
PUB11.039e-929.07Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
NOP42.582e-833.33Nucleolar protein; essential for processing and ma... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398798.459e-4039.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493491.082e-3638.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384175.916e-3541.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365221.295e-3335.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421514.046e-3337.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpa32.134e-5149.71heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
hnrnpa32.463e-5149.71heterogeneous nuclear ribonucleoprotein A3 [Source... [more]
ENSORLT00000010040.23.131e-5148.31heterogeneous nuclear ribonucleoprotein A1 [Source... [more]
msi2a1.117e-4140.24musashi RNA binding protein 2 [Source:NCBI gene;Ac... [more]
msi2a1.898e-4140.24musashi RNA binding protein 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein A1 A2/B1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081075.10.000e+0100.00SMESG000081075.1[more]
SMESG000025890.11.750e-6759.43SMESG000025890.1[more]
SMESG000050993.19.092e-6453.73SMESG000050993.1[more]
SMESG000080165.17.279e-6252.72SMESG000080165.1[more]
SMESG000038668.14.833e-4446.05SMESG000038668.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012822
GenBankAKG62107.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012822 ID=SMED30012822|Name=heterogeneous nuclear ribonucleoprotein A1 A2/B1|organism=Schmidtea mediterranea sexual|type=transcript|length=1191bp
CTTCCACATTAAGATTTGTTTAAATAAGTATCATAAATAAACATTGAAAT
CTTTCTGAAACGATGCGTGGCAATATTGATGAACGTGGAAAAAAACTTTT
TATTGGTGGTCTTCATTTGAAAACAACCGAAGAAAGTTTAAAAGGATTTT
ATTCTCAATGGGGAGAAATAGTTGATGTTGTTGTAATGAGAGATCCACAA
ACTGGAAAGTCAAGAGGTTTTGGATTTGTAACATATTCTGATTCATCATC
AGTTGATGATGCTCAAAGCAACAGACCCCACGAAGTAGATGGCATTAAAG
TTGATTCCAAAAGGGCTATGCCAAAGGAAGATACATCACCTGAATTCCAT
GCAACAGTAAATCGCTTGTTTGTTGGAAGACTTAAGCGAAACGTAGTAGC
TGATGATTTGAGACAATATTTTGGAGAATATGGTACTATTGCTGATGCAG
TTATAATAAACAATTCTAATGGCGAATCTCGTGGTTTTGGATTTGTTACT
TTTGATGACACTGACTCAGTTGATAAGATCATTGTTACTCGACCCCATCA
ATTGGATGGAAATCCTATAGAAGTTAAGAAAGCTCTACCTAGAGATGACA
ATAAATCTAATTCTAAACAATCAAATCCAGTAGGAAATAAATCTACACCA
AGAGGAGGATATAGCAATAGTACTGCTTCAAATAACCGTTACTCACAACA
AGATGACTATAGTTCTTCATATGGTAGCTATCCTAGTGCTAATAGCACCT
ATAACAATAGGAACTACGGAACTAGTTTTAATCAAGGATACTCACAAAAC
TATAGTAGCAATAAGTTTAGCAACAATAGATTAAGTGAAAGTTTCGAAAA
TGAAACCAGTTATAGTCAACCAACATATGGTAATGAAACTAATTACAGTT
ACGGACAATATGATACACCTAACCCCCCTTCGAGTCGATATGGGTATCCT
CCATACAGTAGTGCTATGGGTGAATATAATCAAAGACAAGGAGGTGGTCC
AATGAGGGGGGCGCCAAGGCCCAGTAGGGGTGGCGCTGGTGGATATGGAA
ATTATCCTTATTAAGTATAAATTGTATGTAGAAAACACTTAATTTTGCAT
TCATTTTTAGGTATTTACTTGTTTCCTGCGTATTACTGTATTGCTAATAA
ATGTGTATTAATGAATATATTTATTTGTTTAATTAAAAAAA
back to top

protein sequence of SMED30012822-orf-1

>SMED30012822-orf-1 ID=SMED30012822-orf-1|Name=SMED30012822-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=334bp
MRGNIDERGKKLFIGGLHLKTTEESLKGFYSQWGEIVDVVVMRDPQTGKS
RGFGFVTYSDSSSVDDAQSNRPHEVDGIKVDSKRAMPKEDTSPEFHATVN
RLFVGRLKRNVVADDLRQYFGEYGTIADAVIINNSNGESRGFGFVTFDDT
DSVDKIIVTRPHQLDGNPIEVKKALPRDDNKSNSKQSNPVGNKSTPRGGY
SNSTASNNRYSQQDDYSSSYGSYPSANSTYNNRNYGTSFNQGYSQNYSSN
KFSNNRLSESFENETSYSQPTYGNETNYSYGQYDTPNPPSSRYGYPPYSS
AMGEYNQRQGGGPMRGAPRPSRGGAGGYGNYPY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037366BOULE/DAZ
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: cellular component
TermDefinition
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 101..172
e-value: 1.5E-20
score: 84.3
coord: 11..81
e-value: 4.1E-22
score: 89.5
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 12..70
e-value: 1.6E-15
score: 56.6
coord: 102..167
e-value: 1.8E-14
score: 53.3
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 10..93
score: 16.637
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 100..176
score: 17.114
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 95..191
e-value: 8.7E-22
score: 79.2
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 3..94
e-value: 2.1E-23
score: 84.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 299..333
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 181..220
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 167..220
NoneNo IPR availablePANTHERPTHR11176:SF13GENE 17190-RELATEDcoord: 96..320
coord: 8..92
NoneNo IPR availableCDDcd12578RRM1_hnRNPA_likecoord: 11..88
e-value: 4.62387E-43
score: 141.354
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 96..320
coord: 8..92
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 9..92
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 89..202