Methionine synthase

Overview
NameMethionine synthase
Smed IDSMED30012817
Length (bp)3851
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Methionine synthase (SMED30012817) t-SNE clustered cells

Violin plots show distribution of expression levels for Methionine synthase (SMED30012817) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Methionine synthase (SMED30012817) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Methionine synthase (SMED30012817) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012817

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30012817SMESG000054393.1 dd_Smed_v4_10302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012817SMESG000054393.1 dd_Smed_v4_10302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012817SMESG000054393.1 dd_Smed_v4_10302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30012817SMESG000054393.1 dd_Smed_v4_10302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30012817SMESG000054393.1 dd_Smed_v4_10302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012817SMESG000054393.1 dd_Smed_v4_10302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Methionine synthase vs. Ensembl Human
Match: MTR (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:HGNC Symbol;Acc:HGNC:7468])

HSP 1 Score: 1596.64 bits (4133), Expect = 0.000e+0
Identity = 800/1259 (63.54%), Postives = 987/1259 (78.40%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEEREDPN---YLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            ++K ++  + + L++RIM+LDG MGTMIQ  KL E  FRG+ FKDH + L+GNND+LS+T+PD+++ IHKE+L +GADIIETNTFS T+IAQADYGLEH+ Y++N  SA +ARKA + V+ ++GI RFVAGA+GPTN+TLS+SPSVE+P+YRNITFD+LV AY+EQA  LLDGGVDILLIETIFDTANAKAA+FAL  +FEE     P+FISGTIVDKSGR LSGQT E F+ S+SH +P+CIGLNCALGA++MRPFIE I   TT++V+CYPNAGLPNTFG YDE P    + L  FA DGL+NIVGGCCG+TP HI  I +AV+   PR+PP T FE  ++LSGLE F I P T  FVNIGERCNVAGSR+F +LI    YEEAL +AK QVE GAQV+D+NMD+GML+G  AMT+F NLI+SEPDI+KVPLCIDSSNFAVIEAGLKC QGKCIVNSISLKEGE DF  K + IKK+GAA+V+MAFDE+GQA + D KI +C R Y LLV K+ FNPNDIIFD NILTIGTGMEEHN Y ++FI AT+ +K+ LP A++SGG+SN+SFSFRG E +REAMH VFL+HAIK+GMDMGIVNAG LPVYDDI   LL+LCED++WNK  +AT++LL YA+    +    +++T D WR+  V ERLE++LVKGI+K+IIEDTEEAR   K + RPL++IEGPLM GM  VGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFME+E+     ++G    E  Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P +KIL+ AL+ KAD+IGLSGLITPSL+EM+ VA+EMERL +R PLLIGGATTS+ HTAVKIAP+YS P +HVLDASKSVVV + LLD+    E+ E I EEYE+IR++HYESL ER YL + +ARK   Q++W +      +P F+G+++ E+ D+  L+ YIDWKPFFDVWQLRGKYPNRG+PKIFNDK VG EA+ ++ DA  +L  +I  K L   GV+GF+PA S  DDI LY  ++        + T +GLRQQ E++  +   Y C+SDFIAP+ SG  DY+G+FAV A  G + L++ ++D GDDY+S+MVKAL DRLAEA AE LH  VR  LW Y  +E L   D  ++ Y GIRPAPGYP+QPDH+E+ T+W L   E+  GI L  +SL M+PA++VSGLYFS+ KSKYF+VGKISKDQV DYA RK IS+ E EK L  IL Y+TD
Sbjct:   14 LKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHARPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMCSAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQTGEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDETPSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATAFEGHMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDGMLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDDFLEKARKIKKYGAAMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQT-QGTGGKKVIQT-DEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQKKYPRPLNIIEGPLMNGMKIVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKSGFQMDW-LSEPHPVKPTFIGTQVFEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTLISQKKLRARGVVGFWPAQSIQDDIHLY-AEAAVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAV-ACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL-TESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPILGYDTD 1265          
BLAST of Methionine synthase vs. Ensembl Human
Match: MTR (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:HGNC Symbol;Acc:HGNC:7468])

HSP 1 Score: 1498.8 bits (3879), Expect = 0.000e+0
Identity = 762/1256 (60.67%), Postives = 944/1256 (75.16%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEEREDPN---YLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            ++K ++  + + L++RIM+LDG MGTMIQ  KL E  FRG+ FKDH + L+GNND+LS+T+PD+++ IHKE+L +GADIIETNTFS T+IAQADYGLEH+ Y++N  SA +ARKA + V+ ++GI RFVAGA+GPTN+TLS+SPSVE+P+YRNITFD+LV AY+EQA  LLDGGVDILLIETIFDTANAKAA+FAL  +FEE     P+FISGTIVDKSGR LSGQT E F+ S+SH +P+CIGLNCALGA++MRPFIE I   TT++V+CYPNAGLPNTFG YDE P    + L  FA DGL+NIVGGCCG+TP HI  I +AV+   PR+PP T FE  ++LSGLE F I P T  FVNIGERCNVAGSR+F +LI    YEEAL +AK QVE GAQV+D+NMD+GML+G  AMT+F NLI+SEPDI+KVPLCIDSSNFAVIEAGLKC QGKCIVNSISLKEGE DF  K + IKK+GAA+V+MAFDE+GQA + D KI +C R Y LLV K+ FNPNDIIFD NILTIGTGMEEHN Y ++FI AT+ +K+ LP A++SGG+SN+SFSFRG E +REAMH VFL+HAIK+GMDMGIVNAG LPVYDDI   LL+LCED++WNK  +AT++LL YA+    +    +++T D WR+  V ERLE++LVK                                                VIKSARVMK+AVG+LIPFME+E+     ++G    E  Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P +KIL+ AL+ KAD+IGLSGLITPSL+EM+ VA+EMERL +R PLLIGGATTS+ HTAVKIAP+YS P +HVLDASKSVVV + LLD+    E+ E I EEYE+IR++HYESL ER YL + +ARK   Q++W +      +P F+G+++ E+ D+  L+ YIDWKPFFDVWQLRGKYPNRG+PKIFNDK VG EA+ ++ DA  +L  +I  K L   GV+GF+PA S  DDI LY  ++        + T +GLRQQ E++  +   Y C+SDFIAP+ SG  DY+G+FAV A  G + L++ ++D GDDY+S+MVKAL DRLAEA AE LH  VR  LW Y  +E L   D  ++ Y GIRPAPGYP+QPDH+E+ T+W L   E+  GI L  +SL M+PA++VSGLYFS+ KSKYF+VGKISKDQV DYA RK IS+ E EK L  IL Y+TD
Sbjct:   14 LKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHARPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMCSAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQTGEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDETPSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATAFEGHMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDGMLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDDFLEKARKIKKYGAAMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQT-QGTGGKKVIQT-DEWRNGPVEERLEYALVK------------------------------------------------VIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKSGFQMDW-LSEPHPVKPTFIGTQVFEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTLISQKKLRARGVVGFWPAQSIQDDIHLY-AEAAVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAV-ACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL-TESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPILGYDTD 1214          
BLAST of Methionine synthase vs. Ensembl Human
Match: MTR (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:HGNC Symbol;Acc:HGNC:7468])

HSP 1 Score: 987.252 bits (2551), Expect = 0.000e+0
Identity = 517/852 (60.68%), Postives = 637/852 (74.77%), Query Frame = 3
Query: 1248 GMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEEREDPN---YLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            GML+G  AMT+F NLI+SEPDI+KVPLCIDSSNFAVIEAGLKC QGKCIVNSISLKEGE                           A + D KI +C R Y LLV K+ FNPNDIIFD NILTIGTGMEEHN Y ++FI AT+ +K+ LP A++SGG+SN+SFSFRG E +REAMH VFL+HAIK+GMDMGIVNAG LPVYDDI   LL+LCED++WNK  +AT++LL YA+    +    +++T D WR+  V ERLE++LVKGI+K+IIEDTEEAR   K + RPL++IEGPLM GM  VGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFME+E+     ++G    E  Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P +KIL+ AL+ KAD+IGLSGLITPSL+EM+ VA+EMERL +R PLLIGGATTS+ HTAVKIAP+YS P +HVLDASKSVVV + LLD+    E+ E I EEYE+IR++HYESL ER YL + +ARK   Q++W +      +P F+G+++ E+ D+  L+ YIDWKPFFDVWQLRGKYPNRG+PKIFNDK VG EA+ ++ DA  +L  +I  K L   GV+GF+PA S  DDI LY  ++        + T +GLRQQ E++  +   Y C+SDFIAP+ SG  DY+G+FAV A  G + L++ ++D GDDY+S+MVKAL DRLAEA AE LH  VR  LW Y  +E L   D  ++ Y GIRPAPGYP+QPDH+E+ T+W L   E+  GI L  +SL M+PA++VSGLYFS+ KSKYF+VGKISKDQV DYA RK IS+ E EK L  IL Y+TD
Sbjct:    1 GMLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGE---------------------------ATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTQ-GTGGKKVIQT-DEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQKKYPRPLNIIEGPLMNGMKIVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKSGFQMDW-LSEPHPVKPTFIGTQVFEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTLISQKKLRARGVVGFWPAQSIQDDIHLY-AEAAVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAV-ACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL-TESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPILGYDTD 819          
BLAST of Methionine synthase vs. Ensembl Human
Match: MTR (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:HGNC Symbol;Acc:HGNC:7468])

HSP 1 Score: 481.1 bits (1237), Expect = 1.607e-158
Identity = 225/346 (65.03%), Postives = 281/346 (81.21%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSG 1064
            ++K ++  + + L++RIM+LDG MGTMIQ  KL E  FRG+ FKDH + L+GNND+LS+T+PD+++ IHKE+L +GADIIETNTFS T+IAQADYGLEH+ Y++N  SA +ARKA + V+ ++GI RFVAGA+GPTN+TLS+SPSVE+P+YRNITFD+LV AY+EQA  LLDGGVDILLIETIFDTANAKAA+FAL  +FEE     P+FISGTIVDKSGR LSGQT E F+ S+SH +P+CIGLNCALGA++MRPFIE I   TT++V+CYPNAGLPNTFG YDE P    + L  FA DGL+NIVGGCCG+TP HI  I +AV+   PR+PP T FE  ++LSG
Sbjct:   14 LKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHARPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMCSAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQTGEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDETPSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATAFEGHMLLSG 359          
BLAST of Methionine synthase vs. Ensembl Human
Match: MTR (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:HGNC Symbol;Acc:HGNC:7468])

HSP 1 Score: 340.117 bits (871), Expect = 3.785e-107
Identity = 161/249 (64.66%), Postives = 204/249 (81.93%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCAL 773
            ++K ++  + + L++RIM+LDG MGTMIQ  KL E  FRG+ FKDH + L+GNND+LS+T+PD+++ IHKE+L +GADIIETNTFS T+IAQADYGLEH+ Y++N  SA +ARKA + V+ ++GI RFVAGA+GPTN+TLS+SPSVE+P+YRNITFD+LV AY+EQA  LLDGGVDILLIETIFDTANAKAA+FAL  +FEE     P+FISGTIVDKSGR LSGQT E F+ S+SH +P+ I L  A 
Sbjct:   14 LKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHARPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMCSAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQTGEGFVISVSHGEPLWILLWMAW 262          
BLAST of Methionine synthase vs. Ensembl Celegans
Match: metr-1 (Probable methionine synthase [Source:UniProtKB/Swiss-Prot;Acc:Q09582])

HSP 1 Score: 1543.1 bits (3994), Expect = 0.000e+0
Identity = 765/1257 (60.86%), Postives = 982/1257 (78.12%), Query Frame = 3
Query:   42 KSVLFSTL----RERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGY-EVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKC---HVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE-DPNYLCISDFIAPIESGC-DDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            +S LF  L    +ERIMI+DGAMGTMIQ   +EE DFRGEI KDH K L+GNNDLLS+T+PDI++ IHK +L++GAD +ETNTFSGT IAQADY  EH+V+++NY+SA++AR+ACD V + +G  R+V GAIGPTNRTLSISPSVEKP++RN+TF +LV AY +QA +L+ GGVD+LL+ET+FD+ANAKAA+FA+  +FE+ G  E+PVF+SGTIVD SGR LSGQT EAFL S    KP+ +GLNCALGA DMR F++ +S  + SF+ICYPNAGLPN  G YDE PE   ++L +FA+DGL+NI+GGCCGTTP HI A+ KAV+G +PR+PP       ++LSGLE  I+ P T  FVNIGERCNVAGSRRF  LIK + Y+ A+ +A+ QV++GAQ++D+NMD+G+L+G  AM+KF+ LISSEPD++K+P+CIDSS+F VI AGL+ TQGKC+VNSISLKEGE  F  + +IIK++GAAVV+MAFDEQGQAA+ D K  IC R Y +L  ++ FNPNDIIFD NILTI TGMEEH+ YGM FI A   +++NLP A VSGGVSNISFSFRG E +REAMHSVFLF+AIKAGMDMGIVNAG LPVY+DI+  LL+L ED+L+N+  +AT++LL  A+ + K       KT D WRSL+V ERL+ +LVKG+D++++ DTEEAR+    + RPL+VIE PLM GM+ VG+LFGAGKMFLPQVIKSARVMK+AV +L+PFME E++  +E  G+  +E  Y GT+VIATVKGDVHDIGKNIV VV+GCNN++V+DLGVM P E I++ A+EEKAD IGLSGLITPSL+EM++VA+EM R+G+  PLLIGGATTS+ HTAVKI+P+Y  P VH LDASKSVVV +SL D +    F +++ E+YE++R+EHY SL +R +  +++ R++K +++W  D F + +P+F+G +  +N D+N L+PYIDWKPFFDVWQLRGKYPNR YPKIF+D DVG EA+ +F DAQ  L ++I  K+L  N V+ F PA SEGDD+ +YDP++      N L T +GLRQQ  RE D  + C+SDFI P+++G  DDY+G+FA TAG+GA+   +  +   DDY S+MVKALADRLAEA AEYLH  VRTTLWGYS NE+LT  D + + Y GIRPA GYP+QPDH+E+ T+W LL+ E+ GI L  + L M PAASVSGLYF++P+S+YF+VGKI +DQV DYA RK +   E E+ L  IL Y+TD
Sbjct:    3 RSSLFEELAEIAKERIMIIDGAMGTMIQREYMEEEDFRGEILKDHDKPLKGNNDLLSITRPDIIYKIHKLYLEAGADFVETNTFSGTTIAQADYRCEHLVHEINYQSALVARRACDDVGAATGRRRYVCGAIGPTNRTLSISPSVEKPDFRNVTFQELVKAYGDQARSLIQGGVDVLLVETVFDSANAKAALFAIRTLFEDEGVPEMPVFLSGTIVDMSGRTLSGQTGEAFLVSTKQGKPMAVGLNCALGAKDMRQFVDNMSKWSDSFIICYPNAGLPNALGGYDETPEEMADVLREFARDGLVNIIGGCCGTTPDHINAMYKAVQGITPRVPPQDPHAGKMLLSGLEPSIVGPETN-FVNIGERCNVAGSRRFCNLIKNENYDTAIDVARVQVDSGAQILDVNMDDGLLDGPYAMSKFLRLISSEPDVAKIPVCIDSSDFDVIIAGLESTQGKCVVNSISLKEGEEKFKERARIIKRYGAAVVVMAFDEQGQAAETDPKFEICERSYRILTEEVGFNPNDIIFDANILTIATGMEEHSNYGMYFIEAARMIRENLPGAHVSGGVSNISFSFRGMEAIREAMHSVFLFYAIKAGMDMGIVNAGALPVYEDIDKPLLQLLEDLLFNRDPEATEKLLVAAQEMKKDGKKADTKT-DEWRSLTVEERLKFALVKGVDQFVVADTEEARQNTAKYPRPLNVIERPLMDGMAVVGELFGAGKMFLPQVIKSARVMKKAVAHLLPFMEIERQANIETMGLAEDESPYQGTVVIATVKGDVHDIGKNIVSVVLGCNNFKVVDLGVMTPCENIIKAAIEEKADFIGLSGLITPSLDEMVYVAKEMNRVGLNIPLLIGGATTSKTHTAVKISPRYPHPVVHCLDASKSVVVCSSLSDMSVRDAFLQDLNEDYEDVRQEHYASLKDRRFTDLNKTREKKFKIDW--DKFTAVKPSFVGRREYQNFDLNELIPYIDWKPFFDVWQLRGKYPNRSYPKIFDDADVGAEAKKVFDDAQTWLKKLIDEKILVANAVVSFLPAASEGDDMHVYDPET-----GNKLDTFYGLRQQSGREHDQPHFCLSDFIKPLKNGVPDDYLGLFACTAGLGAEEYCKTLEKNHDDYASIMVKALADRLAEAYAEYLHKEVRTTLWGYSTNEDLTESDLLSIKYQGIRPACGYPSQPDHTEKRTLWKLLEAEKNGIGL-TEHLAMLPAASVSGLYFANPQSEYFAVGKIDQDQVIDYAARKNVPKEEVERWLSPILGYDTD 1249          
BLAST of Methionine synthase vs. Ensembl Fly
Match: CG10623 (gene:FBgn0032727 transcript:FBtr0344844)

HSP 1 Score: 65.855 bits (159), Expect = 7.690e-11
Identity = 76/290 (26.21%), Postives = 127/290 (43.79%), Query Frame = 3
Query:  204 TKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADY-GL-EHMVYKLNYESAILARKACDLVSSKSGISR-----FVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKP-------ICIGLNCA--LGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYD-EKPEY--TGEILSQFAKDGL---INIVGGCCGTTPAHIAAIKKAVRG 1007
            T P+ V   H +FL +GADII TNT+  +      Y G+      +L  +S  LA++A +   S+ G         + G+IGP    L             ++ ++L   +K +    L  GVD L +ET+     A+A    + + F +A + V +         SG N +    EA L+    ++        + IGLNC   L  + +   +  ++ +    ++ Y N G       YD E+ ++  TGE + +F  + +   + IVGGCC   P  + AI+K V G
Sbjct:   46 TNPEAVIQTHLDFLRNGADIILTNTYQSSVEGFVKYLGVTRERGVELIQKSVQLAKQAKEQYLSEIGSEAESALPLIMGSIGPYGAYLHDGSEYTGNYADKMSKEELRAWHKTRIEICLAAGVDGLALETLPCLMEAEAVTELVLDNFPDAKFWVSLQCMDEKHMASGENFA----EAALSLWRLVQSRKAENRLLGIGLNCVNPLFVTPLLSSLTKVAGSDRIPLVVYSNRG-----EIYDVEQGDWTGTGEEVVKFVPEWIQLGVRIVGGCCRVYPTDVLAIRKYVDG 326          
BLAST of Methionine synthase vs. Ensembl Fly
Match: CG10623 (gene:FBgn0032727 transcript:FBtr0344845)

HSP 1 Score: 65.855 bits (159), Expect = 7.690e-11
Identity = 76/290 (26.21%), Postives = 127/290 (43.79%), Query Frame = 3
Query:  204 TKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADY-GL-EHMVYKLNYESAILARKACDLVSSKSGISR-----FVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKP-------ICIGLNCA--LGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYD-EKPEY--TGEILSQFAKDGL---INIVGGCCGTTPAHIAAIKKAVRG 1007
            T P+ V   H +FL +GADII TNT+  +      Y G+      +L  +S  LA++A +   S+ G         + G+IGP    L             ++ ++L   +K +    L  GVD L +ET+     A+A    + + F +A + V +         SG N +    EA L+    ++        + IGLNC   L  + +   +  ++ +    ++ Y N G       YD E+ ++  TGE + +F  + +   + IVGGCC   P  + AI+K V G
Sbjct:   46 TNPEAVIQTHLDFLRNGADIILTNTYQSSVEGFVKYLGVTRERGVELIQKSVQLAKQAKEQYLSEIGSEAESALPLIMGSIGPYGAYLHDGSEYTGNYADKMSKEELRAWHKTRIEICLAAGVDGLALETLPCLMEAEAVTELVLDNFPDAKFWVSLQCMDEKHMASGENFA----EAALSLWRLVQSRKAENRLLGIGLNCVNPLFVTPLLSSLTKVAGSDRIPLVVYSNRG-----EIYDVEQGDWTGTGEEVVKFVPEWIQLGVRIVGGCCRVYPTDVLAIRKYVDG 326          
BLAST of Methionine synthase vs. Ensembl Fly
Match: CG10623 (gene:FBgn0032727 transcript:FBtr0081190)

HSP 1 Score: 65.855 bits (159), Expect = 7.690e-11
Identity = 76/290 (26.21%), Postives = 127/290 (43.79%), Query Frame = 3
Query:  204 TKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADY-GL-EHMVYKLNYESAILARKACDLVSSKSGISR-----FVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKP-------ICIGLNCA--LGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYD-EKPEY--TGEILSQFAKDGL---INIVGGCCGTTPAHIAAIKKAVRG 1007
            T P+ V   H +FL +GADII TNT+  +      Y G+      +L  +S  LA++A +   S+ G         + G+IGP    L             ++ ++L   +K +    L  GVD L +ET+     A+A    + + F +A + V +         SG N +    EA L+    ++        + IGLNC   L  + +   +  ++ +    ++ Y N G       YD E+ ++  TGE + +F  + +   + IVGGCC   P  + AI+K V G
Sbjct:   46 TNPEAVIQTHLDFLRNGADIILTNTYQSSVEGFVKYLGVTRERGVELIQKSVQLAKQAKEQYLSEIGSEAESALPLIMGSIGPYGAYLHDGSEYTGNYADKMSKEELRAWHKTRIEICLAAGVDGLALETLPCLMEAEAVTELVLDNFPDAKFWVSLQCMDEKHMASGENFA----EAALSLWRLVQSRKAENRLLGIGLNCVNPLFVTPLLSSLTKVAGSDRIPLVVYSNRG-----EIYDVEQGDWTGTGEEVVKFVPEWIQLGVRIVGGCCRVYPTDVLAIRKYVDG 326          
BLAST of Methionine synthase vs. Ensembl Fly
Match: CG10621 (gene:FBgn0032726 transcript:FBtr0081191)

HSP 1 Score: 50.0618 bits (118), Expect = 8.692e-6
Identity = 73/340 (21.47%), Postives = 133/340 (39.12%), Query Frame = 3
Query:   72 RIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGL--EHMVYKLNYESAILARKACD---------LVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTT---EAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSF----VICYPNAGLPNTFGAYDEKPEYTGE--------ILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYS 1013
            R+++ DG  GT +  +        G+     P      +   + T P  + + H +FL +GADII TNT+  +     +Y    E    +L   +  LA  A +          +S + G    +A +IGP    L             +   ++   ++ +  A L+ GVD L IETI     A+A V  L + + +  + V            G   +       +      +  K + IG+NC +    + P  ++++ +        ++ YPN+G       YD    + G          + ++A+ G   ++GGCC T    I  I +A+R ++
Sbjct:    5 RVLVKDGGFGTQMTVHV-------GDSVDGDPLW----SARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGYMEYLELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGYPLIIA-SIGPFGAHLHDGSEYTGSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCDDYPDVKFWVAFQCKDENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNC-VHPKFVTPLFKSLNGDREVGEQIPLVVYPNSG-----EVYDVVNGWQGREHCVPLANYVPEWAQLG-AKVIGGCCRTYARDIRHIGEAIRDWN 325          
BLAST of Methionine synthase vs. Ensembl Fly
Match: CG10621 (gene:FBgn0032726 transcript:FBtr0342926)

HSP 1 Score: 50.0618 bits (118), Expect = 8.692e-6
Identity = 73/340 (21.47%), Postives = 133/340 (39.12%), Query Frame = 3
Query:   72 RIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGL--EHMVYKLNYESAILARKACD---------LVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTT---EAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSF----VICYPNAGLPNTFGAYDEKPEYTGE--------ILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYS 1013
            R+++ DG  GT +  +        G+     P      +   + T P  + + H +FL +GADII TNT+  +     +Y    E    +L   +  LA  A +          +S + G    +A +IGP    L             +   ++   ++ +  A L+ GVD L IETI     A+A V  L + + +  + V            G   +       +      +  K + IG+NC +    + P  ++++ +        ++ YPN+G       YD    + G          + ++A+ G   ++GGCC T    I  I +A+R ++
Sbjct:    5 RVLVKDGGFGTQMTVHV-------GDSVDGDPLW----SARFNATNPAAIISTHLDFLQNGADIILTNTYQSSVDGYMEYLELDEEQSIELIKNTVRLAHIAKERYLTECYQAQLSVQEGYPLIIA-SIGPFGAHLHDGSEYTGSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALVEMLCDDYPDVKFWVAFQCKDENTLAHGETFADAANAIWDLLAERNAQDKCLAIGVNC-VHPKFVTPLFKSLNGDREVGEQIPLVVYPNSG-----EVYDVVNGWQGREHCVPLANYVPEWAQLG-AKVIGGCCRTYARDIRHIGEAIRDWN 325          
BLAST of Methionine synthase vs. Ensembl Zebrafish
Match: mtr (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-031001-5])

HSP 1 Score: 1315.44 bits (3403), Expect = 0.000e+0
Identity = 643/987 (65.15%), Postives = 800/987 (81.05%), Query Frame = 3
Query:   51 LFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGK 3002
            L   L++RI++LDG MGTMIQ   LEE +FRG+ FKDHPK L+GNND+LS+T+PD++++IHKE+L++GADIIETNTFS T+IAQADYG+E + Y+LN  SA +AR+A D VS+++G  RFVAGA+GPTN+TLS+SPSVE+P+YRNITFD+LV AY EQ   LLDGG D+LL+ETIFDTANAKAA+FA+  +FEE+    PV ISGTIVDKSGR LSGQT EAF+ S+SH +P+CIGLNCALGAS+MRPFIE I  +T++FVICYPNAGLPNTFG YDE P+ T   L +FA DGL+NIVGGCCGTTP HI AI ++VR   PR+PPT ++ D ++LSGLE F I P T  FVNIGERCNVAGSR+F +LI    YE A +  K  ++ G+Q+ D N   G L+G  AM++F NLI+SEPDI KVPLCIDSSNF+VIEAGLKC QGKCIVNSISLKEGE DF R+ + ++++GAAVV+MAFDE GQA + D+K+ IC R Y LL+++  FNPNDIIFD NILTIGTGMEEH+ Y ++FIRAT  +K++LP A+VSGG+SN+SFSFRG E +REAMH  FL+HAIK GMDMGIVNAG LPVYDDI+  LL LCE+I+WN+  DAT++LL YA+N  K     +++T D WR+ SV ERLE++LVKGI+KY++EDTEEAR   + + RPLHVIEGPLM GM TVGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFME+E+   M  SG       Y GT+++ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P ++IL+ A+  KAD+IGLSGLITPSL+EM+HVA+EMERLG++ PLLIGGATTS+ HTAVKIAP+YS P VHVLDAS+SVVV + LLD+    ++ E +QEEYE+IR++HY+SL +R +LS+  AR++ L ++W +   +  RP FLG+ + +  D+  L+ +IDWKPFFDVWQLRGKYPNRGYPKIF DK VG+
Sbjct:   20 LTELLQQRILVLDGGMGTMIQQRHLEEEEFRGQEFKDHPKSLKGNNDILSITQPDVIYSIHKEYLEAGADIIETNTFSSTSIAQADYGMEDLAYRLNKASAEVARRAADDVSAQTGCKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYAEQVKGLLDGGADVLLVETIFDTANAKAALFAIDRLFEESYEARPVLISGTIVDKSGRTLSGQTGEAFVISVSHTQPLCIGLNCALGASEMRPFIEAIGKSTSAFVICYPNAGLPNTFGGYDETPDVTAAHLKEFAVDGLVNIVGGCCGTTPDHIRAIAESVRHVKPRVPPTDVYSDYMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRKFAKLIMAGNYEPAGASPKCTLKLGSQICDRNNTRGFLDGAAAMSRFCNLIASEPDICKVPLCIDSSNFSVIEAGLKCCQGKCIVNSISLKEGEQDFLRRARQVRRYGAAVVVMAFDEDGQATETDQKVQICSRAYHLLIDQAGFNPNDIIFDPNILTIGTGMEEHSMYAINFIRATRIIKESLPGARVSGGLSNLSFSFRGMEAIREAMHGAFLYHAIKDGMDMGIVNAGNLPVYDDIDKELLLLCENIIWNRDPDATEKLLLYAQNNAKGGK-KVVQT-DEWRTGSVEERLEYALVKGIEKYVVEDTEEARAQTERYPRPLHVIEGPLMNGMKTVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREEMMATSGCVEEVDPYQGTVLLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMIPCDRILREAIHNKADIIGLSGLITPSLDEMIHVAKEMERLGLKIPLLIGGATTSKTHTAVKIAPRYSSPVVHVLDASRSVVVCSQLLDEGVRDDYFEEVQEEYEDIRQDHYDSLKDRRFLSLSRAREKGLHIDW-LAQPKPVRPQFLGTHVFDTYDLRKLVDFIDWKPFFDVWQLRGKYPNRGYPKIFKDKTVGQ 1002          

HSP 2 Score: 222.631 bits (566), Expect = 1.496e-58
Identity = 114/189 (60.32%), Postives = 140/189 (74.07%), Query Frame = 3
Query: 3219 YLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLK-PERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            ++C+    AP  SG  DYVG+FAV+   GA+ L+QKF+ QGDDY S+MVKALADRLAEA AE LH  VR  LWGYS  E+L   D  K+ Y+GIRPA GYP+QPDHSE+ T+W L    E+ GI+L  +SL MSPAASVSGLYFS+PKS YF+VGKI+K+QV DYA RKQ+ + E E+ L  IL Y+TD
Sbjct: 1077 HVCLKRGCAPRSSGVQDYVGLFAVSV-FGAEELSQKFEKQGDDYRSIMVKALADRLAEAFAEELHVRVRRDLWGYSSEEDLPASDLHKLRYEGIRPAAGYPSQPDHSEKLTMWKLADIQEKTGISL-TESLAMSPAASVSGLYFSNPKSAYFAVGKITKEQVEDYALRKQMEVCEVERWLGPILGYDTD 1263          
BLAST of Methionine synthase vs. Ensembl Zebrafish
Match: zgc:172121 (zgc:172121 [Source:ZFIN;Acc:ZDB-GENE-030131-9545])

HSP 1 Score: 68.1662 bits (165), Expect = 1.285e-11
Identity = 69/279 (24.73%), Postives = 126/279 (45.16%), Query Frame = 3
Query:  204 TKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADY-GLEHMVYKLNYESAI-LARKACDLVSSKSGISR----FVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTT---SFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGL------INIVGGCCGTTPAHIAAIKK 995
            T    + ++H  +L SG+D+I T T+  +      Y G++    +    SA+ LA++      S+S +S      VAG++GP    L             +T ++L   ++ Q   L+  G D++ +ETI     A+    AL EV +E   E   ++S +  D +  +   + +EA   +    + + +G+NC   A  ++P +E+  ++     S+V+ YPN+G       +D    +  E+ + FA   L         +GGCC   PA I  +K+
Sbjct:   36 TDSQAIKDVHYRYLQSGSDVITTATYQASIEGFVKYLGVQPEEAQHMMMSAVQLAKETVSEFISQSPMSDRREPLVAGSVGPYGSFLHDGSEYTGAYEDKMTVEELKDWHRPQIQCLVKAGADLVAMETIPGLKEAE----ALVEVLKEFP-ETKAWLSFSCKDNNSISSGRRFSEAVEMACRSTQLVAVGVNCC-PALLVKPLLESAKSHKRADLSWVV-YPNSG-----EGWDVTTGWKTEMRTSFANLSLEWKAQGALWIGGCCRVRPADITELKQ 302          
BLAST of Methionine synthase vs. Ensembl Zebrafish
Match: zgc:172121 (zgc:172121 [Source:ZFIN;Acc:ZDB-GENE-030131-9545])

HSP 1 Score: 68.1662 bits (165), Expect = 1.285e-11
Identity = 69/279 (24.73%), Postives = 126/279 (45.16%), Query Frame = 3
Query:  204 TKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADY-GLEHMVYKLNYESAI-LARKACDLVSSKSGISR----FVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTT---SFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGL------INIVGGCCGTTPAHIAAIKK 995
            T    + ++H  +L SG+D+I T T+  +      Y G++    +    SA+ LA++      S+S +S      VAG++GP    L             +T ++L   ++ Q   L+  G D++ +ETI     A+    AL EV +E   E   ++S +  D +  +   + +EA   +    + + +G+NC   A  ++P +E+  ++     S+V+ YPN+G       +D    +  E+ + FA   L         +GGCC   PA I  +K+
Sbjct:   36 TDSQAIKDVHYRYLQSGSDVITTATYQASIEGFVKYLGVQPEEAQHMMMSAVQLAKETVSEFISQSPMSDRREPLVAGSVGPYGSFLHDGSEYTGAYEDKMTVEELKDWHRPQIQCLVKAGADLVAMETIPGLKEAE----ALVEVLKEFP-ETKAWLSFSCKDNNSISSGRRFSEAVEMACRSTQLVAVGVNCC-PALLVKPLLESAKSHKRADLSWVV-YPNSG-----EGWDVTTGWKTEMRTSFANLSLEWKAQGALWIGGCCRVRPADITELKQ 302          
BLAST of Methionine synthase vs. Ensembl Zebrafish
Match: zgc:172121 (zgc:172121 [Source:ZFIN;Acc:ZDB-GENE-030131-9545])

HSP 1 Score: 68.1662 bits (165), Expect = 1.285e-11
Identity = 69/279 (24.73%), Postives = 126/279 (45.16%), Query Frame = 3
Query:  204 TKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADY-GLEHMVYKLNYESAI-LARKACDLVSSKSGISR----FVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTT---SFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGL------INIVGGCCGTTPAHIAAIKK 995
            T    + ++H  +L SG+D+I T T+  +      Y G++    +    SA+ LA++      S+S +S      VAG++GP    L             +T ++L   ++ Q   L+  G D++ +ETI     A+    AL EV +E   E   ++S +  D +  +   + +EA   +    + + +G+NC   A  ++P +E+  ++     S+V+ YPN+G       +D    +  E+ + FA   L         +GGCC   PA I  +K+
Sbjct:   36 TDSQAIKDVHYRYLQSGSDVITTATYQASIEGFVKYLGVQPEEAQHMMMSAVQLAKETVSEFISQSPMSDRREPLVAGSVGPYGSFLHDGSEYTGAYEDKMTVEELKDWHRPQIQCLVKAGADLVAMETIPGLKEAE----ALVEVLKEFP-ETKAWLSFSCKDNNSISSGRRFSEAVEMACRSTQLVAVGVNCC-PALLVKPLLESAKSHKRADLSWVV-YPNSG-----EGWDVTTGWKTEMRTSFANLSLEWKAQGALWIGGCCRVRPADITELKQ 302          
BLAST of Methionine synthase vs. Ensembl Xenopus
Match: smap2 (small ArfGAP2 [Source:Xenbase;Acc:XB-GENE-5817085])

HSP 1 Score: 1618.59 bits (4190), Expect = 0.000e+0
Identity = 805/1260 (63.89%), Postives = 995/1260 (78.97%), Query Frame = 3
Query:   30 RKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE----DPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETDE 3785
            ++N++  L S LRERIM+LDG MGTMIQ + L+E  FRG+ F DH K L+GNNDLLS+T+ +I++ IHKE+L  GADI+ETNTFS T+IAQADYGLEH+ Y+LN  SA +AR+A D V++++G+ R+VAGA+GPTN+TLS+SPSVE+P+YRN+TFD+LV AY EQA  LLDGGVDILL+ETIFDTANAKAA+FA+ ++FEE     P+FISGTIVDKSGR LSGQT EAF+ S+SH +P+CIGLNCALGA +MRPFIE I   TTS+VICYPNAGLPNTFG YDE PE T + +  FA DGL+NIVGGCCGTTPAHI  I +AV+   PRIPPT++F+  ++LSGLE F I P T  FVNIGERCNVAGSRRF +LI +D YEEALS+AK QVE GAQ++D+N+D+GML+G  AM +F N I+SEPDI+KVPLCIDSSNF VIEAGLKC QGKCIVNSISLKEGE DF  K K IK+FGAAVVIMAFDE GQA D + K+++C R Y+LLV K++FNPNDIIFD NILTIGTGMEEH+ Y ++FI AT+ +K++L  A+VSGG+SN+SFSFRG E +REAMH VFL+HAIKAGMDMGIVNAG LPVYDDI+  LL LCED++WN+  D T++LL+YA+   K     +++T D WR+ SV ERLE++L+KGI+K++IEDTEEAR   + + RPLH+IEGPLM GM  VG+LFGAGKMFLPQVIKSARVMK++VG+LIPFME+E+     +SG    +  Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P +KIL+ A+E KAD+IGLSGLITPSL+EM+ VA+EMERLG+RTPLLIGGATTSR HTAVKIAP+Y+ P +H LDASKSVVV + LLD+    +F E I EEYE+IR++HYESL ER YL++++AR + L ++W + H +  RP  +G+++  N D+  L  YIDWKPFFDVWQLRGKYPNR +PKIFNDK VG+EA+ L+ DAQ +L  +I  K     GV+G +PAHS  DDILLY  D  N++    + T +GLRQQ E++    DP Y C+SDFIAP  SG  DY+G+FAV A  G + L++ ++ QGDDY+S+M KAL DRL EA AE LH  VR  LWGY   E L   D  ++ Y+GIRPAPGYP+QPDH E+ T+W L   ER  GI L  +SL MSPA+SVSGL FS P SKYF+VGKISKDQV DYA RK + + E EK L  ILSY+ ++
Sbjct:   15 KRNLQEELDSVLRERIMVLDGGMGTMIQQHTLQEESFRGQEFIDHAKPLKGNNDLLSITQSEIIYKIHKEYLTCGADIVETNTFSSTSIAQADYGLEHLAYRLNKVSAEVARRAADDVTAETGMKRYVAGAMGPTNKTLSVSPSVERPDYRNVTFDELVDAYAEQARGLLDGGVDILLVETIFDTANAKAALFAIQKLFEEDYEPRPIFISGTIVDKSGRTLSGQTGEAFVVSVSHAEPLCIGLNCALGAIEMRPFIEAIGKCTTSYVICYPNAGLPNTFGGYDETPEVTAKHIKDFALDGLVNIVGGCCGTTPAHIREIAEAVKNCKPRIPPTSVFDGYMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRRFAKLIMSDNYEEALSVAKAQVEMGAQILDINVDDGMLDGPTAMARFCNYIASEPDIAKVPLCIDSSNFNVIEAGLKCCQGKCIVNSISLKEGEEDFLAKAKKIKQFGAAVVIMAFDEVGQATDTETKVSVCTRAYNLLVEKLNFNPNDIIFDPNILTIGTGMEEHDKYAINFIEATKSIKESLKGARVSGGLSNLSFSFRGMEAIREAMHGVFLYHAIKAGMDMGIVNAGNLPVYDDIDKELLTLCEDLIWNRDPDGTEKLLKYAQTKAKGGK-KVIQT-DEWRNGSVEERLEYALIKGIEKFVIEDTEEARANKEKYSRPLHIIEGPLMNGMKVVGELFGAGKMFLPQVIKSARVMKKSVGHLIPFMEKEREAMRAISGTLEEDNPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILRAAIENKADIIGLSGLITPSLDEMIFVAKEMERLGIRTPLLIGGATTSRTHTAVKIAPRYNAPVIHCLDASKSVVVCSQLLDENVRDDFLEEITEEYEDIRQDHYESLRERRYLTLEQARNKGLHIDW-LSHPKPVRPKLIGTEVYSNYDLEKLRHYIDWKPFFDVWQLRGKYPNRAFPKIFNDKTVGEEAKRLYEDAQNMLNMVISEKKFEARGVVGIWPAHSVQDDILLY-ADEGNMSSTEAIATFYGLRQQAEKDSASTDP-YYCLSDFIAPQHSGVKDYLGVFAV-ACFGVEELSKVYEKQGDDYSSIMAKALGDRLVEAFAEELHERVRKDLWGYCSEEQLNVSDLRRIRYEGIRPAPGYPSQPDHIEKVTMWKLADVERTTGIKL-TESLAMSPASSVSGLMFSSPMSKYFAVGKISKDQVEDYACRKNMPVCEVEKWLGPILSYDPED 1266          
BLAST of Methionine synthase vs. Ensembl Xenopus
Match: smap2 (small ArfGAP2 [Source:Xenbase;Acc:XB-GENE-5817085])

HSP 1 Score: 1618.59 bits (4190), Expect = 0.000e+0
Identity = 805/1261 (63.84%), Postives = 996/1261 (78.98%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE----DPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETDE 3785
            +++N++  L S LRERIM+LDG MGTMIQ + L+E  FRG+ F DH K L+GNNDLLS+T+ +I++ IHKE+L  GADI+ETNTFS T+IAQADYGLEH+ Y+LN  SA +AR+A D V++++G+ R+VAGA+GPTN+TLS+SPSVE+P+YRN+TFD+LV AY EQA  LLDGGVDILL+ETIFDTANAKAA+FA+ ++FEE     P+FISGTIVDKSGR LSGQT EAF+ S+SH +P+CIGLNCALGA +MRPFIE I   TTS+VICYPNAGLPNTFG YDE PE T + +  FA DGL+NIVGGCCGTTPAHI  I +AV+   PRIPPT++F+  ++LSGLE F I P T  FVNIGERCNVAGSRRF +LI +D YEEALS+AK QVE GAQ++D+N+D+GML+G  AM +F N I+SEPDI+KVPLCIDSSNF VIEAGLKC QGKCIVNSISLKEGE DF  K K IK+FGAAVVIMAFDE GQA D + K+++C R Y+LLV K++FNPNDIIFD NILTIGTGMEEH+ Y ++FI AT+ +K++L  A+VSGG+SN+SFSFRG E +REAMH VFL+HAIKAGMDMGIVNAG LPVYDDI+  LL LCED++WN+  D T++LL+YA+   K     +++T D WR+ SV ERLE++L+KGI+K++IEDTEEAR   + + RPLH+IEGPLM GM  VG+LFGAGKMFLPQVIKSARVMK++VG+LIPFME+E+     +SG    +  Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P +KIL+ A+E KAD+IGLSGLITPSL+EM+ VA+EMERLG+RTPLLIGGATTSR HTAVKIAP+Y+ P +H LDASKSVVV + LLD+    +F E I EEYE+IR++HYESL ER YL++++AR + L ++W + H +  RP  +G+++  N D+  L  YIDWKPFFDVWQLRGKYPNR +PKIFNDK VG+EA+ L+ DAQ +L  +I  K     GV+G +PAHS  DDILLY  D  N++    + T +GLRQQ E++    DP Y C+SDFIAP  SG  DY+G+FAV A  G + L++ ++ QGDDY+S+M KAL DRL EA AE LH  VR  LWGY   E L   D  ++ Y+GIRPAPGYP+QPDH E+ T+W L   ER  GI L  +SL MSPA+SVSGL FS P SKYF+VGKISKDQV DYA RK + + E EK L  ILSY+ ++
Sbjct:    1 IKRNLQEELDSVLRERIMVLDGGMGTMIQQHTLQEESFRGQEFIDHAKPLKGNNDLLSITQSEIIYKIHKEYLTCGADIVETNTFSSTSIAQADYGLEHLAYRLNKVSAEVARRAADDVTAETGMKRYVAGAMGPTNKTLSVSPSVERPDYRNVTFDELVDAYAEQARGLLDGGVDILLVETIFDTANAKAALFAIQKLFEEDYEPRPIFISGTIVDKSGRTLSGQTGEAFVVSVSHAEPLCIGLNCALGAIEMRPFIEAIGKCTTSYVICYPNAGLPNTFGGYDETPEVTAKHIKDFALDGLVNIVGGCCGTTPAHIREIAEAVKNCKPRIPPTSVFDGYMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRRFAKLIMSDNYEEALSVAKAQVEMGAQILDINVDDGMLDGPTAMARFCNYIASEPDIAKVPLCIDSSNFNVIEAGLKCCQGKCIVNSISLKEGEEDFLAKAKKIKQFGAAVVIMAFDEVGQATDTETKVSVCTRAYNLLVEKLNFNPNDIIFDPNILTIGTGMEEHDKYAINFIEATKSIKESLKGARVSGGLSNLSFSFRGMEAIREAMHGVFLYHAIKAGMDMGIVNAGNLPVYDDIDKELLTLCEDLIWNRDPDGTEKLLKYAQTKAKGGK-KVIQT-DEWRNGSVEERLEYALIKGIEKFVIEDTEEARANKEKYSRPLHIIEGPLMNGMKVVGELFGAGKMFLPQVIKSARVMKKSVGHLIPFMEKEREAMRAISGTLEEDNPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILRAAIENKADIIGLSGLITPSLDEMIFVAKEMERLGIRTPLLIGGATTSRTHTAVKIAPRYNAPVIHCLDASKSVVVCSQLLDENVRDDFLEEITEEYEDIRQDHYESLRERRYLTLEQARNKGLHIDW-LSHPKPVRPKLIGTEVYSNYDLEKLRHYIDWKPFFDVWQLRGKYPNRAFPKIFNDKTVGEEAKRLYEDAQNMLNMVISEKKFEARGVVGIWPAHSVQDDILLY-ADEGNMSSTEAIATFYGLRQQAEKDSASTDP-YYCLSDFIAPQHSGVKDYLGVFAV-ACFGVEELSKVYEKQGDDYSSIMAKALGDRLVEAFAEELHERVRKDLWGYCSEEQLNVSDLRRIRYEGIRPAPGYPSQPDHIEKVTMWKLADVERTTGIKL-TESLAMSPASSVSGLMFSSPMSKYFAVGKISKDQVEDYACRKNMPVCEVEKWLGPILSYDPED 1253          
BLAST of Methionine synthase vs. Ensembl Xenopus
Match: smap2 (small ArfGAP2 [Source:Xenbase;Acc:XB-GENE-5817085])

HSP 1 Score: 1617.82 bits (4188), Expect = 0.000e+0
Identity = 805/1259 (63.94%), Postives = 994/1259 (78.95%), Query Frame = 3
Query:   33 KNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE----DPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETDE 3785
            +N++  L S LRERIM+LDG MGTMIQ + L+E  FRG+ F DH K L+GNNDLLS+T+ +I++ IHKE+L  GADI+ETNTFS T+IAQADYGLEH+ Y+LN  SA +AR+A D V++++G+ R+VAGA+GPTN+TLS+SPSVE+P+YRN+TFD+LV AY EQA  LLDGGVDILL+ETIFDTANAKAA+FA+ ++FEE     P+FISGTIVDKSGR LSGQT EAF+ S+SH +P+CIGLNCALGA +MRPFIE I   TTS+VICYPNAGLPNTFG YDE PE T + +  FA DGL+NIVGGCCGTTPAHI  I +AV+   PRIPPT++F+  ++LSGLE F I P T  FVNIGERCNVAGSRRF +LI +D YEEALS+AK QVE GAQ++D+N+D+GML+G  AM +F N I+SEPDI+KVPLCIDSSNF VIEAGLKC QGKCIVNSISLKEGE DF  K K IK+FGAAVVIMAFDE GQA D + K+++C R Y+LLV K++FNPNDIIFD NILTIGTGMEEH+ Y ++FI AT+ +K++L  A+VSGG+SN+SFSFRG E +REAMH VFL+HAIKAGMDMGIVNAG LPVYDDI+  LL LCED++WN+  D T++LL+YA+   K     +++T D WR+ SV ERLE++L+KGI+K++IEDTEEAR   + + RPLH+IEGPLM GM  VG+LFGAGKMFLPQVIKSARVMK++VG+LIPFME+E+     +SG    +  Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P +KIL+ A+E KAD+IGLSGLITPSL+EM+ VA+EMERLG+RTPLLIGGATTSR HTAVKIAP+Y+ P +H LDASKSVVV + LLD+    +F E I EEYE+IR++HYESL ER YL++++AR + L ++W + H +  RP  +G+++  N D+  L  YIDWKPFFDVWQLRGKYPNR +PKIFNDK VG+EA+ L+ DAQ +L  +I  K     GV+G +PAHS  DDILLY  D  N++    + T +GLRQQ E++    DP Y C+SDFIAP  SG  DY+G+FAV A  G + L++ ++ QGDDY+S+M KAL DRL EA AE LH  VR  LWGY   E L   D  ++ Y+GIRPAPGYP+QPDH E+ T+W L   ER  GI L  +SL MSPA+SVSGL FS P SKYF+VGKISKDQV DYA RK + + E EK L  ILSY+ ++
Sbjct:   19 RNLQEELDSVLRERIMVLDGGMGTMIQQHTLQEESFRGQEFIDHAKPLKGNNDLLSITQSEIIYKIHKEYLTCGADIVETNTFSSTSIAQADYGLEHLAYRLNKVSAEVARRAADDVTAETGMKRYVAGAMGPTNKTLSVSPSVERPDYRNVTFDELVDAYAEQARGLLDGGVDILLVETIFDTANAKAALFAIQKLFEEDYEPRPIFISGTIVDKSGRTLSGQTGEAFVVSVSHAEPLCIGLNCALGAIEMRPFIEAIGKCTTSYVICYPNAGLPNTFGGYDETPEVTAKHIKDFALDGLVNIVGGCCGTTPAHIREIAEAVKNCKPRIPPTSVFDGYMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRRFAKLIMSDNYEEALSVAKAQVEMGAQILDINVDDGMLDGPTAMARFCNYIASEPDIAKVPLCIDSSNFNVIEAGLKCCQGKCIVNSISLKEGEEDFLAKAKKIKQFGAAVVIMAFDEVGQATDTETKVSVCTRAYNLLVEKLNFNPNDIIFDPNILTIGTGMEEHDKYAINFIEATKSIKESLKGARVSGGLSNLSFSFRGMEAIREAMHGVFLYHAIKAGMDMGIVNAGNLPVYDDIDKELLTLCEDLIWNRDPDGTEKLLKYAQTKAKGGK-KVIQT-DEWRNGSVEERLEYALIKGIEKFVIEDTEEARANKEKYSRPLHIIEGPLMNGMKVVGELFGAGKMFLPQVIKSARVMKKSVGHLIPFMEKEREAMRAISGTLEEDNPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILRAAIENKADIIGLSGLITPSLDEMIFVAKEMERLGIRTPLLIGGATTSRTHTAVKIAPRYNAPVIHCLDASKSVVVCSQLLDENVRDDFLEEITEEYEDIRQDHYESLRERRYLTLEQARNKGLHIDW-LSHPKPVRPKLIGTEVYSNYDLEKLRHYIDWKPFFDVWQLRGKYPNRAFPKIFNDKTVGEEAKRLYEDAQNMLNMVISEKKFEARGVVGIWPAHSVQDDILLY-ADEGNMSSTEAIATFYGLRQQAEKDSASTDP-YYCLSDFIAPQHSGVKDYLGVFAV-ACFGVEELSKVYEKQGDDYSSIMAKALGDRLVEAFAEELHERVRKDLWGYCSEEQLNVSDLRRIRYEGIRPAPGYPSQPDHIEKVTMWKLADVERTTGIKL-TESLAMSPASSVSGLMFSSPMSKYFAVGKISKDQVEDYACRKNMPVCEVEKWLGPILSYDPED 1269          
BLAST of Methionine synthase vs. Ensembl Xenopus
Match: smap2 (small ArfGAP2 [Source:Xenbase;Acc:XB-GENE-5817085])

HSP 1 Score: 1617.44 bits (4187), Expect = 0.000e+0
Identity = 805/1260 (63.89%), Postives = 995/1260 (78.97%), Query Frame = 3
Query:   30 RKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE----DPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETDE 3785
            ++N++  L S LRERIM+LDG MGTMIQ + L+E  FRG+ F DH K L+GNNDLLS+T+ +I++ IHKE+L  GADI+ETNTFS T+IAQADYGLEH+ Y+LN  SA +AR+A D V++++G+ R+VAGA+GPTN+TLS+SPSVE+P+YRN+TFD+LV AY EQA  LLDGGVDILL+ETIFDTANAKAA+FA+ ++FEE     P+FISGTIVDKSGR LSGQT EAF+ S+SH +P+CIGLNCALGA +MRPFIE I   TTS+VICYPNAGLPNTFG YDE PE T + +  FA DGL+NIVGGCCGTTPAHI  I +AV+   PRIPPT++F+  ++LSGLE F I P T  FVNIGERCNVAGSRRF +LI +D YEEALS+AK QVE GAQ++D+N+D+GML+G  AM +F N I+SEPDI+KVPLCIDSSNF VIEAGLKC QGKCIVNSISLKEGE DF  K K IK+FGAAVVIMAFDE GQA D + K+++C R Y+LLV K++FNPNDIIFD NILTIGTGMEEH+ Y ++FI AT+ +K++L  A+VSGG+SN+SFSFRG E +REAMH VFL+HAIKAGMDMGIVNAG LPVYDDI+  LL LCED++WN+  D T++LL+YA+   K     +++T D WR+ SV ERLE++L+KGI+K++IEDTEEAR   + + RPLH+IEGPLM GM  VG+LFGAGKMFLPQVIKSARVMK++VG+LIPFME+E+     +SG    +  Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P +KIL+ A+E KAD+IGLSGLITPSL+EM+ VA+EMERLG+RTPLLIGGATTSR HTAVKIAP+Y+ P +H LDASKSVVV + LLD+    +F E I EEYE+IR++HYESL ER YL++++AR + L ++W + H +  RP  +G+++  N D+  L  YIDWKPFFDVWQLRGKYPNR +PKIFNDK VG+EA+ L+ DAQ +L  +I  K     GV+G +PAHS  DDILLY  D  N++    + T +GLRQQ E++    DP Y C+SDFIAP  SG  DY+G+FAV A  G + L++ ++ QGDDY+S+M KAL DRL EA AE LH  VR  LWGY   E L   D  ++ Y+GIRPAPGYP+QPDH E+ T+W L   ER  GI L  +SL MSPA+SVSGL FS P SKYF+VGKISKDQV DYA RK + + E EK L  ILSY+ ++
Sbjct:    9 KRNLQEELDSVLRERIMVLDGGMGTMIQQHTLQEESFRGQEFIDHAKPLKGNNDLLSITQSEIIYKIHKEYLTCGADIVETNTFSSTSIAQADYGLEHLAYRLNKVSAEVARRAADDVTAETGMKRYVAGAMGPTNKTLSVSPSVERPDYRNVTFDELVDAYAEQARGLLDGGVDILLVETIFDTANAKAALFAIQKLFEEDYEPRPIFISGTIVDKSGRTLSGQTGEAFVVSVSHAEPLCIGLNCALGAIEMRPFIEAIGKCTTSYVICYPNAGLPNTFGGYDETPEVTAKHIKDFALDGLVNIVGGCCGTTPAHIREIAEAVKNCKPRIPPTSVFDGYMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRRFAKLIMSDNYEEALSVAKAQVEMGAQILDINVDDGMLDGPTAMARFCNYIASEPDIAKVPLCIDSSNFNVIEAGLKCCQGKCIVNSISLKEGEEDFLAKAKKIKQFGAAVVIMAFDEVGQATDTETKVSVCTRAYNLLVEKLNFNPNDIIFDPNILTIGTGMEEHDKYAINFIEATKSIKESLKGARVSGGLSNLSFSFRGMEAIREAMHGVFLYHAIKAGMDMGIVNAGNLPVYDDIDKELLTLCEDLIWNRDPDGTEKLLKYAQTKAKGGK-KVIQT-DEWRNGSVEERLEYALIKGIEKFVIEDTEEARANKEKYSRPLHIIEGPLMNGMKVVGELFGAGKMFLPQVIKSARVMKKSVGHLIPFMEKEREAMRAISGTLEEDNPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILRAAIENKADIIGLSGLITPSLDEMIFVAKEMERLGIRTPLLIGGATTSRTHTAVKIAPRYNAPVIHCLDASKSVVVCSQLLDENVRDDFLEEITEEYEDIRQDHYESLRERRYLTLEQARNKGLHIDW-LSHPKPVRPKLIGTEVYSNYDLEKLRHYIDWKPFFDVWQLRGKYPNRAFPKIFNDKTVGEEAKRLYEDAQNMLNMVISEKKFEARGVVGIWPAHSVQDDILLY-ADEGNMSSTEAIATFYGLRQQAEKDSASTDP-YYCLSDFIAPQHSGVKDYLGVFAV-ACFGVEELSKVYEKQGDDYSSIMAKALGDRLVEAFAEELHERVRKDLWGYCSEEQLNVSDLRRIRYEGIRPAPGYPSQPDHIEKVTMWKLADVERTTGIKL-TESLAMSPASSVSGLMFSSPMSKYFAVGKISKDQVEDYACRKNMPVCEVEKWLGPILSYDPED 1260          
BLAST of Methionine synthase vs. Ensembl Xenopus
Match: smap2 (small ArfGAP2 [Source:Xenbase;Acc:XB-GENE-5817085])

HSP 1 Score: 1552.34 bits (4018), Expect = 0.000e+0
Identity = 785/1271 (61.76%), Postives = 975/1271 (76.71%), Query Frame = 3
Query:    3 NLYVFR*--NMRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE----DPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETDE 3785
            N++ F     +++N++  L S LRERIM+LDG MGTMIQ + L+E  FRG+ F DH K L+GNNDLLS+T+ +I++ IHKE+L  GADI+ETNTFS T+IAQADYGLEH+ Y+LN  SA +AR+A D V++++G+ R+VAGA+GPTN+TLS+SPSVE+P+YRN+TFD+LV AY EQA  LLDGGVDILL+ETIFDTANAKAA+FA+ ++FEE     P+FISGTIVDKSGR LSGQT EAF+ S+SH +P+CIGLNCALGA +MRPFIE I   TTS+VICYPNAGLPNTFG YDE PE T + +  FA DGL+NIVGGCCGTTPAHI  I +AV+   PRIPPT++F+  ++LSGLE F I P T  FVNIGERCNVAGSRRF +LI +D YEEALS+AK QVE GAQ++D+N+D+GML+G  AM +F N I+SEPDI+KVPLCIDSSNF VIEAGLKC QGKCIVNSISLKEGE DF  K K IK+FGAAVVIMAFDE GQA D + K+++C R Y+LLV K++FNPNDIIFD NILTIGTGMEEH+ Y ++FI AT+ +K++L  A+VSGG+SN+SFSFRG E +REAMH VFL+HAIKAGMDMGIVNAG LPVYDDI+  LL LCED++WN+  D T++LL+YA+   K     +++T D WR+ SV ERLE++L+KGI+K++IEDTEEAR   + + RPLH+IEGPLM GM  VG+LFGAGKMFLPQVIKSARVMK++VG+LIPFME+E+     +SG    +           V  D   I      +  GC    VIDLGVM P +KIL+ A+E KAD+IGLSGLITPSL+EM+ VA+EMERLG+RTPLLIGGATTSR HTAVKIAP+Y+ P +H LDASKSVVV + LLD+    +F E I EEYE+IR++HYESL ER YL++++AR + L ++W + H +  RP  +G+++  N D+  L  YIDWKPFFDVWQLRGKYPNR +PKIFNDK VG+EA+ L+ DAQ +L  +I  K     GV+G +PAHS  DDILLY  D  N++    + T +GLRQQ E++    DP Y C+SDFIAP  SG  DY+G+FAV A  G + L++ ++ QGDDY+S+M KAL DRL EA AE LH  VR  LWGY   E L   D  ++ Y+GIRPAPGYP+QPDH E+ T+W L   ER  GI L  +SL MSPA+SVSGL FS P SKYF+VGKISKDQV DYA RK + + E EK L  ILSY+ ++
Sbjct:   17 NMFAFSQIETLKRNLQEELDSVLRERIMVLDGGMGTMIQQHTLQEESFRGQEFIDHAKPLKGNNDLLSITQSEIIYKIHKEYLTCGADIVETNTFSSTSIAQADYGLEHLAYRLNKVSAEVARRAADDVTAETGMKRYVAGAMGPTNKTLSVSPSVERPDYRNVTFDELVDAYAEQARGLLDGGVDILLVETIFDTANAKAALFAIQKLFEEDYEPRPIFISGTIVDKSGRTLSGQTGEAFVVSVSHAEPLCIGLNCALGAIEMRPFIEAIGKCTTSYVICYPNAGLPNTFGGYDETPEVTAKHIKDFALDGLVNIVGGCCGTTPAHIREIAEAVKNCKPRIPPTSVFDGYMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRRFAKLIMSDNYEEALSVAKAQVEMGAQILDINVDDGMLDGPTAMARFCNYIASEPDIAKVPLCIDSSNFNVIEAGLKCCQGKCIVNSISLKEGEEDFLAKAKKIKQFGAAVVIMAFDEVGQATDTETKVSVCTRAYNLLVEKLNFNPNDIIFDPNILTIGTGMEEHDKYAINFIEATKSIKESLKGARVSGGLSNLSFSFRGMEAIREAMHGVFLYHAIKAGMDMGIVNAGNLPVYDDIDKELLTLCEDLIWNRDPDGTEKLLKYAQTKAKGGK-KVIQT-DEWRNGSVEERLEYALIKGIEKFVIEDTEEARANKEKYSRPLHIIEGPLMNGMKVVGELFGAGKMFLPQVIKSARVMKKSVGHLIPFMEKEREAMRAISGTLEED-----------VSPDFCIISAFCTNIFFGC---LVIDLGVMTPCDKILRAAIENKADIIGLSGLITPSLDEMIFVAKEMERLGIRTPLLIGGATTSRTHTAVKIAPRYNAPVIHCLDASKSVVVCSQLLDENVRDDFLEEITEEYEDIRQDHYESLRERRYLTLEQARNKGLHIDW-LSHPKPVRPKLIGTEVYSNYDLEKLRHYIDWKPFFDVWQLRGKYPNRAFPKIFNDKTVGEEAKRLYEDAQNMLNMVISEKKFEARGVVGIWPAHSVQDDILLY-ADEGNMSSTEAIATFYGLRQQAEKDSASTDP-YYCLSDFIAPQHSGVKDYLGVFAV-ACFGVEELSKVYEKQGDDYSSIMAKALGDRLVEAFAEELHERVRKDLWGYCSEEQLNVSDLRRIRYEGIRPAPGYPSQPDHIEKVTMWKLADVERTTGIKL-TESLAMSPASSVSGLMFSSPMSKYFAVGKISKDQVEDYACRKNMPVCEVEKWLGPILSYDPED 1265          
BLAST of Methionine synthase vs. Ensembl Mouse
Match: Mtr (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:MGI Symbol;Acc:MGI:894292])

HSP 1 Score: 1582.77 bits (4097), Expect = 0.000e+0
Identity = 795/1261 (63.05%), Postives = 989/1261 (78.43%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEA-GYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE----DPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            M+K ++  + + LR+RIM+LDG MGTMIQ YKL E  F+G+ FKDH + L+GNND+LS+T+PDI++ IHKE+L +GADIIETNTFS T+IAQADYGLEH+ Y++N  SA +ARKA + ++ ++G+ RFVAGA+GPTN+TLS+SPSVE+P+YRNITFD+LV AY+EQA  LLDG VDILLIETIFDTANAKAA+FA+  +FEE      P+FISGTIVDKSGR LSGQT EAF+TS+SH  P+CIGLNC+LGA++MRPFIETI   TT++V+CYPNAGLPNTFG YDE P      L  FA DGL+NIVGGCCG+TP HI  I +AV+   PR+PP ++FE  ++LSGLE F I P T  FVNIGERCNVAGSR+F +LI    YEEALSIAK QVE GAQV+D+NMD+GML+G  AMT+F N I+SEPDI+KVPLCIDSSNFAVIEAGLKC QGKCIVNSISLKEGE DF  K + IKKFGAAVV+MAFDE+GQA + D K+ +C R Y LLV+K+ FNPNDIIFD NILTIGTGMEEHN Y ++FI AT  +K+ LP  ++SGG+SN+SFSFRG E +REAMH VFL+HAIK GMDMGIVNAG LPVYD I   LL+LCED++WNK  +AT++LL YA+    +    +++T D WR+ S+ ERLE++LVKGI+K+I+EDTEEAR   + + RPL++IEGPLM GM  VGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFME+E+  A  ++G    E  Y GT+V+ATVKGDVHDIGKNIVGVV+ CNN+RVIDLGVM P +KILQ AL+ KAD+IGLSGLITPSL+EM+ VA+EMERL ++ PLLIGGATTSR HTAVKIAP+YS P +HVLDASKSVVV + LLD+    ++ E I EEYE+IR++HYESL ER Y+ + +ARK    ++W +      +P F+G+++ E+ ++  L+ YIDWKPFFDVWQLRGKYPNRG+PKIFNDK VG+EA+ +++DAQ +L  +I  K L   GV+GF+PA S  DDI LY  +         + T +GLRQQ E++    DP Y C+SDFIAP+ SG  DY+G+FAV A  G + L++ ++D GDDY+S+MVKAL DRLAEA AE LH  VR  LW YS +E L   D  ++ Y+GIRPAPGYP+QPDH+E+ T+W L   E+  GI L  +SL M+PA++VSGLYFS+ K+KYF+VGKISKDQ  DYA RK + + E EK L  IL Y+TD
Sbjct:    1 MKKTLQDEIEAILRKRIMVLDGGMGTMIQRYKLSEEHFQGQEFKDHSRPLKGNNDILSITQPDIIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNKCSADVARKAAEEITLQTGVKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVDAYQEQAKGLLDGRVDILLIETIFDTANAKAALFAIQNLFEENYAPPRPIFISGTIVDKSGRTLSGQTGEAFVTSVSHSDPLCIGLNCSLGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDETPSTMATHLKDFAVDGLVNIVGGCCGSTPDHIREIAEAVKKCKPRVPPASVFEGHMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRKFAKLIMAGNYEEALSIAKAQVEMGAQVLDINMDDGMLDGPSAMTRFCNSIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEGDFLEKARKIKKFGAAVVVMAFDEEGQATETDVKVNVCTRAYHLLVDKVGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATRVIKETLPGVRISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKFGMDMGIVNAGNLPVYDAIHKDLLQLCEDLIWNKDSEATEKLLRYAQT-HGTGGKKVIQT-DEWRNGSIEERLEYALVKGIEKHIVEDTEEARLNGEKYPRPLNIIEGPLMNGMKVVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREEARLINGSVEEEDPYQGTIVLATVKGDVHDIGKNIVGVVLACNNFRVIDLGVMTPCDKILQAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLRDDYFEEILEEYEDIRQDHYESLKERKYVPLSQARKHGFHIDW-LSEPHPVKPTFIGTQVFEDYNLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKAVGEEARKVYNDAQNMLNILISQKKLQARGVVGFWPAQSVQDDIHLY-AEGVVPQAAEPIATFYGLRQQAEKDSSSTDP-YHCLSDFIAPLHSGVCDYLGLFAV-ACFGVEELSKTYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYSRSEQLGVPDLRRLRYEGIRPAPGYPSQPDHTEKLTMWRLASIEQATGIRL-TESLAMAPASAVSGLYFSNVKAKYFAVGKISKDQTEDYALRKNMPVAEVEKWLGPILGYDTD 1253          
BLAST of Methionine synthase vs. Ensembl Mouse
Match: Mtr (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:MGI Symbol;Acc:MGI:894292])

HSP 1 Score: 145.206 bits (365), Expect = 1.143e-38
Identity = 64/100 (64.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHM 326
            M+K ++  + + LR+RIM+LDG MGTMIQ YKL E  F+G+ FKDH + L+GNND+LS+T+PDI++ IHKE+L +GADIIETNTFS T+IAQADYGLEH+
Sbjct:    1 MKKTLQDEIEAILRKRIMVLDGGMGTMIQRYKLSEEHFQGQEFKDHSRPLKGNNDILSITQPDIIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHL 100          
BLAST of Methionine synthase vs. UniProt/SwissProt
Match: sp|Q4JIJ3|METH_BOVIN (Methionine synthase OS=Bos taurus OX=9913 GN=MTR PE=2 SV=1)

HSP 1 Score: 1610.89 bits (4170), Expect = 0.000e+0
Identity = 808/1260 (64.13%), Postives = 994/1260 (78.89%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE----DPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPE-RIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            M+K ++  + + L+ERIM+LDG MGTMIQ +KL E DFRG+ FKDH + L+GNND+LS+T+P++++ IHKE+L +GADIIETNTFS T+IAQADYGLEH+ Y++N  SA +ARKA + +S ++GI R+VAGA+GPTN+TLS+SPSVE+P+YRNITFD+LV AYKEQA  LLDGGVDILLIETIFDTANAKAA+FA+ ++FEE     PVFISGTIVDKSGR LSGQT EAF+ S+SH  P+CIGLNCALGA++MRPFIETI   TT++V+CYPNAGLPNTFG YDE P      L  FA DGL+NIVGGCCGTTP HI  I +AV+   PR+PP T+FE  ++LSGLE F I P T  FVNIGERCNVAGSRRF +LI    YEEALS+AK QVE GAQV+D+NMD+GML+G  AMT+F N I+SEPDI+KVPLCIDSSNFAVIEAGLKC QGKCIVNSISLKEGE DF  K + IKKFGAAVV+MAFDE+GQA + D KI +C R Y LL+ K+ FNPNDIIFD NILTIGTGMEEHN Y ++FI AT+ +K+ LP AKVSGG+SN+SFSFRG E +REAMH VFL+HAIK GMDMGIVNAG LPVYDDI   LL+LCED++WN+  +AT++LL YA+   K     +++T D WR+  + ERLE++LVKGI+KYIIEDTEEAR   + + RPL++IEGPLM GM  VGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFME+E+     ++G   +E  Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P +KIL+ AL+ KAD+IGLSGLITPSL+EM+ VA+EMERL ++ PLLIGGATTSR HTAVKIAP+YS P +HVLDASKSVVV + LLD+    E+ E I EEYE+IR++HYESL ER YL++ +AR+    ++W +      +P FLG+++ E+ D+  L+ YIDWKPFFDVWQLRGKYPNRG+PKIF+DK VG+EA+ ++ DAQ +L  +I  K L   GV+GF+PA S  DDI LY   +        + T +GLRQQ E++    DP YLC+SDFIAP+ SG  DY+G+FAV A  G + L++ ++++ DDY+S+MVKAL DRLAEA AE LH   R  LWGY   E L   D  ++ Y+GIRPAPGYP+QPDH+E+ TVW L   E R GI L  +SL M+PA++VSGLYFS+ KSKYF+VGKISKDQ+ DYA RK +S+ E EK L  IL Y+TD
Sbjct:   14 MKKTLQDEIEAILQERIMVLDGGMGTMIQRHKLSEEDFRGQEFKDHARPLKGNNDILSITQPNVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMCSAGVARKAAEDISLQTGIKRYVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYKEQAKGLLDGGVDILLIETIFDTANAKAALFAVQKLFEEEYVPRPVFISGTIVDKSGRTLSGQTGEAFVISVSHADPLCIGLNCALGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDETPHVMAMHLKDFAVDGLVNIVGGCCGTTPDHIREIAEAVKNCKPRVPPATVFEGHMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRRFAKLIMAGNYEEALSVAKMQVEMGAQVLDINMDDGMLDGPSAMTRFCNFIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDDFLEKARKIKKFGAAVVVMAFDEEGQATETDPKIRVCTRAYHLLLKKLGFNPNDIIFDPNILTIGTGMEEHNLYAVNFINATKVIKETLPGAKVSGGLSNLSFSFRGMEAIREAMHGVFLYHAIKFGMDMGIVNAGSLPVYDDIHKELLQLCEDLIWNRDPEATEKLLHYAQTQGKGGK-KVIQT-DEWRNGPLEERLEYALVKGIEKYIIEDTEEARLNQEKYPRPLNIIEGPLMNGMKIVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETKVLTGKIEDEDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDEYFEEILEEYEDIRQDHYESLKERRYLTLRQARENGFHIDW-LSEPPPVKPTFLGTRVFEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFDDKTVGEEAKKVYDDAQNMLQALISQKKLQARGVVGFWPAQSIQDDIHLYAEGAVP-QASEPIATFYGLRQQAEKDSASSDP-YLCLSDFIAPLHSGIPDYLGLFAV-ACFGVEELSKAYEEECDDYSSIMVKALGDRLAEAFAEELHERARRELWGYCSGEQLAVADLRRLRYEGIRPAPGYPSQPDHTEKLTVWRLADVEQRTGIRL-TESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQIEDYASRKNMSVAEVEKWLGPILGYDTD 1265          
BLAST of Methionine synthase vs. UniProt/SwissProt
Match: sp|Q99707|METH_HUMAN (Methionine synthase OS=Homo sapiens OX=9606 GN=MTR PE=1 SV=2)

HSP 1 Score: 1596.64 bits (4133), Expect = 0.000e+0
Identity = 800/1259 (63.54%), Postives = 987/1259 (78.40%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEEREDPN---YLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            ++K ++  + + L++RIM+LDG MGTMIQ  KL E  FRG+ FKDH + L+GNND+LS+T+PD+++ IHKE+L +GADIIETNTFS T+IAQADYGLEH+ Y++N  SA +ARKA + V+ ++GI RFVAGA+GPTN+TLS+SPSVE+P+YRNITFD+LV AY+EQA  LLDGGVDILLIETIFDTANAKAA+FAL  +FEE     P+FISGTIVDKSGR LSGQT E F+ S+SH +P+CIGLNCALGA++MRPFIE I   TT++V+CYPNAGLPNTFG YDE P    + L  FA DGL+NIVGGCCG+TP HI  I +AV+   PR+PP T FE  ++LSGLE F I P T  FVNIGERCNVAGSR+F +LI    YEEAL +AK QVE GAQV+D+NMD+GML+G  AMT+F NLI+SEPDI+KVPLCIDSSNFAVIEAGLKC QGKCIVNSISLKEGE DF  K + IKK+GAA+V+MAFDE+GQA + D KI +C R Y LLV K+ FNPNDIIFD NILTIGTGMEEHN Y ++FI AT+ +K+ LP A++SGG+SN+SFSFRG E +REAMH VFL+HAIK+GMDMGIVNAG LPVYDDI   LL+LCED++WNK  +AT++LL YA+    +    +++T D WR+  V ERLE++LVKGI+K+IIEDTEEAR   K + RPL++IEGPLM GM  VGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFME+E+     ++G    E  Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P +KIL+ AL+ KAD+IGLSGLITPSL+EM+ VA+EMERL +R PLLIGGATTS+ HTAVKIAP+YS P +HVLDASKSVVV + LLD+    E+ E I EEYE+IR++HYESL ER YL + +ARK   Q++W +      +P F+G+++ E+ D+  L+ YIDWKPFFDVWQLRGKYPNRG+PKIFNDK VG EA+ ++ DA  +L  +I  K L   GV+GF+PA S  DDI LY  ++        + T +GLRQQ E++  +   Y C+SDFIAP+ SG  DY+G+FAV A  G + L++ ++D GDDY+S+MVKAL DRLAEA AE LH  VR  LW Y  +E L   D  ++ Y GIRPAPGYP+QPDH+E+ T+W L   E+  GI L  +SL M+PA++VSGLYFS+ KSKYF+VGKISKDQV DYA RK IS+ E EK L  IL Y+TD
Sbjct:   14 LKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHARPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMCSAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQTGEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDETPSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATAFEGHMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDGMLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDDFLEKARKIKKYGAAMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQT-QGTGGKKVIQT-DEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQKKYPRPLNIIEGPLMNGMKIVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKSGFQMDW-LSEPHPVKPTFIGTQVFEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTLISQKKLRARGVVGFWPAQSIQDDIHLY-AEAAVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAV-ACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL-TESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPILGYDTD 1265          
BLAST of Methionine synthase vs. UniProt/SwissProt
Match: sp|Q9Z2Q4|METH_RAT (Methionine synthase OS=Rattus norvegicus OX=10116 GN=Mtr PE=1 SV=1)

HSP 1 Score: 1596.25 bits (4132), Expect = 0.000e+0
Identity = 796/1261 (63.12%), Postives = 994/1261 (78.83%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEA-GYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEA---RKCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE----DPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            M+K ++  + + LR+RIM+LDG MGTMIQ YKL E +F+G+ FKDH + L+GNND+LS+T+PD+++ IHKE+L +GADIIETNTFS T+IAQADYGLEH+ Y++N  SA +ARKA + ++ ++G+ RFVAG++GPTN+TLS+SPSVE+P+YRNITFD+LV AY+EQA  LLDGGVDILLIETIFDTANAKAA+FAL ++FEE      P+FISGTIVDKSGR LSGQT EAF+TS+SH  P+CIGLNCALGA++MRPFIETI   TT++V+CYPNAGLPNTFG YDE P      L  FA DGL+N+VGGCCG+TP HI  I +AV+   PR+PP ++FE  ++LSGLE F I P T  FVNIGERCNVAGS++F +LI    YEEALS+AK QVE GAQV+D+NMD+GML+G  AMTKF N I+SEPDI+KVPLCIDSSNFAVIEAGLKC QGKCIVNSISLKEGE DF  K + IKKFGAAVV+MAFDE+GQA + D K+++C R Y LLV K+ FNPNDIIFD NILTIGTGMEEHN Y ++FI AT  +K+ LP  ++SGG+SN+SF+FRG + +REAMH VFL+HAIK GMDMGIVNAG LPVYDDI   LL+LCED++WN+  +AT++LL YA+   K     +++T D WR+ S+ ERLE++LVKGI+K+I+EDTEEA   R+ + RPL++IEGPLM GM  VGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFME+E+  A  ++G    E  Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P +KILQ AL+ KAD+IGLSGLITPSL+EM+ VA+EMERL ++ PLLIGGATTSR HTAVKIAP+YS P +HVLDASKSVVV + LLD+    ++ E I EEYE+IR++HYESL ER YL + +ARK    ++W +      +P F+G+++ E+ ++  L+ YIDWKPFFDVWQLRGKYPNRG+PKIFNDK VG+EA+ ++ DAQ +L  +I  K L   GV+GF+PA S  DDI LY   +        + T +GLRQQ E++    DP Y C+SDF+AP+ SG  DY+G+FAV A  G + L++ ++D GDDY+S+MVKAL DRLAEA AE LH  VR  LW Y  +E L   D  K+ Y+GIRPAPGYP+QPDH+E+ T+W L   E+  GI L  +SL M+PA++VSGLYFS+ KSKYF+VGKISKDQ+ DYA RK +S+ E EK L  IL Y+TD
Sbjct:    1 MKKTLQDEIEAILRKRIMVLDGGMGTMIQRYKLSEENFQGQEFKDHSRPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNKCSADVARKAAEEITLQTGVKRFVAGSLGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLIETIFDTANAKAALFALQKLFEENYASPRPIFISGTIVDKSGRTLSGQTGEAFVTSVSHSDPLCIGLNCALGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDETPAMMAMHLKDFAVDGLVNVVGGCCGSTPDHIREIAEAVKNCKPRVPPDSVFEGHMLLSGLEPFRIGPYTN-FVNIGERCNVAGSKKFAKLIMAGNYEEALSVAKVQVEMGAQVLDINMDDGMLDGPSAMTKFCNFIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEEDFLEKARKIKKFGAAVVVMAFDEEGQATETDVKVSVCTRAYHLLVEKVGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATRVIKETLPGVRISGGLSNLSFAFRGMDAIREAMHGVFLYHAIKFGMDMGIVNAGSLPVYDDIHKDLLQLCEDLIWNRDAEATEKLLRYAQTHGKGGK-KVIQT-DEWRNGSIEERLEYALVKGIEKHIVEDTEEARLNREKYPRPLNIIEGPLMNGMKVVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREEARVLNGSVEEEDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILQAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDDYFEEILEEYEDIRQDHYESLKERKYLPLSQARKHSFHIDW-LSEPHPVKPTFIGTQVFEDYNLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKAVGEEARKVYEDAQNMLSILISRKKLRARGVVGFWPAQSVQDDIHLYAEGAVP-QAAEPIATFYGLRQQAEKDSSSTDP-YHCLSDFVAPLHSGVRDYLGLFAV-ACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLGVTDLRKLRYEGIRPAPGYPSQPDHTEKLTMWRLANIEQATGIRL-TESLAMAPASAVSGLYFSNVKSKYFAVGKISKDQIEDYALRKNMSVAEVEKWLGPILGYDTD 1253          
BLAST of Methionine synthase vs. UniProt/SwissProt
Match: sp|A6H5Y3|METH_MOUSE (Methionine synthase OS=Mus musculus OX=10090 GN=Mtr PE=1 SV=1)

HSP 1 Score: 1582.77 bits (4097), Expect = 0.000e+0
Identity = 795/1261 (63.05%), Postives = 989/1261 (78.43%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEA-GYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE----DPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPER-IGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            M+K ++  + + LR+RIM+LDG MGTMIQ YKL E  F+G+ FKDH + L+GNND+LS+T+PDI++ IHKE+L +GADIIETNTFS T+IAQADYGLEH+ Y++N  SA +ARKA + ++ ++G+ RFVAGA+GPTN+TLS+SPSVE+P+YRNITFD+LV AY+EQA  LLDG VDILLIETIFDTANAKAA+FA+  +FEE      P+FISGTIVDKSGR LSGQT EAF+TS+SH  P+CIGLNC+LGA++MRPFIETI   TT++V+CYPNAGLPNTFG YDE P      L  FA DGL+NIVGGCCG+TP HI  I +AV+   PR+PP ++FE  ++LSGLE F I P T  FVNIGERCNVAGSR+F +LI    YEEALSIAK QVE GAQV+D+NMD+GML+G  AMT+F N I+SEPDI+KVPLCIDSSNFAVIEAGLKC QGKCIVNSISLKEGE DF  K + IKKFGAAVV+MAFDE+GQA + D K+ +C R Y LLV+K+ FNPNDIIFD NILTIGTGMEEHN Y ++FI AT  +K+ LP  ++SGG+SN+SFSFRG E +REAMH VFL+HAIK GMDMGIVNAG LPVYD I   LL+LCED++WNK  +AT++LL YA+    +    +++T D WR+ S+ ERLE++LVKGI+K+I+EDTEEAR   + + RPL++IEGPLM GM  VGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFME+E+  A  ++G    E  Y GT+V+ATVKGDVHDIGKNIVGVV+ CNN+RVIDLGVM P +KILQ AL+ KAD+IGLSGLITPSL+EM+ VA+EMERL ++ PLLIGGATTSR HTAVKIAP+YS P +HVLDASKSVVV + LLD+    ++ E I EEYE+IR++HYESL ER Y+ + +ARK    ++W +      +P F+G+++ E+ ++  L+ YIDWKPFFDVWQLRGKYPNRG+PKIFNDK VG+EA+ +++DAQ +L  +I  K L   GV+GF+PA S  DDI LY  +         + T +GLRQQ E++    DP Y C+SDFIAP+ SG  DY+G+FAV A  G + L++ ++D GDDY+S+MVKAL DRLAEA AE LH  VR  LW YS +E L   D  ++ Y+GIRPAPGYP+QPDH+E+ T+W L   E+  GI L  +SL M+PA++VSGLYFS+ K+KYF+VGKISKDQ  DYA RK + + E EK L  IL Y+TD
Sbjct:    1 MKKTLQDEIEAILRKRIMVLDGGMGTMIQRYKLSEEHFQGQEFKDHSRPLKGNNDILSITQPDIIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNKCSADVARKAAEEITLQTGVKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVDAYQEQAKGLLDGRVDILLIETIFDTANAKAALFAIQNLFEENYAPPRPIFISGTIVDKSGRTLSGQTGEAFVTSVSHSDPLCIGLNCSLGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDETPSTMATHLKDFAVDGLVNIVGGCCGSTPDHIREIAEAVKKCKPRVPPASVFEGHMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRKFAKLIMAGNYEEALSIAKAQVEMGAQVLDINMDDGMLDGPSAMTRFCNSIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEGDFLEKARKIKKFGAAVVVMAFDEEGQATETDVKVNVCTRAYHLLVDKVGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATRVIKETLPGVRISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKFGMDMGIVNAGNLPVYDAIHKDLLQLCEDLIWNKDSEATEKLLRYAQT-HGTGGKKVIQT-DEWRNGSIEERLEYALVKGIEKHIVEDTEEARLNGEKYPRPLNIIEGPLMNGMKVVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREEARLINGSVEEEDPYQGTIVLATVKGDVHDIGKNIVGVVLACNNFRVIDLGVMTPCDKILQAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIKIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLRDDYFEEILEEYEDIRQDHYESLKERKYVPLSQARKHGFHIDW-LSEPHPVKPTFIGTQVFEDYNLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKAVGEEARKVYNDAQNMLNILISQKKLQARGVVGFWPAQSVQDDIHLY-AEGVVPQAAEPIATFYGLRQQAEKDSSSTDP-YHCLSDFIAPLHSGVCDYLGLFAV-ACFGVEELSKTYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYSRSEQLGVPDLRRLRYEGIRPAPGYPSQPDHTEKLTMWRLASIEQATGIRL-TESLAMAPASAVSGLYFSNVKAKYFAVGKISKDQTEDYALRKNMPVAEVEKWLGPILGYDTD 1253          
BLAST of Methionine synthase vs. UniProt/SwissProt
Match: sp|Q09582|METH_CAEEL (Probable methionine synthase OS=Caenorhabditis elegans OX=6239 GN=metr-1 PE=3 SV=1)

HSP 1 Score: 1543.1 bits (3994), Expect = 0.000e+0
Identity = 765/1257 (60.86%), Postives = 982/1257 (78.12%), Query Frame = 3
Query:   42 KSVLFSTL----RERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGY-EVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKC---HVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE-DPNYLCISDFIAPIESGC-DDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            +S LF  L    +ERIMI+DGAMGTMIQ   +EE DFRGEI KDH K L+GNNDLLS+T+PDI++ IHK +L++GAD +ETNTFSGT IAQADY  EH+V+++NY+SA++AR+ACD V + +G  R+V GAIGPTNRTLSISPSVEKP++RN+TF +LV AY +QA +L+ GGVD+LL+ET+FD+ANAKAA+FA+  +FE+ G  E+PVF+SGTIVD SGR LSGQT EAFL S    KP+ +GLNCALGA DMR F++ +S  + SF+ICYPNAGLPN  G YDE PE   ++L +FA+DGL+NI+GGCCGTTP HI A+ KAV+G +PR+PP       ++LSGLE  I+ P T  FVNIGERCNVAGSRRF  LIK + Y+ A+ +A+ QV++GAQ++D+NMD+G+L+G  AM+KF+ LISSEPD++K+P+CIDSS+F VI AGL+ TQGKC+VNSISLKEGE  F  + +IIK++GAAVV+MAFDEQGQAA+ D K  IC R Y +L  ++ FNPNDIIFD NILTI TGMEEH+ YGM FI A   +++NLP A VSGGVSNISFSFRG E +REAMHSVFLF+AIKAGMDMGIVNAG LPVY+DI+  LL+L ED+L+N+  +AT++LL  A+ + K       KT D WRSL+V ERL+ +LVKG+D++++ DTEEAR+    + RPL+VIE PLM GM+ VG+LFGAGKMFLPQVIKSARVMK+AV +L+PFME E++  +E  G+  +E  Y GT+VIATVKGDVHDIGKNIV VV+GCNN++V+DLGVM P E I++ A+EEKAD IGLSGLITPSL+EM++VA+EM R+G+  PLLIGGATTS+ HTAVKI+P+Y  P VH LDASKSVVV +SL D +    F +++ E+YE++R+EHY SL +R +  +++ R++K +++W  D F + +P+F+G +  +N D+N L+PYIDWKPFFDVWQLRGKYPNR YPKIF+D DVG EA+ +F DAQ  L ++I  K+L  N V+ F PA SEGDD+ +YDP++      N L T +GLRQQ  RE D  + C+SDFI P+++G  DDY+G+FA TAG+GA+   +  +   DDY S+MVKALADRLAEA AEYLH  VRTTLWGYS NE+LT  D + + Y GIRPA GYP+QPDH+E+ T+W LL+ E+ GI L  + L M PAASVSGLYF++P+S+YF+VGKI +DQV DYA RK +   E E+ L  IL Y+TD
Sbjct:    3 RSSLFEELAEIAKERIMIIDGAMGTMIQREYMEEEDFRGEILKDHDKPLKGNNDLLSITRPDIIYKIHKLYLEAGADFVETNTFSGTTIAQADYRCEHLVHEINYQSALVARRACDDVGAATGRRRYVCGAIGPTNRTLSISPSVEKPDFRNVTFQELVKAYGDQARSLIQGGVDVLLVETVFDSANAKAALFAIRTLFEDEGVPEMPVFLSGTIVDMSGRTLSGQTGEAFLVSTKQGKPMAVGLNCALGAKDMRQFVDNMSKWSDSFIICYPNAGLPNALGGYDETPEEMADVLREFARDGLVNIIGGCCGTTPDHINAMYKAVQGITPRVPPQDPHAGKMLLSGLEPSIVGPETN-FVNIGERCNVAGSRRFCNLIKNENYDTAIDVARVQVDSGAQILDVNMDDGLLDGPYAMSKFLRLISSEPDVAKIPVCIDSSDFDVIIAGLESTQGKCVVNSISLKEGEEKFKERARIIKRYGAAVVVMAFDEQGQAAETDPKFEICERSYRILTEEVGFNPNDIIFDANILTIATGMEEHSNYGMYFIEAARMIRENLPGAHVSGGVSNISFSFRGMEAIREAMHSVFLFYAIKAGMDMGIVNAGALPVYEDIDKPLLQLLEDLLFNRDPEATEKLLVAAQEMKKDGKKADTKT-DEWRSLTVEERLKFALVKGVDQFVVADTEEARQNTAKYPRPLNVIERPLMDGMAVVGELFGAGKMFLPQVIKSARVMKKAVAHLLPFMEIERQANIETMGLAEDESPYQGTVVIATVKGDVHDIGKNIVSVVLGCNNFKVVDLGVMTPCENIIKAAIEEKADFIGLSGLITPSLDEMVYVAKEMNRVGLNIPLLIGGATTSKTHTAVKISPRYPHPVVHCLDASKSVVVCSSLSDMSVRDAFLQDLNEDYEDVRQEHYASLKDRRFTDLNKTREKKFKIDW--DKFTAVKPSFVGRREYQNFDLNELIPYIDWKPFFDVWQLRGKYPNRSYPKIFDDADVGAEAKKVFDDAQTWLKKLIDEKILVANAVVSFLPAASEGDDMHVYDPET-----GNKLDTFYGLRQQSGREHDQPHFCLSDFIKPLKNGVPDDYLGLFACTAGLGAEEYCKTLEKNHDDYASIMVKALADRLAEAYAEYLHKEVRTTLWGYSTNEDLTESDLLSIKYQGIRPACGYPSQPDHTEKRTLWKLLEAEKNGIGL-TEHLAMLPAASVSGLYFANPQSEYFAVGKIDQDQVIDYAARKNVPKEEVERWLSPILGYDTD 1249          
BLAST of Methionine synthase vs. TrEMBL
Match: A0A2C9JEV6 (Methionine synthase OS=Biomphalaria glabrata OX=6526 GN=106055438 PE=4 SV=1)

HSP 1 Score: 1659.81 bits (4297), Expect = 0.000e+0
Identity = 825/1260 (65.48%), Postives = 1008/1260 (80.00%), Query Frame = 3
Query:   33 KNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKT--EDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARK---CHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSN-EPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEEREDPN---YLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETDE 3785
            ++I   L  TL+ RIMI DG MGTMIQ  +L E DFRG IFKDHP+ L+GNNDLL LT+PD+V  IHKE+L +GAD IETNTFSGT+IAQ+DYGLE  VY++N E+A LAR+ACD VS ++G++R+VAGAIGPTNRTLSISPSVE PE RNITFD+LV AY EQA  LLDGG D+LL+ETIFDTANAKAA+FA+  VFE     VPV++SGTIVDKSGR LSGQTTEAF+ S+SH +P+C+GLNCALGA +MRPF+E++S NTT++V+CYPNAGLPNTFG YDE PE T   +  F KDGLINI+GGCCGT P HI AI +  + + PR+PP  L    L LSGLE F I+P T  FVNIGERCNVAGSRRF RLIK  K+EEALS+AKEQV+NGAQ+ID+NMDEGML+G  AMT ++NLI+SEP+I+KVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGE DF RK +IIKK+GAAVVIMAFDE GQAAD +RK++IC R Y+LL  K+ FNPNDIIFD NILTI TG+EEHN YG++FI AT  +KK LP A+VSGGVSN SFSFRG E +REAMHSVFLFHAIKAG+DMGIVNAG LPVYDDIEP LL+LCE++LWNK  D T++LL YA+   KS   G+ K   +D WRS  V ERL +SLVKGIDKY+IEDTEEAR+    + RPL+VIEGPLM+GM+ VGDLFG+GKMFLPQVIKSARVMK+AVG+LIP+ME+E++ +M+  G+  + EP Y GT+VIATVKGDVHDIGKNIV VV+GCNNY+VIDLGVMCP E I++ A++EKAD IG+SGLITPSL+EM++  +E ER+G+  P+LIGGATTS+QHTAVKIAP+ + P VHVLDASK+VVV ++L D T   EF E + EEYEEIR+EHYESL +R YL + +AR++KL ++WS       +P+F+G K  EN D+  L+PYIDW+PFF+VWQLRGKYPNRGYPKIFNDK+VG+EA+ +F+DAQK++ +II+ K L     I FYPA+S GDDI +YD           + TLFGLRQQ E+E  +   YLC SDFIA  ESG  DY+G+FA T+GIG + L Q+++ Q DDYN +MVKA+ADRLAEA AEYLH  VR   WGYS  EN  P+D  ++ Y GIRPA GYP+QPDH+E+ T+W L++P+ +GI L  DSL M PA+SVSG+Y ++P+S YF+  K+ KDQ+ DYA+RKQI +  +EK L+S L+Y+ DE
Sbjct:   15 RDIFKELECTLKNRIMIFDGGMGTMIQRERLAEEDFRGTIFKDHPRNLKGNNDLLCLTRPDVVLKIHKEYLYAGADFIETNTFSGTSIAQSDYGLEKYVYRINKEAAELARRACDEVSIQTGVTRYVAGAIGPTNRTLSISPSVEHPEMRNITFDELVEAYTEQARGLLDGGADVLLVETIFDTANAKAALFAIDNVFEMGYPGVPVYVSGTIVDKSGRTLSGQTTEAFIISVSHAQPMCLGLNCALGAREMRPFVESVSKNTTAYVLCYPNAGLPNTFGEYDETPEQTASYIQDFIKDGLINIIGGCCGTQPGHIKAIAEVAKKFKPRVPPLELHSGHLCLSGLEPFYISPLTN-FVNIGERCNVAGSRRFCRLIKDRKFEEALSVAKEQVQNGAQIIDINMDEGMLDGVSAMTTYVNLITSEPEIAKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGEDDFLRKARIIKKYGAAVVIMAFDEVGQAADTERKVSICTRSYNLLTQKLGFNPNDIIFDPNILTIATGIEEHNIYGINFIEATAIIKKTLPGARVSGGVSNFSFSFRGMEAIREAMHSVFLFHAIKAGLDMGIVNAGALPVYDDIEPELLKLCENLLWNKDPDGTEKLLAYAQTKSKS---GMTKASQDDEWRSKPVEERLSYSLVKGIDKYVIEDTEEARQNTALYPRPLNVIEGPLMKGMAVVGDLFGSGKMFLPQVIKSARVMKKAVGHLIPYMEKERQESMKAQGLPEDAEPSYQGTVVIATVKGDVHDIGKNIVSVVLGCNNYKVIDLGVMCPCESIIEAAIKEKADYIGMSGLITPSLDEMIYNVKEFERVGLNIPVLIGGATTSKQHTAVKIAPRKTSPVVHVLDASKAVVVVSALGDQTSRDEFIEELSEEYEEIREEHYESLKDRKYLPLSKAREKKLVIDWSKTPLPV-KPSFIGVKKFENFDLQELVPYIDWRPFFNVWQLRGKYPNRGYPKIFNDKEVGEEAKRIFNDAQKIIEKIIKEKKLQAAATIAFYPANSVGDDIEVYD------ETGKKIATLFGLRQQAEKESSDNSPYLCQSDFIASKESGITDYIGLFACTSGIGTEQLCQEYETQFDDYNVIMVKAVADRLAEAFAEYLHLKVRKEYWGYSHEENSNPDDLHRLKYQGIRPAAGYPSQPDHTEKTTMWQLMRPDEVGITL-TDSLAMEPASSVSGIYLANPQSFYFATDKLCKDQIIDYAQRKQIDLTVAEKWLRSNLAYDDDE 1262          
BLAST of Methionine synthase vs. TrEMBL
Match: K1P5E0 (Methionine synthase OS=Crassostrea gigas OX=29159 GN=CGI_10010551 PE=4 SV=1)

HSP 1 Score: 1652.11 bits (4277), Expect = 0.000e+0
Identity = 807/1252 (64.46%), Postives = 1000/1252 (79.87%), Query Frame = 3
Query:   33 KNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARK---CHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEEREDPN---YLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILS 3770
            + ++  + STL+ERIMI DG MGTMIQ ++LEE DFRG+ FKDH K L+GNND+L LT+P +VF IHK++ ++GAD +ETNTFSGT IAQADYG EH+ Y+LNYE+A +A++A + V++K+GI ++VAGA+GPTNRTLSISPSVEKPE+RN+TFD+LV AY EQA  LL+GG D+LL+ETIFDTAN+KAA+FA+ E+F +  +  PVF+SGTIVDKSGR LSGQTTEAFL S+SH  P+CIGLNCALGA++MRPFIE +S NTT++ ICYPNAGLPNTFG YDE PE   E LS FA+DGL+NIVGGCCGTTP HI AI + V  + PR+PP  L +D ++LSGLE   + P T  FVNIGERCNVAGSR+F RLIK   YEEALSIAK QVENGAQ++D+NMDEGML+G   MTKF+NL++SEP+ISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSIS+KEGE DF  K + IK++GAAVV+MAFDE+GQA    RK  IC R Y +LV+K+ FNPNDIIFD NILTI TG+EEHN YG+DFI AT+ +K+NLP A+VSGGVSN SFSFRG E VREAMHSVFL+HAIK GMDMGIVNAGCLPVYDDIEP+LLE+CE++LWNK  D T++LL YA+++ K     ++   D WR+ +V ERLE SL+KGIDK+++EDTEEAR+    + RPL+VIEGPLM+GMS VGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFME+EK   M+ +G  + E  Y G +V+ATVKGDVHDIGKNIVGVV+ CNN++VIDLGVM P EKILQ A+EE AD+IGLSGLITPSL+EM++VA+EMER+G + PLLIGGATTS+ HTAVKIAP+Y  PTVHVLDASKSVVV + LLD+   +++ E + E+Y EIR +HY SL +R YLSI++AR++KL ++WS  +  +  P+ +G K  EN D++ L+PYIDWKPFFDVWQLRGKYPNRGYPKIF DK VG EA+ +++DAQ +L  II    L  +GV+ F+PA+S GDDI +Y+ +         +  L GLRQQ E+E  +   YLC+SDF+AP  SG  DY+GMFAVTAG G D + + ++++ DDY  +MVKALADRLAEA AE LH  VR  +WGYS  E L   D  K+ Y GIRPAPGYP+QPDH+E+  +W LLK +++GI L  +SL M PAASVSGLYF+HPKS+YF+ GK+ KDQ+ DY+ RK + +  +EK L S L+
Sbjct:   13 ETVRDKIQSTLQERIMIFDGGMGTMIQKHRLEEEDFRGQEFKDHLKSLKGNNDILVLTQPKLVFEIHKDYFEAGADFVETNTFSGTKIAQADYGTEHLTYRLNYEAAKIAKRAAEEVTNKTGIQKYVAGAMGPTNRTLSISPSVEKPEFRNVTFDELVEAYTEQAKGLLEGGADVLLVETIFDTANSKAALFAIEELFRKEKFTCPVFVSGTIVDKSGRTLSGQTTEAFLISVSHGNPMCIGLNCALGANEMRPFIEAVSKNTTAYTICYPNAGLPNTFGDYDETPESMCEQLSNFARDGLLNIVGGCCGTTPEHIKAIAEGVSQFKPRVPPDELRKDFMMLSGLEPTYLGPYTN-FVNIGERCNVAGSRKFARLIKDGDYEEALSIAKTQVENGAQILDINMDEGMLDGVACMTKFVNLVASEPEISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISMKEGEEDFVEKARKIKQYGAAVVVMAFDEEGQATGRQRKFEICQRSYRILVDKVKFNPNDIIFDPNILTIATGIEEHNSYGVDFIMATKDIKENLPGARVSGGVSNFSFSFRGMEAVREAMHSVFLYHAIKNGMDMGIVNAGCLPVYDDIEPKLLEMCENLLWNKDPDGTEKLLAYAQSMGKDAKKAVVS--DEWRNKNVEERLEFSLIKGIDKFVVEDTEEARQNQELYPRPLNVIEGPLMKGMSVVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEKEERMKRTG--NVESGYSGVIVLATVKGDVHDIGKNIVGVVLACNNFKVIDLGVMTPCEKILQTAMEENADIIGLSGLITPSLDEMIYVAKEMERIGFKVPLLIGGATTSKTHTAVKIAPQYKSPTVHVLDASKSVVVCSQLLDEENREDYMEEVTEDYAEIRTDHYNSLKDRKYLSIEKAREKKLNIDWSA-YPPAPEPSVIGVKRFENYDLSRLVPYIDWKPFFDVWQLRGKYPNRGYPKIFKDKTVGPEAKRVYNDAQNLLKTIITTNKLQAHGVVAFFPANSVGDDIEVYNENG------EVIEVLRGLRQQAEKEALDKSPYLCLSDFVAPKSSGKKDYIGMFAVTAGHGVDKMCKVYEEKYDDYGIIMVKALADRLAEAFAEELHERVRKEIWGYSREELLEANDLHKIKYQGIRPAPGYPSQPDHTEKDIMWRLLKADKVGITL-TESLAMFPAASVSGLYFAHPKSEYFATGKLQKDQIVDYSARKSVDVSVTEKWLSSALA 1251          
BLAST of Methionine synthase vs. TrEMBL
Match: A0A3Q1JSN2 (Methionine synthase OS=Anabas testudineus OX=64144 PE=4 SV=1)

HSP 1 Score: 1649.8 bits (4271), Expect = 0.000e+0
Identity = 814/1257 (64.76%), Postives = 1011/1257 (80.43%), Query Frame = 3
Query:   39 IKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKC---HVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNH-LTTLFGLRQQEEREDPN---YLCISDFIAPIESGCDDYVGMFAVTAGI-GADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLK-PERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            ++S L + L++R+M+LDG MGTMIQ +KLEE DFRG+ FKDHP  L+GNNDLLS+T+P+I++NIHKE+L +GADIIETNTFS T++AQADYGLEHM Y+LN  SA LAR+A D V+ ++G  R+VAG++GPTN+TLS+SPSVE+P++RNITFD+LV AY EQ   LLDGG D++L+ETIFDTANAKAA+FA+  +FE++    P+FISGTIVD+SGR LSGQT EAF+ S+SH KP+CIGLNCALGA++MRPFIETI  +TT+F+ICYPNAGLPNTFG YDE PE T   L +FA DGL+NIVGGCCGTTP HI AI +AVR   PR P   +++DCL+LSGLE F I P T  FVNIGERCNVAGS +F RLIKT  YEEALSIAK QVE GAQV+D+NMDEGMLEG  AMT+F NLI+SEPDI++VPLCIDSSNF+VIEAGLKC QGKCIVNSISLKEGE +F  +   +K++GAAVV+MAFDE+GQA D DRK+ IC R Y LLVNK+ FNPNDIIFD NILTIGTGMEEHN Y ++F+RAT+ +K+ LP A+VSGG+SN+SFSFRG E +REAMH  FL+HAIK GMDMGIVNAG LPVYDDI+  LL LCE+++WN+   ATD+LL YA+N +K     +++T D WR  SV ERLE++L+KGI+KYI+ED EE R     + RPLH+IEGPLM GM  VGDLFGAGKMFLPQVIKSARVMK+AV +LIPFME+E+   M  +G       Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P +KIL+ A+ +KAD+IGLSGLITPSL+EM++VA+EMERLG++TPLLIGGATTS+ HTAVKIAP+YS P VHVLDAS+SVVV + LLD+T  +E+ + ++EEYEEIR++HY+SL +R YLS+ +AR++ L ++W +   +  RP FLG++I E  D+N L+ +IDWKPFFDVWQLRGKYPNRGYPKIFNDK VG EAQ +F DAQ++L ++I    L  +G++GF+ A S GDDI +Y+ D   V R    + T  GLRQQ  ++  +   YLC+SDF+AP++SG  DY+G+FA  AG+ GA  L+Q+F+ QGDDY+S+MVKALADRLAEA AE LH  VR  LWGYS  E L   D  +V Y GIRPAPGYP+QPDH+E+ T+WDL    E+ GI+L  +SL M PAASVSGLYFS+P++ YF+VGKI+K+QV DYAKRK++S+ E E+ L  IL Y+TD
Sbjct:   20 LESELRAVLQKRVMVLDGGMGTMIQHHKLEEEDFRGDEFKDHPLPLKGNNDLLSITQPNIIYNIHKEYLQAGADIIETNTFSSTSVAQADYGLEHMAYRLNKASAELARRAADDVAKQTGCKRYVAGSVGPTNKTLSVSPSVERPDFRNITFDELVEAYSEQVRGLLDGGADLILVETIFDTANAKAALFAIDLLFEKSYERKPIFISGTIVDRSGRTLSGQTGEAFIVSVSHAKPLCIGLNCALGATEMRPFIETIGQSTTAFIICYPNAGLPNTFGGYDETPEVTASNLKEFAMDGLVNIVGGCCGTTPGHIRAISEAVRHCKPRAPVANIYQDCLLLSGLEPFRIGPHTN-FVNIGERCNVAGSLKFARLIKTGNYEEALSIAKMQVEMGAQVLDINMDEGMLEGATAMTRFCNLIASEPDIARVPLCIDSSNFSVIEAGLKCCQGKCIVNSISLKEGEEEFLLRAATVKRYGAAVVVMAFDEEGQATDTDRKVEICTRAYKLLVNKVGFNPNDIIFDPNILTIGTGMEEHNEYAVNFMRATKLIKETLPGARVSGGLSNLSFSFRGMEAIREAMHGAFLYHAIKDGMDMGIVNAGNLPVYDDIDKELLLLCENLIWNRDAGATDKLLAYAQNNVKGGK-KVVQT-DEWREGSVEERLEYALIKGIEKYIVEDVEECRTQVDRYTRPLHIIEGPLMNGMKVVGDLFGAGKMFLPQVIKSARVMKKAVSHLIPFMEKEREEMMASTGSTEELDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMVPCDKILREAIAQKADIIGLSGLITPSLDEMIYVAKEMERLGIKTPLLIGGATTSKTHTAVKIAPRYSCPVVHVLDASRSVVVCSQLLDETMREEYFDEVKEEYEEIRQDHYDSLMDRQYLSLSQAREKALHIDW-LSQPRPVRPQFLGTRIFECYDLNSLVDFIDWKPFFDVWQLRGKYPNRGYPKIFNDKTVGSEAQRVFDDAQRLLSQMIDSSSLKGHGLVGFWRAQSYGDDINVYE-DDVKVRRDTKPIATFHGLRQQLVKDSSSSEAYLCLSDFVAPVDSGVADYIGLFA--AGVFGAKELSQQFEAQGDDYSSIMVKALADRLAEAFAEELHVRVRKELWGYSSEEALQTSDLHRVRYQGIRPAPGYPSQPDHTEKITMWDLAGVQEKTGISL-TESLAMMPAASVSGLYFSNPQASYFAVGKITKEQVEDYAKRKEMSVEEVERWLAPILGYDTD 1268          
BLAST of Methionine synthase vs. TrEMBL
Match: A0A1S3HNR6 (Methionine synthase OS=Lingula unguis OX=7574 GN=LOC106156809 PE=4 SV=1)

HSP 1 Score: 1649.41 bits (4270), Expect = 0.000e+0
Identity = 839/1257 (66.75%), Postives = 1011/1257 (80.43%), Query Frame = 3
Query:   36 NIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXX-XXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEER----EDPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            +I + + +TL ERIMI DGAMGTMIQ  +LEE DFRGE+FKDHPK L+GNNDLLSLT+PD++  IHKE+L++GAD +ETNTFSGT +AQADYGLEH+ Y++N ESA LAR+A D V++++G+ R+VAGA+GPTNRTLSISPSVEKPEYRNITFD+LVTAY EQA  LLDGG D+LL+ETIFDTAN+KAA+FA+  +FE+    VP+FISGTIVDKSGR LSGQTTEAF+ S+SH  P+C+GLNCALGAS+MRPFIE+I  NTT++V+CYPNAGLPNTFG YDE PE   E L  FA+DGL+NI+GGCCGTTP HI  IK+AV+ Y PR  PT L E   +LSGLE  +I P T  FVNIGERCNVAGSR+F +LIK ++YEEALSIAK QVENGAQV+D+NMDEGML+G  AM+KF+N ISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGE DF +K K+IKK GAAVV+MAFDE+GQA D +RKIAIC R YD+LV K+ F P DIIFD NILTI TG+EEHN YG+ FI AT  +K+ LP A+VSGGVSN SFSFRG + VREAMHSVFL+HAIKAGMDMGIVNAGCLPVYDDI+  LLELCE++LWNK  + T++LL YA++L K  D   +   + WR  +V ERL + L+KGIDKY++EDTEEAR     + R L+VIEGPLM GM TVGDLFGAGKMFLPQVIKSARVMK+AVGYLIPFME+EK   M+ +GI      Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN++VIDLGVM P EKIL  A +EKAD+IGLSGLITPSL+EM+HVA+EMER  M+TPLLIGGATTS+QHTAVKI+P+YS P +HVLDASKSVVV ++LLD T++   + E I EEYEEIR+EHYESL ER YLS+++AR++ L+++WS++      P FLG K  E  D++ L+PYIDWKPFFDVWQLRGKYPNRG+PKIFND  VG+EA+ L+++AQ +L +I   KLL   GV+ FY A+S GDDI LYD      +   +L TL+GLRQQ E+    EDP YLCISDF+AP E+   DY+GMFAV+   G D +  +F+ Q DDY+ +MVKALADRLAEA AE +H  VR   WGY   E L  +D  ++ Y+GIRPAPGYP+QPDH+E+ T+W L+KP+R+GI L  +SL M PAASVSGLYF++PKS YF+VGKI+KDQV DYA RK+  +   EK L   L+Y TD
Sbjct:   17 DIGAEISATLEERIMIFDGAMGTMIQKNRLEEEDFRGELFKDHPKNLKGNNDLLSLTRPDVIMKIHKEYLEAGADFVETNTFSGTWVAQADYGLEHLAYRINLESAKLARRAADEVTAQTGVRRYVAGALGPTNRTLSISPSVEKPEYRNITFDELVTAYTEQAKGLLDGGADVLLVETIFDTANSKAALFAIETLFEKDYKPVPIFISGTIVDKSGRTLSGQTTEAFVISVSHSNPMCLGLNCALGASEMRPFIESIGKNTTAYVLCYPNAGLPNTFGEYDETPELMAEKLGSFARDGLVNIIGGCCGTTPDHIRVIKEAVQKYPPRKRPTVLREGYTLLSGLEPMLIGPHTN-FVNIGERCNVAGSRKFCKLIKDNQYEEALSIAKLQVENGAQVLDINMDEGMLDGVAAMSKFVNFISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGEEDFIQKAKVIKKHGAAVVVMAFDEEGQATDTERKIAICQRSYDILVKKVGFYPYDIIFDPNILTIATGIEEHNPYGISFIEATRAIKERLPGARVSGGVSNFSFSFRGMDAVREAMHSVFLYHAIKAGMDMGIVNAGCLPVYDDIKKELLELCENLLWNKDPEGTEKLLTYAQSLGK--DAKKITESEEWRKNTVEERLAYGLIKGIDKYVVEDTEEARANKALYPRTLNVIEGPLMAGMGTVGDLFGAGKMFLPQVIKSARVMKKAVGYLIPFMEKEKEEKMKETGIKDLSDAYNGTVVLATVKGDVHDIGKNIVGVVLGCNNFKVIDLGVMTPCEKILDTATQEKADIIGLSGLITPSLDEMIHVAKEMERRDMKTPLLIGGATTSKQHTAVKISPRYSSPVIHVLDASKSVVVCSNLLDKTENYADYIEEIAEEYEEIREEHYESLKERKYLSLEKARQKSLKIDWSMEP-APVAPTFLGVKTFEEYDLSALIPYIDWKPFFDVWQLRGKYPNRGFPKIFNDPTVGEEAKKLYNEAQAMLKKITDNKLLTARGVVAFYKANSIGDDIELYD------DTGAYLNTLYGLRQQAEKEPGVEDP-YLCISDFVAPKETSIRDYIGMFAVSC-FGVDKMCNEFERQLDDYSIIMVKALADRLAEAFAEEMHERVRKEYWGYCTQETLGAQDLHRIKYEGIRPAPGYPSQPDHTEKITMWKLMKPDRLGIKL-TESLAMEPAASVSGLYFANPKSYYFAVGKINKDQVEDYAGRKKEDVATIEKWLGPCLAYSTD 1260          
BLAST of Methionine synthase vs. TrEMBL
Match: A0A3Q1ECF4 (Methionine synthase OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 1639.78 bits (4245), Expect = 0.000e+0
Identity = 805/1255 (64.14%), Postives = 1000/1255 (79.68%), Query Frame = 3
Query:   39 IKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKC---HVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEEREDPN---YLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLK-PERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            ++S L + L++RIM+LDGAMGTMIQ ++L+E DFRG  FK+HP  L+GNND+LS+T+PDI++ IHKE+L++GADIIETNTFS T+IAQADYGLEHM Y LN  SA LARKA D V+ ++G  R+VAGA+GPTN+TLS+SPSVEKP++RNITFD+LV AY EQ   LLDGG DILL+ETIFDTANAKAA+FA+  +FE++    PVFISGTIVD+SGR LSGQT EAF+ S+SH KP+CIGLNCALGA++MRPFIE I  +TTSF+ICYPNAGLPNTFG YDE P+ T   L  F+  GL+NIVGGCCGTTPAHI AI +AVR   PR+P   ++++ L+L+GLE F I P T  FVNIGERCNVAGSR+F +LI    YEEALSIAK QVE GAQV+D+NMDEGMLEG  AM +F N I+SEPD+++VPLCIDSSNF+VIEAGLKC QGKCIVNSISLKEGE +F  +   +K++GAAVV+MAFDE+GQA D DRK+ IC R Y+LLV+K+ F+PNDIIFD NILTIGTGMEEHN Y ++FIRAT+ +K+ LP AKVSGG+SN+SFSFRG E +REAMH  FL+HAIK GMDMGIVNAG LPVYDDI+  LL LCED++WN+  DAT++LL YA+N +K +   +++T D WR  SV ERLE++L+KGIDKY++ED EE R     + RPLH+IEGPLM GM  VGDLFGAGK+FLPQVIKSARVMK+AVG+LIPFME+E+   M  S   +    Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P ++IL+ A+ +KAD+IGLSGLITPSL+EM+HVA+EMERLGM TPLLIGGATTS+ HTAVKIAP+YS P +HVLDAS+SVVV + LLD+   +E+ E ++EEYEEIR+EHY+SL +R YLS+ +AR++   ++W +   +  RP FLG+++ ++ D+N LL +IDWKPFFDVWQLRGKYPNRGYPKIFNDK VG EA+ +F DAQ++L  I     L   G++GF+ A S GDDI +Y  D+        + T  GLRQQ E++  +   YLC+SDFIAP++SG  DYVG+FAV    GA+ L+QKFQ QGDDYNS+MVKALADRLAEA AE LH  VR  LWGY+  E L   D  ++ Y GIRPA GYP+QPDH+E+ T+W+L    E+ GI L  +SL M+PAASVSGLYFS+P++ YF+VGKI+K+QV DYA+RK+ S+ E EK L  IL Y+++
Sbjct:   20 LESELRAVLQQRIMVLDGAMGTMIQQHELQEEDFRGSKFKEHPLPLKGNNDILSITQPDIIYKIHKEYLEAGADIIETNTFSSTSIAQADYGLEHMAYCLNKASAELARKAADDVAKQTGCKRYVAGAVGPTNKTLSVSPSVEKPDFRNITFDELVEAYVEQVRGLLDGGADILLVETIFDTANAKAALFAIDLLFEKSNERKPVFISGTIVDRSGRTLSGQTGEAFVVSVSHAKPLCIGLNCALGATEMRPFIEAIGKSTTSFIICYPNAGLPNTFGGYDETPQVTASNLQDFSMSGLVNIVGGCCGTTPAHIRAISEAVRHCKPRLPAADVYQNYLLLAGLEPFRIGPYTN-FVNIGERCNVAGSRKFAKLIMAGNYEEALSIAKAQVEMGAQVLDINMDEGMLEGPTAMARFCNFIASEPDVARVPLCIDSSNFSVIEAGLKCCQGKCIVNSISLKEGEPEFLLRAATVKRYGAAVVVMAFDEEGQATDTDRKVEICTRAYNLLVSKVGFDPNDIIFDPNILTIGTGMEEHNDYAVNFIRATKLIKETLPRAKVSGGLSNLSFSFRGMEAIREAMHGAFLYHAIKDGMDMGIVNAGNLPVYDDIDKELLSLCEDLIWNRDADATEKLLAYAQNNVK-EGKKVVQT-DQWRESSVEERLEYALIKGIDKYVVEDVEECRAQTDRYTRPLHIIEGPLMNGMKVVGDLFGAGKLFLPQVIKSARVMKKAVGHLIPFMEKEREEMMASSSTDTEMDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMVPCDRILREAVAQKADIIGLSGLITPSLDEMIHVAKEMERLGMTTPLLIGGATTSKTHTAVKIAPRYSSPAIHVLDASRSVVVCSQLLDEAVMEEYFEELKEEYEEIRQEHYDSLKDRRYLSLSQAREKAFHVDW-LSLPRPVRPQFLGTRVFDSYDLNSLLDFIDWKPFFDVWQLRGKYPNRGYPKIFNDKTVGSEARRVFDDAQRLLSHIFDQSSLKGRGLVGFWRAQSVGDDIRVYKDDATVCRDTKPIATFHGLRQQAEKDSHSSEPYLCVSDFIAPVDSGVADYVGVFAVGV-FGAEELSQKFQAQGDDYNSIMVKALADRLAEAFAEELHARVRKELWGYNAEEALQASDLHRIRYQGIRPAAGYPSQPDHTEKTTMWNLAGIQEKTGIGL-TESLAMTPAASVSGLYFSNPQASYFAVGKITKEQVEDYARRKETSVEEVEKWLAPILGYDSE 1268          
BLAST of Methionine synthase vs. Ensembl Cavefish
Match: mtr (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-031001-5])

HSP 1 Score: 1620.91 bits (4196), Expect = 0.000e+0
Identity = 799/1237 (64.59%), Postives = 996/1237 (80.52%), Query Frame = 3
Query:   96 MGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKC---HVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEERE----DPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLK-PERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            MGTMIQ  KLEE DFR + FKDHPK L+GNNDLLS+T+P+++++IHKE+L +GADIIETNTFSGT +AQADYGLE + Y+LN  SA +ARKA D V++++G+ R+VAGA+GPTNRTLS+SPSVE+P++RNITFD+LV AY EQ   LLDGG DILL+ETIFDTANAKAA+FA+  +FEE+    P+FISGTIVDKSGR LSGQT EAF+ S+SH+KP+CIGLNCALGA++MRPFIE I  +T++F+ICYPNAGLPNTFG YDE P+ T   + +FA DGL+NIVGGCCGTTP HI AI ++V+  SPR+P   +F D ++LSGLE F I P T  FVNIGERCNVAGSR+F +LI +  YEEALSIAK QVE GAQV+D+NMDEGMLEG  AMT+F NLI+SEPDI++VPLCIDSSNFAVIEAGLKC QGKCIVNSISLKEGE +F ++   ++++GAAVVIMAFDE+GQA + D+K+ IC R Y LLV+K+ FNPNDIIFD NILTIGTGMEEHN Y ++FIRAT  +K+ LP A+VSGG+SN+SFSFRG E +REAMH  FL+HAIK GMDMGIVNAG LPVYDDI+  LL LCE+++WNK  +AT++LL+YA+N  K     +++T D WR  +V ERLE++L+KGI+KY++EDTEEAR     + RPLHVIEGPLM GM TVGDLFGAGKMFLPQVIKSARVMK+AVGYLIPFME+E+   M  SG   +   Y GT+V+ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P ++IL+ A+E+KADVIGLSGLITPSL+EM+HVA+EM+RL ++TPLLIGGATTS+ HTAVKIAP+YS P +HVLDAS+SVVV + LLD+  ++++ E + EEYE+IR+EHY+SL ER YLS+ +AR + L ++W +      RP FLG+++ E  D+  L+ +IDWKPFFDVWQLRGKYPNRGYPKIFNDK VG EA+ ++ DA  +L  +I  K L   GV+GF+PA S+GDDILL+  +       N + T +GLRQQ E++    DP YLC+SDF+AP++SG  DYVG+FAV A  GA+ L++ F+ +GDDY+S+MVKALADRLAEA AE LH  VR  LWGYS   +L   +  K+ Y GIRPA GYP+QPDH+E+ T+W L    E+ GI L  +SL M+PAA+VSGLYFS+PKS YF+VGKI+K+QV DYA+RK+IS+ E+E+ L   L Y+TD
Sbjct:    1 MGTMIQQRKLEEEDFRAQEFKDHPKSLKGNNDLLSITQPEVIYSIHKEYLLAGADIIETNTFSGTRVAQADYGLEELAYRLNKASAEVARKAADDVAAQTGVKRYVAGAVGPTNRTLSVSPSVERPDFRNITFDELVEAYSEQVRGLLDGGCDILLVETIFDTANAKAALFAIDLLFEESYEPRPIFISGTIVDKSGRTLSGQTGEAFVISMSHMKPMCIGLNCALGATEMRPFIEAIGKSTSAFIICYPNAGLPNTFGDYDETPQVTASNIKEFAMDGLVNIVGGCCGTTPEHIRAISESVKQCSPRVPQKDIFNDYMLLSGLEPFRIGPYTN-FVNIGERCNVAGSRKFAKLIMSGNYEEALSIAKAQVEMGAQVLDINMDEGMLEGPAAMTRFCNLIASEPDIARVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEEEFLKRANQVRRYGAAVVIMAFDEEGQATEIDQKVQICTRAYHLLVSKVGFNPNDIIFDPNILTIGTGMEEHNMYAINFIRATSIIKETLPGARVSGGLSNLSFSFRGMEAIREAMHGAFLYHAIKDGMDMGIVNAGNLPVYDDIDKELLVLCENLIWNKDPEATEKLLQYAQNYAKGGK-KVIQT-DEWRKGNVEERLEYALIKGIEKYVVEDTEEARAQTDRYPRPLHVIEGPLMNGMKTVGDLFGAGKMFLPQVIKSARVMKKAVGYLIPFMEKEREEMMAASGETEDTDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMVPCDRILKEAIEKKADVIGLSGLITPSLDEMIHVAKEMDRLSLKTPLLIGGATTSKTHTAVKIAPRYSSPVIHVLDASRSVVVCSQLLDEGVYEDYFEEVTEEYEDIRQEHYDSLKERHYLSLAQARDKGLHVDW-LAQPAPVRPQFLGTRVFEAYDLRRLVDFIDWKPFFDVWQLRGKYPNRGYPKIFNDKTVGVEARRVYDDAVGLLNRLINSKGLEARGVVGFWPAQSQGDDILLFADNDVTPTSTNPVATFYGLRQQAEKDSASSDP-YLCLSDFVAPLQSGVRDYVGLFAV-AVFGAEKLSRDFERKGDDYSSIMVKALADRLAEAFAEELHARVRRELWGYSNEGDLPASELHKLRYAGIRPAAGYPSQPDHTEKRTMWSLANIQEKTGIGL-TESLAMTPAAAVSGLYFSNPKSSYFAVGKITKEQVEDYARRKEISVSEAERWLAPNLGYDTD 1230          
BLAST of Methionine synthase vs. Ensembl Cavefish
Match: zgc:172121 (homocysteine S-methyltransferase YbgG-like [Source:NCBI gene;Acc:103040478])

HSP 1 Score: 62.3882 bits (150), Expect = 7.741e-10
Identity = 74/325 (22.77%), Postives = 141/325 (43.38%), Query Frame = 3
Query:   63 LRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAIL------ARKACDLVSSKSGISR----FVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETI---SANTTSFVICYPNAG--LPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIK 992
            +  + +ILDG + T     +LEE   RG   ++ P      +  +  T P  + ++H  FL SG+D+I T T+  T     +   +H+  K      +L      A+    L ++    +      VAG++GP    L+            ++ ++L   ++ Q   L+    D++ +ETI      +A V  L E           ++S +  D    +   + ++A   +    + + +G+NC+   S + P +E+     A   S+V+ YPN+G       G   ++  +T E+ +++ + G + I GGCC T PA I  ++
Sbjct:    1 MTSKPLILDGGLAT-----ELEE---RGFYLQEDPLW----SAKVLYTDPQAIKDVHYRFLQSGSDVITTATYQAT----LEGFFKHLKLKPEQAEELLISGVQIAKDTAALFTTNCTAADRAVPLVAGSVGPYGAFLNDGSEYTGNYQSQMSVEELKDWHRPQVRCLVAAEADLIALETIPCLKEVEALVGLLREF-----PNTKAWMSFSCKDTQCISGGNKFSQAVELAARSTQLVAVGVNCS-APSLVTPLLESAKSQKAPNMSWVV-YPNSGEEWDPKKGWKSKRMSFT-ELSAEWKEQGALWI-GGCCRTGPADITELR 300          
BLAST of Methionine synthase vs. Ensembl Sea Lamprey
Match: mtr (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-031001-5])

HSP 1 Score: 921.768 bits (2381), Expect = 0.000e+0
Identity = 441/727 (60.66%), Postives = 548/727 (75.38%), Query Frame = 3
Query:   36 NIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGL--EHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKCHV---RPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSAR 2201
            +++ +L S LRERIM+LDG MGTMIQ ++L E DFRG+ F++H + L+GNNDLLS+T+PD+++ IH+E+L +GADIIETNTFSGT+IAQADYGL   H+ Y+LN  SA LA++A   V +++G+ RFVAGA+GPTN+TLS+SPSVEKPE+RN+ FD+LV AY EQA  LLDGG DI+L+ETIFDTANAKAA+FAL  +FE      P+F+SGTIVDKSGR LSGQT EAF+ S+SH +P+C+GLNCALGA+DMRPF+E I   T+SFVICYPNAGLPNTFG YDE PE T   L  FA+DGL+NIVGGCCGTTPAHI +   + +G  P                                         RRF +LI   KYEEAL+IAK QVE+GAQ++D+NMDE ML G  AM  F  LI+SEPDI+KVPLCIDSSNFAVIEAGLKC QGKC+VNS+SLKEGE DF  K ++++++GAA+V+MAFDE GQA D DRK+ IC R Y LL   + FNPNDIIFD NILTI TGMEEHN Y + ++ A   +K  LP A+VSGG+SN+SFSFRG E +REAMH VFL+HAIK+G++MGIVNAGCLPVYDDI+  LL++CE ++WN+  +ATD+LL+YA+  L +         D WRS SV  RL+++LVKG++K+++EDTEEAR  HV   RPLH+IEGPLM GM  VGDLFG GKMFLPQV +  R
Sbjct:   17 SLRELLPSVLRERIMVLDGGMGTMIQRHQLAEEDFRGDAFREHSRPLQGNNDLLSITRPDVIYGIHREYLLAGADIIETNTFSGTSIAQADYGLGLAHVAYELNKASAELAKRAAKDVGAETGVRRFVAGAMGPTNKTLSVSPSVEKPEFRNLAFDELVQAYMEQARGLLDGGADIMLVETIFDTANAKAALFALQLLFEAEFEPKPIFVSGTIVDKSGRTLSGQTGEAFVISVSHTQPMCLGLNCALGAADMRPFVEAIGKATSSFVICYPNAGLPNTFGDYDETPEITAGHLKSFAQDGLVNIVGGCCGTTPAHIKSPSPSAKGARP----------------------------------------FRRFAKLITAGKYEEALAIAKSQVESGAQILDINMDEAMLNGVEAMAHFCKLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCVVNSVSLKEGEADFLEKARVVRRYGAALVVMAFDEIGQATDADRKLEICSRSYQLLTRLVGFNPNDIIFDPNILTIATGMEEHNLYAITYMEAARRIKATLPGARVSGGLSNLSFSFRGMEAIREAMHGVFLYHAIKSGLEMGIVNAGCLPVYDDIDRDLLDMCEKLIWNRDPEATDKLLQYAQ--LHTKGCKKAVQSDEWRSGSVESRLQYALVKGVEKFVVEDTEEARLDHVKYTRPLHIIEGPLMSGMKVVGDLFGQGKMFLPQVRRGRR 701          
BLAST of Methionine synthase vs. Ensembl Yeast
Match: SAM4 (S-adenosylmethionine-homocysteine methyltransferase; functions along with Mht1p in the conversion of S-adenosylmethionine (AdoMet) to methionine to control the methionine/AdoMet ratio; SAM4 has a paralog, YMR321C, that arose from a single-locus duplication [Source:SGD;Acc:S000006194])

HSP 1 Score: 51.9878 bits (123), Expect = 2.582e-7
Identity = 79/337 (23.44%), Postives = 141/337 (41.84%), Query Frame = 3
Query:   69 ERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTN----RTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSIS----HIKP--ICIGLNCALGASDMRP-FIETISANTTSF-VICYPNAG----------LPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYS 1013
            +++++LDG  GT ++   ++       ++   P +        S     IV  +  +FL++GA+I+ T T+  +  + +    E+   +   E   L  +  D   +  G  +++ G IGP      R  +     E PE  NI F Q      E  +   +  +D++  ETI +    KA +      ++E+    P +I G  V + G    G T E     I      I P    +G+NC   + +  P  +E++     +  ++ YPN+G          LPN+     +K      ++ Q+   G   I+GGCC T+P  I  I  AV+ Y+
Sbjct:   15 KKVLVLDGGQGTELENRGIK---VANPVWSTIPFISESFWSDESSANRKIVKEMFNDFLNAGAEILMTTTYQTSYKSVS----ENTPIRTLSEYNNLLNRIVDFSRNCIGEDKYLIGCIGPWGAHICREFTGDYGAE-PE--NIDFYQYFKPQLENFNK--NDKLDLIGFETIPNIHELKAIL-----SWDESILSRPFYI-GLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV--SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNS-----DKLNSWDTVVKQYISSG-ARIIGGCCRTSPKDIQEISAAVKKYT 325          
BLAST of Methionine synthase vs. Ensembl Nematostella
Match: EDO35691 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKT1])

HSP 1 Score: 1461.82 bits (3783), Expect = 0.000e+0
Identity = 756/1247 (60.63%), Postives = 927/1247 (74.34%), Query Frame = 3
Query:   78 MILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEAR---KCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEP---QYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLF-GLRQQEERE----DPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLK-PERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETD 3782
            MI DG MGTMIQ   LEE DFRGE FK+HPK L+GNNDLLS+TKPD + +IHK +L++GAD +ETNTFSGT IAQADYGLE   Y+LN  SA +A++A   V++ +G+ +FVAGA+GPTNRTLSISP+VE P +RN+TFD+LV AY EQA  LLDGGVD+LL+ETIFDTANAKAA+FA+ ++FE+    VPVF+SGTIVDKSGR LSGQTTE+F+ S+SH  P+CIGLNCALGA +MRPFIE +  NT ++ ICYPNAGLPNTFG YDE PE   + L              CCGTTP HI AI +AVR Y PR+ P  L  D L L GLE   INP + LFVNIGERCNVAGSR F +LIK  K++                                               VPLCIDSSNF VIEAGLKC QGKCIVNSISLK GE DF  K +IIK++GAAVV+MAFDEQGQAAD +RK+ IC R Y+LLV +  F PNDIIFD NILT+ TGMEEHN YG  FI+AT  +K+ LP A+VSGG+SN SFSFRG + +REAMHSVFL+HAIKAG+DM IVNAG LPVYDDIE  LLELCED+LWN+  +AT++LL+ A+++        +   D WR  +V ERLE +LVKGIDKY+IEDTEEAR     + RPL+VIEGPLM+GM  VGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFMEEE+++ +   G   +     +Y GT+V+ATVKGDVHDIGKNIVGVV+GCNNYRVIDLGVM   EKILQ A+EE+AD+IGLSGLITPSL+EM+HVA+EMER G++ PLLIGGATTSR HTAVKIAP+YS PT+HVLDASKSVVV ++L+D     +F E + EEYEEIR++HY+SL ER YLSI++AR++K  +++ +D F+  +P FLG K+ E+ D+  ++PYIDWKPFFDVWQLRGKYPNRGYPKIFNDK VG+EA+ +++DAQ +L  +++ K L   G + F+PA+SEGDD+ ++D D    NR      +F GLRQQ E+E    DP Y CISDFIAP +SG  DYVG FAVT  +GA++LA+++Q++ DDY+ +MVKALADR+ EA AE LH  VR   WGY   E+L  +D  ++ Y GIRPA GYP+QPDH+E+ T+W L+   E  GI L  +SL M PAASVSGLYFSHP+S YF+VGKI +DQ+ +YA RK   +   EK L S LSY+ +
Sbjct:    1 MIFDGGMGTMIQKLHLEEADFRGEEFKNHPKSLKGNNDLLSITKPDAILDIHKGYLEAGADFVETNTFSGTKIAQADYGLEDAAYRLNRASAEVAKRAAYEVTASTGVEKFVAGAMGPTNRTLSISPTVECPGFRNVTFDELVDAYTEQARGLLDGGVDVLLVETIFDTANAKAALFAIDQLFEKEYSPVPVFVSGTIVDKSGRTLSGQTTESFVISVSHSSPMCIGLNCALGAVEMRPFIEAVGMNTEAYTICYPNAGLPNTFGDYDETPETMAKHLK-----------ARCCGTTPEHIRAIAEAVRPYKPRMRPEDLHSDALSLCGLESMRINP-SVLFVNIGERCNVAGSRMFCKLIKNGKFQ-----------------------------------------------VPLCIDSSNFDVIEAGLKCAQGKCIVNSISLKNGEEDFLDKARIIKRYGAAVVVMAFDEQGQAADCERKVEICTRSYNLLVKEAHFEPNDIIFDPNILTVATGMEEHNNYGKYFIQATRIIKETLPGARVSGGLSNFSFSFRGMDAIREAMHSVFLYHAIKAGLDMAIVNAGALPVYDDIEKNLLELCEDLLWNRDPEATEKLLQLAQSM--GPGAKKVTITDEWRHGNVEERLEFALVKGIDKYVIEDTEEARVNTDRYPRPLNVIEGPLMKGMGVVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEEERQMRLANGGGVGDSSLKNKYNGTIVLATVKGDVHDIGKNIVGVVLGCNNYRVIDLGVMTACEKILQTAIEEEADIIGLSGLITPSLDEMIHVAKEMERQGLKIPLLIGGATTSRTHTAVKIAPRYSEPTIHVLDASKSVVVCSALMDKGARDDFVEEVSEEYEEIREDHYDSLKERRYLSIEKAREKKAFVDF-VD-FRPVKPTFLGIKVFEDYDLEKIIPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKTVGEEARRVYNDAQTMLNNVLRDKTLRAVGELAFFPANSEGDDVYVFDEDD---NRTGEPRAVFCGLRQQAEKEHGVTDP-YYCISDFIAPRDSGIKDYVGCFAVTC-LGAEALAEEYQNELDDYSVIMVKALADRIVEAFAEELHEQVRKHYWGYCGEESLDTKDLHRIRYQGIRPAFGYPSQPDHTEKLTMWGLMNCEESTGIKL-TESLAMDPAASVSGLYFSHPESCYFAVGKICQDQIQEYANRKDKPVQVMEKWLSSALSYDAE 1178          
BLAST of Methionine synthase vs. Ensembl Nematostella
Match: EDO25701 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVQ8])

HSP 1 Score: 395.201 bits (1014), Expect = 1.305e-127
Identity = 187/309 (60.52%), Postives = 237/309 (76.70%), Query Frame = 3
Query:   57 STLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACD-LVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHI 980
            S L+ERI++LDGAMGTMIQ + LEE DFR   F++H K L+GNNDLLSLT+PDI+  IH  + ++GADI ETNTFSGT IAQADY LE  VY +N+ SA +AR+  D   + +    RFVAG++GPTNRT SISP V  P YR ITF++LVTAYK+QA+AL+DGGVD+LL+ET+FDT NAKAA+FA+ EV+EE    +P+ +SGTI D+SGR L+GQTTEAFL SISH+  + +GLNCALGAS MRP+++ +       V  +PNAGLPN FG YDE  E   E + +F ++GL+NI+GGCCGTTPAHI
Sbjct:    6 SILKERILVLDGAMGTMIQRHALEEEDFRRGWFENHHKPLKGNNDLLSLTRPDIIKEIHSLYFEAGADIAETNTFSGTTIAQADYDLEDAVYDINFHSAKIAREVADEFTAREPHKPRFVAGSMGPTNRTASISPDVNDPGYRAITFNELVTAYKQQANALIDGGVDLLLVETVFDTLNAKAALFAIDEVYEERNVNLPIMVSGTITDQSGRTLTGQTTEAFLISISHMNLLTVGLNCALGASMMRPYLQILDKKAPFGVSAHPNAGLPNEFGEYDETAEMMAEQIKEFLEEGLVNIIGGCCGTTPAHI 314          
BLAST of Methionine synthase vs. Ensembl Nematostella
Match: EDO25545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DW65])

HSP 1 Score: 169.474 bits (428), Expect = 1.073e-48
Identity = 78/141 (55.32%), Postives = 109/141 (77.30%), Query Frame = 3
Query:   45 SVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARK-ACDLVSSKSGISRFVAGAIGPTNRTLSISPSV 464
            S ++  L++RI++LDGAMGTM+Q +K  E DFRGE FK++   L+GNNDLLS+T+P+ V  +H+++  +GADI+ETNTFSGT IA ADY LE +VY+LNY+SA +A++ A +  + +    RFVAG+IGPTNRT S+SP V
Sbjct:    2 SNIYQELQKRILVLDGAMGTMLQEFKFTEEDFRGERFKEYSTPLQGNNDLLSITQPEAVKEVHRKYFAAGADIVETNTFSGTTIAMADYQLEELVYELNYQSAKIAKEVANEFTAKEPHKPRFVAGSIGPTNRTASMSPDV 142          
BLAST of Methionine synthase vs. Ensembl Nematostella
Match: EDO48828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIN5])

HSP 1 Score: 68.1662 bits (165), Expect = 7.378e-12
Identity = 78/308 (25.32%), Postives = 134/308 (43.51%), Query Frame = 3
Query:  210 PDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRN--LSGQTTEAFLTSISHIKPICIGLNCALGASD-------MRPFIETISANTTSFV----ICYPNAGLPNTFGAYDE-----KPEYTGEILS-QFAKDGL---INIVGGCCGTTPAHIAAIKKAVRGYSPRIPP----TTLFEDCLV 1055
            P+ V  +H+EFL +GAD+I+  TF+         G  +   ++++  +ILA++  D      G     +G++  T  +L I     K E +          +++Q    +D G+D+L+ E I     A+  V    EV +E+G   PV ++  I  +  R+  L G+     + + + I    IG+NC             M+  I+     T   V       P+AG P+ F +  E     +P     I + +FA+      +  +GGCCG  P HI A+ K +     R+PP    + L+ + LV
Sbjct:   47 PEAVRQLHREFLRAGADVIQAFTFAMQDKPLVSAGYSYKWDEISHAGSILAKEVSD-----EGEFALSSGSLCETG-SLFIKGLASKEEIKQ--------RFRDQVKIFVDTGMDLLIAEYISHVQEAEWMV----EVMKESGK--PVAVTMAISREGDRHGVLPGECAVRLVRAGADI----IGVNCRFDPERSLDTIALMQEAIQREGLKTHWMVQPLGYWCPDAG-PSGFTSIPECTLALEPRVLTRIEAHKFARKAYNMGVRYIGGCCGFEPYHIRALAKELSKERGRLPPGSDKSCLWGEALV 329          
BLAST of Methionine synthase vs. Ensembl Nematostella
Match: EDO48830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIN7])

HSP 1 Score: 60.4622 bits (145), Expect = 1.896e-9
Identity = 83/347 (23.92%), Postives = 145/347 (41.79%), Query Frame = 3
Query:   69 ERIMILDGAMGTMIQTYKLEENDF-RGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRN--ITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRN--LSGQTTEAFLTSISHIKPICIGLNCALGASD-------MRPFIETISANTTSFV----ICYPNAGLPNTFGAYDEKPEYTGEIL------SQFAKDGL---INIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTT 1034
            E ++I DG M     TY LE   + +  ++   P+ +  N        P+ V  +H+EFL +GAD+I+  TF+         G  +   ++++  ++LA+         SG   F A A G    T S+        +R    + +++   +++Q    +D G+D+++ E I     A+  V    EV +E+G  +P  +S  I  +   +  L G+     + + + I    IG+NC             M+  I+     T   V       P+AG P+ F +  E P      L       +FA+      +  +GGCCG  P HI A+ + +     R PP +
Sbjct:    6 EEVIIGDGGM-----TYALERRGYVKAGVWT--PECVMEN--------PEAVQQLHREFLRAGADVIQAFTFAMQDKPLVSAGYSYKWNEISHAGSLLAKGV-------SGEGEF-ALASGSLCETGSL--------FRKGLASKEEIQQRFRDQVQIFVDTGMDLIIAEYISHVQEAEWMV----EVIKESG--MPTAVSLAISREGDHHGVLPGECALRLVRAGADI----IGVNCRFDPERSLDTIALMQEAIQREGLKTHWMVQPVGYWVPDAG-PSGFTSIPENPLALEPRLMTRIEAHKFARKAYNMGVRYIGGCCGFEPYHIRAVAEELAKERGRFPPGS 310          
BLAST of Methionine synthase vs. Ensembl Medaka
Match: mtr (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:NCBI gene;Acc:101155968])

HSP 1 Score: 1617.44 bits (4187), Expect = 0.000e+0
Identity = 799/1260 (63.41%), Postives = 998/1260 (79.21%), Query Frame = 3
Query:   30 RKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKC---HVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEEREDPN---YLCISDFIAPIESGCDDYVGMFAVTAGI-GADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLK-PERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETDE 3785
            R  +++ L + L++RI++LDG MGTMIQ  +L+E DFRGE FK HP  L GNNDLLS+T+PD+++ IHKE+L +GADI+ETNTFS T+IAQADYGLEHM Y LN  SA LARKA D V+ ++G+ RFVAGA+GPTN+TLS+SPSVE+P++RNITFD+LV AY +QA  LLDGG DILL+ETIFD+ANAKAA+FA+  +FE+     P+FISGTIVD+SGR LSGQT EAF+ S+SH KP+CIGLNCALGA++MRPFIE I  NTT+F+ICYPNAGLPNTFG YDE PE T   L  FA DGL+N+VGGCCGTTP+HI AI +AV+   PR+PPT ++ED L+LSGLE F I   T  FVNIGERCNVAGSR+F +LI    YEEALSIAK QVE GAQ++D+NMDEGMLEG  AM +F N I+SEPDI++VPLCIDSSNFAVIEAGLKC QGKCIVNSISLKEGE +F  +   +K++GAA+V+MAFDE+GQA + +RKI IC R Y LLVN++ F+PNDIIFD NILTIGTGMEEHN Y ++FI+AT  +K+ LP A+VSGG+SN+SFSFRG E VREAMH VFL+HAIK GMDMGIVNAG LPVYDDI+  LL LCE+++WN+  DAT++LL YA+N++K     +++T D WR +SV ERLE++LVKGI+KY++ED EE +     + RP+H+IEGPLM GM  VGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFME+E+   M  SG       Y GT+++ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P ++IL+ A+  KAD+IGLSGLITPSL+EM++VA+EMERLGMR PLLIGGATTS++HTAVKIAP+YS P +HVLDAS+SVVV + LLD+T  +++ E ++EEYEE+R EHY+SL +R YLS+ EAR++ L L+WS        P FLG+++ E  D++ LL +IDWKPFFDVWQLRGKYPNRG+PKIFNDK VG EA+ LF +AQ +L ++I    L   G++GF+ A S+GDDI LY+           + T  GLRQQ E++  +   YLC+SDF+AP++S   DYVGMFAV  GI GA+ L+Q+F  Q DDY+S+MVKALADRLAEA AE LH  VR  LW YS  E L   D  ++ Y GIRPA GYP+QPDH+E+ T+W+L    E+ GI L  +SL M+PAASVSGLYFS+P++ YF+VGKI+K+QV DYA+RK++S+ E E+ L  IL YE ++
Sbjct:   18 RPQLEAELRALLQQRILVLDGGMGTMIQQQQLDEGDFRGEEFKAHPLPLNGNNDLLSITRPDVIYKIHKEYLLAGADIVETNTFSSTSIAQADYGLEHMAYLLNRRSAELARKAADDVTKQTGVKRFVAGALGPTNKTLSVSPSVERPDFRNITFDELVEAYSDQARGLLDGGADILLVETIFDSANAKAALFAIDLLFEKGYERRPIFISGTIVDRSGRTLSGQTGEAFVVSVSHAKPLCIGLNCALGATEMRPFIEAIGKNTTAFIICYPNAGLPNTFGGYDETPEVTASHLKDFATDGLVNVVGGCCGTTPSHIRAISEAVKHRQPRVPPTAIYEDYLLLSGLEPFKIGSHTN-FVNIGERCNVAGSRKFAKLILAGHYEEALSIAKAQVEMGAQILDINMDEGMLEGPKAMARFCNYIASEPDIARVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEEEFLLRAATVKRYGAALVVMAFDEEGQATETNRKIQICTRAYTLLVNQVGFDPNDIIFDPNILTIGTGMEEHNNYAVNFIQATRLIKETLPRARVSGGLSNLSFSFRGMEAVREAMHGVFLYHAIKDGMDMGIVNAGSLPVYDDIDKELLLLCENLIWNRDADATEKLLAYAQNIVKGGK-KVVQT-DEWREVSVEERLEYALVKGIEKYVVEDVEECQAQVSRYKRPIHIIEGPLMNGMKMVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKERLELMAASGSAEETSPYQGTILLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMVPCDQILRAAVAHKADIIGLSGLITPSLDEMIYVAKEMERLGMRVPLLIGGATTSKRHTAVKIAPRYSCPVIHVLDASRSVVVCSQLLDETMKEDYFEELKEEYEEVRLEHYDSLKDRRYLSLSEARQKALHLDWS-SMPAPVLPQFLGTRVFECYDLHRLLDFIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGPEARRLFDEAQLMLSDMIDSGTLKGRGLVGFWRAQSDGDDIHLYNHSERVGVDTRPVATFHGLRQQAEKDGASSEPYLCLSDFVAPVDSNVADYVGMFAV--GIFGAEELSQQFLAQRDDYSSIMVKALADRLAEAFAEELHARVRKELWAYSTEEALQASDLHRLRYQGIRPAAGYPSQPDHTEKITMWNLAAVEEKTGIAL-TESLAMTPAASVSGLYFSNPQASYFAVGKITKEQVEDYARRKEMSVEEVERWLAPILGYEQED 1270          
BLAST of Methionine synthase vs. Ensembl Medaka
Match: mtr (5-methyltetrahydrofolate-homocysteine methyltransferase [Source:NCBI gene;Acc:101155968])

HSP 1 Score: 1587.01 bits (4108), Expect = 0.000e+0
Identity = 790/1260 (62.70%), Postives = 988/1260 (78.41%), Query Frame = 3
Query:   30 RKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKC---HVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEEREDPN---YLCISDFIAPIESGCDDYVGMFAVTAGI-GADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLK-PERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETDE 3785
            R  +++ L + L++RI++LDG MGTMIQ  +L+E DFRGE FK HP  L GNNDLLS+T+PD+++ IHKE+L +GADI+ETNTFS T+IAQADYGLEHMV   ++ S  L       +  K    RFVAGA+GPTN+TLS+SPSVE+P++RNITFD+LV AY +QA  LLDGG DILL+ETIFD+ANAKAA+FA+  +FE+     P+FISGTIVD+SGR LSGQT EAF+ S+SH KP+CIGLNCALGA++MRPFIE I  NTT+F+ICYPNAGLPNTFG YDE PE T   L  FA DGL+N+VGGCCGTTP+HI AI +AV+   PR+PPT ++ED L+LSGLE F I   T  FVNIGERCNVAGSR+F +LI    YEEALSIAK QVE GAQ++D+NMDEGMLEG  AM +F N I+SEPDI++VPLCIDSSNFAVIEAGLKC QGKCIVNSISLKEGE +F  +   +K++GAA+V+MAFDE+GQA + +RKI IC R Y LLVN++ F+PNDIIFD NILTIGTGMEEHN Y ++FI+AT  +K+ LP A+VSGG+SN+SFSFRG E VREAMH VFL+HAIK GMDMGIVNAG LPVYDDI+  LL LCE+++WN+  DAT++LL YA+N++K     +++T D WR +SV ERLE++LVKGI+KY++ED EE +     + RP+H+IEGPLM GM  VGDLFGAGKMFLPQVIKSARVMK+AVG+LIPFME+E+   M  SG       Y GT+++ATVKGDVHDIGKNIVGVV+GCNN+RVIDLGVM P ++IL+ A+  KAD+IGLSGLITPSL+EM++VA+EMERLGMR PLLIGGATTS++HTAVKIAP+YS P +HVLDAS+SVVV + LLD+T  +++ E ++EEYEE+R EHY+SL +R YLS+ EAR++ L L+WS        P FLG+++ E  D++ LL +IDWKPFFDVWQLRGKYPNRG+PKIFNDK VG EA+ LF +AQ +L ++I    L   G++GF+ A S+GDDI LY+           + T  GLRQQ E++  +   YLC+SDF+AP++S   DYVGMFAV  GI GA+ L+Q+F  Q DDY+S+MVKALADRLAEA AE LH  VR  LW YS  E L   D  ++ Y GIRPA GYP+QPDH+E+ T+W+L    E+ GI L  +SL M+PAASVSGLYFS+P++ YF+VGKI+K+QV DYA+RK++S+ E E+ L  IL YE ++
Sbjct:   12 RPQLEAELRALLQQRILVLDGGMGTMIQQQQLDEGDFRGEEFKAHPLPLNGNNDLLSITRPDVIYKIHKEYLLAGADIVETNTFSSTSIAQADYGLEHMVRCTHHSSPRLTNADSLTICVK----RFVAGALGPTNKTLSVSPSVERPDFRNITFDELVEAYSDQARGLLDGGADILLVETIFDSANAKAALFAIDLLFEKGYERRPIFISGTIVDRSGRTLSGQTGEAFVVSVSHAKPLCIGLNCALGATEMRPFIEAIGKNTTAFIICYPNAGLPNTFGGYDETPEVTASHLKDFATDGLVNVVGGCCGTTPSHIRAISEAVKHRQPRVPPTAIYEDYLLLSGLEPFKIGSHTN-FVNIGERCNVAGSRKFAKLILAGHYEEALSIAKAQVEMGAQILDINMDEGMLEGPKAMARFCNYIASEPDIARVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEEEFLLRAATVKRYGAALVVMAFDEEGQATETNRKIQICTRAYTLLVNQVGFDPNDIIFDPNILTIGTGMEEHNNYAVNFIQATRLIKETLPRARVSGGLSNLSFSFRGMEAVREAMHGVFLYHAIKDGMDMGIVNAGSLPVYDDIDKELLLLCENLIWNRDADATEKLLAYAQNIVKGGK-KVVQT-DEWREVSVEERLEYALVKGIEKYVVEDVEECQAQVSRYKRPIHIIEGPLMNGMKMVGDLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKERLELMAASGSAEETSPYQGTILLATVKGDVHDIGKNIVGVVLGCNNFRVIDLGVMVPCDQILRAAVAHKADIIGLSGLITPSLDEMIYVAKEMERLGMRVPLLIGGATTSKRHTAVKIAPRYSCPVIHVLDASRSVVVCSQLLDETMKEDYFEELKEEYEEVRLEHYDSLKDRRYLSLSEARQKALHLDWS-SMPAPVLPQFLGTRVFECYDLHRLLDFIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGPEARRLFDEAQLMLSDMIDSGTLKGRGLVGFWRAQSDGDDIHLYNHSERVGVDTRPVATFHGLRQQAEKDGASSEPYLCLSDFVAPVDSNVADYVGMFAV--GIFGAEELSQQFLAQRDDYSSIMVKALADRLAEAFAEELHARVRKELWAYSTEEALQASDLHRLRYQGIRPAAGYPSQPDHTEKITMWNLAAVEEKTGIAL-TESLAMTPAASVSGLYFSNPQASYFAVGKITKEQVEDYARRKEMSVEEVERWLAPILGYEQED 1260          
BLAST of Methionine synthase vs. Ensembl Medaka
Match: zgc:172121 (homocysteine S-methyltransferase [Source:NCBI gene;Acc:101164391])

HSP 1 Score: 70.0922 bits (170), Expect = 3.239e-12
Identity = 82/334 (24.55%), Postives = 147/334 (44.01%), Query Frame = 3
Query:   66 RERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISR-------------FVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTT---SFVICYPNAGL----PNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRG 1007
            R R +ILDG + T ++ +  +    +G+      +LL         T P  + + H  FL SGAD+I T T+  +        ++  V  L     + A +A +L+ S   ++R              VAG+IG     L  +          +T D+L   ++ Q   LL  G D+L  ETI     A A V  L E  + + +     +S ++ D++  +      EA   +    + + +G+NC    + + P +++ S+  +   S+V+ YPN+G        + A  E   +  E+  ++ K G   ++GGCC  +PA IA ++K ++G
Sbjct:   13 RNRPLILDGGLATELEAHGAQ---LQGDPLWS-ARLLH--------TNPKAIKDAHHRFLLSGADVITTATYQAS--------VQGFVTHLG----MSAERAKELLMSGVHLAREVVKNFGSGNTGPLVAGSIGSYGAYLHDTSEYTGTFAEKMTVDELKDWHRPQVEGLLAAGADLLAFETIPSIKEADAVVELLREFPDSSAW-----LSFSVKDETRISDGSPFAEAVRVASRSAQLLAVGVNCC-SPTVVEPLLDSASSQLSPDMSWVV-YPNSGWEYDSQQGWQARGESSIWIPELSRRWVKQGAA-LIGGCCCISPAEIAELRKVLKG 314          
BLAST of Methionine synthase vs. Ensembl Medaka
Match: zgc:172121 (homocysteine S-methyltransferase [Source:NCBI gene;Acc:101164391])

HSP 1 Score: 52.373 bits (124), Expect = 1.634e-6
Identity = 77/327 (23.55%), Postives = 137/327 (41.90%), Query Frame = 3
Query:   66 RERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISR-------------FVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTT---SFVICYPNAGL----PNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAA 986
            R R +ILDG + T ++ +  +    +G+      +LL         T P  + + H  FL SGAD+I T T+  +        ++  V  L     + A +A +L+ S   ++R              VAG+IG     L  +          +T D+L   ++ Q   LL  G D+L  ETI     A A V  L E  + + +     +S ++ D++  +      EA   +    + + +G+NC    + + P +++ S+  +   S+V+ YPN+G        + A  E   +  E+  ++ K G   I    C   P+ IA+
Sbjct:   13 RNRPLILDGGLATELEAHGAQ---LQGDPLWS-ARLLH--------TNPKAIKDAHHRFLLSGADVITTATYQAS--------VQGFVTHLG----MSAERAKELLMSGVHLAREVVKNFGSGNTGPLVAGSIGSYGAYLHDTSEYTGTFAEKMTVDELKDWHRPQVEGLLAAGADLLAFETIPSIKEADAVVELLREFPDSSAW-----LSFSVKDETRISDGSPFAEAVRVASRSAQLLAVGVNCC-SPTVVEPLLDSASSQLSPDMSWVV-YPNSGWEYDSQQGWQARGESSIWIPELSRRWVKQGAALIGTMSCSPFPSAIAS 308          
BLAST of Methionine synthase vs. Planmine SMEST
Match: SMESG000054393.1 (SMESG000054393.1)

HSP 1 Score: 2532.29 bits (6562), Expect = 0.000e+0
Identity = 1251/1254 (99.76%), Postives = 1253/1254 (99.92%), Query Frame = 3
Query:   27 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTXXXXXXXXXXXXXXXXXXXXXXSLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTTLFGLRQQEEREDPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYETDEY 3788
            MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTKHQEFEENIQEEYEEIRKEHYESLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPA+SEGDDIL+YDPDSFNVNRKNHLTTLFGLRQQEEREDPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQV DYAKRKQISIGESEKRLQSILSYETDEY
Sbjct:    1 MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLLRGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHMVYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPEYRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVFEEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALGASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAKDGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERFIINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQVIDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKCTQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRKIAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATEFVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIVNAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGILKTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKCHVRPLHVIEGPLMRGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSGIYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSEKILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATTSRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTKHQEFEENIQEEYEEIRKEHYESLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVENIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSDAQKVLFEIIQYKLLHVNGVIGFYPANSEGDDILIYDPDSFNVNRKNHLTTLFGLRQQEEREDPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQKFQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDYIKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPERIGINLHKDSLGMSPAASVSGLYFSHPKSKYFSVGKISKDQVCDYAKRKQISIGESEKRLQSILSYETDEY 1254          
The following BLAST results are available for this feature:
BLAST of Methionine synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTR0.000e+063.545-methyltetrahydrofolate-homocysteine methyltransf... [more]
MTR0.000e+060.675-methyltetrahydrofolate-homocysteine methyltransf... [more]
MTR0.000e+060.685-methyltetrahydrofolate-homocysteine methyltransf... [more]
MTR1.607e-15865.035-methyltetrahydrofolate-homocysteine methyltransf... [more]
MTR3.785e-10764.665-methyltetrahydrofolate-homocysteine methyltransf... [more]
back to top
BLAST of Methionine synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
metr-10.000e+060.86Probable methionine synthase [Source:UniProtKB/Sw... [more]
back to top
BLAST of Methionine synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG106237.690e-1126.21gene:FBgn0032727 transcript:FBtr0344844[more]
CG106237.690e-1126.21gene:FBgn0032727 transcript:FBtr0344845[more]
CG106237.690e-1126.21gene:FBgn0032727 transcript:FBtr0081190[more]
CG106218.692e-621.47gene:FBgn0032726 transcript:FBtr0081191[more]
CG106218.692e-621.47gene:FBgn0032726 transcript:FBtr0342926[more]
back to top
BLAST of Methionine synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mtr1.496e-5865.155-methyltetrahydrofolate-homocysteine methyltransf... [more]
zgc:1721211.285e-1124.73zgc:172121 [Source:ZFIN;Acc:ZDB-GENE-030131-9545][more]
zgc:1721211.285e-1124.73zgc:172121 [Source:ZFIN;Acc:ZDB-GENE-030131-9545][more]
zgc:1721211.285e-1124.73zgc:172121 [Source:ZFIN;Acc:ZDB-GENE-030131-9545][more]
back to top
BLAST of Methionine synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smap20.000e+063.89small ArfGAP2 [Source:Xenbase;Acc:XB-GENE-5817085][more]
smap20.000e+063.84small ArfGAP2 [Source:Xenbase;Acc:XB-GENE-5817085][more]
smap20.000e+063.94small ArfGAP2 [Source:Xenbase;Acc:XB-GENE-5817085][more]
smap20.000e+063.89small ArfGAP2 [Source:Xenbase;Acc:XB-GENE-5817085][more]
smap20.000e+061.76small ArfGAP2 [Source:Xenbase;Acc:XB-GENE-5817085][more]
back to top
BLAST of Methionine synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mtr0.000e+063.055-methyltetrahydrofolate-homocysteine methyltransf... [more]
Mtr1.143e-3864.005-methyltetrahydrofolate-homocysteine methyltransf... [more]
back to top
BLAST of Methionine synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4JIJ3|METH_BOVIN0.000e+064.13Methionine synthase OS=Bos taurus OX=9913 GN=MTR P... [more]
sp|Q99707|METH_HUMAN0.000e+063.54Methionine synthase OS=Homo sapiens OX=9606 GN=MTR... [more]
sp|Q9Z2Q4|METH_RAT0.000e+063.12Methionine synthase OS=Rattus norvegicus OX=10116 ... [more]
sp|A6H5Y3|METH_MOUSE0.000e+063.05Methionine synthase OS=Mus musculus OX=10090 GN=Mt... [more]
sp|Q09582|METH_CAEEL0.000e+060.86Probable methionine synthase OS=Caenorhabditis ele... [more]
back to top
BLAST of Methionine synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JEV60.000e+065.48Methionine synthase OS=Biomphalaria glabrata OX=65... [more]
K1P5E00.000e+064.46Methionine synthase OS=Crassostrea gigas OX=29159 ... [more]
A0A3Q1JSN20.000e+064.76Methionine synthase OS=Anabas testudineus OX=64144... [more]
A0A1S3HNR60.000e+066.75Methionine synthase OS=Lingula unguis OX=7574 GN=L... [more]
A0A3Q1ECF40.000e+064.14Methionine synthase OS=Acanthochromis polyacanthus... [more]
back to top
BLAST of Methionine synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mtr0.000e+064.595-methyltetrahydrofolate-homocysteine methyltransf... [more]
zgc:1721217.741e-1022.77homocysteine S-methyltransferase YbgG-like [Source... [more]
back to top
BLAST of Methionine synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mtr0.000e+060.665-methyltetrahydrofolate-homocysteine methyltransf... [more]
back to top
BLAST of Methionine synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAM42.582e-723.44S-adenosylmethionine-homocysteine methyltransferas... [more]
back to top
BLAST of Methionine synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356910.000e+060.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257011.305e-12760.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO255451.073e-4855.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO488287.378e-1225.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488301.896e-923.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Methionine synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mtr0.000e+063.415-methyltetrahydrofolate-homocysteine methyltransf... [more]
mtr0.000e+062.705-methyltetrahydrofolate-homocysteine methyltransf... [more]
zgc:1721213.239e-1224.55homocysteine S-methyltransferase [Source:NCBI gene... [more]
zgc:1721211.634e-623.55homocysteine S-methyltransferase [Source:NCBI gene... [more]
back to top
BLAST of Methionine synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000054393.10.000e+099.76SMESG000054393.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012817 ID=SMED30012817|Name=Methionine synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=3851bp
CGAACTTATATGTCTTTAGGTGAAATATGCGTAAAAATATTAAATCTGTA
CTTTTTTCAACTCTTCGAGAACGAATAATGATTTTAGACGGTGCTATGGG
CACTATGATCCAAACATATAAATTAGAAGAAAATGATTTTCGCGGAGAGA
TTTTTAAAGATCATCCAAAATTGCTCAGAGGAAACAATGATTTATTATCT
TTAACAAAACCTGATATAGTTTTCAATATCCACAAAGAATTTTTGGACTC
AGGTGCTGATATAATAGAAACAAACACATTTAGCGGCACAGCTATTGCTC
AAGCTGATTACGGGTTAGAACACATGGTTTATAAATTAAATTACGAAAGC
GCGATTCTGGCACGAAAGGCATGTGATTTGGTGTCATCAAAATCTGGCAT
TTCTAGATTTGTTGCGGGAGCTATTGGACCAACTAATCGTACTTTATCCA
TTTCCCCTTCAGTTGAAAAACCGGAATATCGTAATATTACATTTGATCAG
TTGGTAACTGCGTATAAAGAACAAGCTCATGCTCTTTTGGACGGAGGTGT
CGATATTTTATTAATTGAAACTATATTTGACACAGCGAATGCTAAAGCTG
CAGTATTTGCATTATTTGAAGTTTTTGAAGAGGCAGGTTATGAAGTGCCA
GTATTTATTTCTGGAACAATTGTTGACAAAAGTGGTCGTAATTTGAGTGG
TCAGACAACAGAGGCTTTTCTCACTAGTATATCACATATAAAGCCCATTT
GTATTGGATTGAATTGTGCACTTGGAGCATCTGATATGCGACCTTTTATT
GAAACAATCAGTGCAAATACAACTTCATTTGTTATATGTTATCCAAATGC
GGGATTACCAAATACATTTGGTGCATACGACGAGAAACCGGAATATACAG
GGGAAATCTTGAGTCAATTTGCTAAAGATGGATTAATAAATATTGTCGGA
GGATGTTGTGGAACCACTCCTGCCCATATTGCTGCGATTAAAAAAGCCGT
ACGTGGTTATTCTCCGCGGATACCCCCGACTACATTGTTTGAAGATTGTC
TAGTTCTATCTGGTCTAGAACGATTTATAATAAATCCACGTACAACATTA
TTTGTTAATATCGGCGAAAGATGCAATGTTGCTGGAAGTCGTCGTTTCCT
ACGACTTATCAAAACTGATAAATATGAAGAAGCTCTTTCGATTGCTAAAG
AACAAGTGGAAAACGGCGCTCAAGTAATTGATCTAAACATGGATGAAGGT
ATGCTTGAAGGAAAATTGGCAATGACCAAATTTATCAATCTAATATCCTC
TGAACCAGATATTTCCAAGGTTCCGCTTTGTATTGATTCTTCAAATTTTG
CAGTCATTGAAGCCGGTTTAAAATGTACCCAAGGAAAATGTATCGTCAAC
AGTATCAGTTTAAAAGAAGGCGAATTGGACTTTTATCGAAAATTGAAAAT
AATTAAAAAATTTGGAGCGGCTGTTGTAATAATGGCTTTTGATGAGCAAG
GCCAAGCTGCGGATTATGATAGAAAAATTGCGATTTGTTGTCGAATTTAT
GATTTACTTGTTAATAAAATGGATTTTAATCCGAATGATATTATATTTGA
TTTGAATATTTTGACTATTGGAACAGGAATGGAAGAGCATAATGGTTATG
GCATGGATTTTATCAGAGCTACGGAATTTGTTAAGAAAAATTTGCCCCAT
GCCAAAGTATCAGGAGGTGTTTCTAATATCAGTTTTTCATTTCGTGGGAA
AGAGGTTGTCAGAGAAGCAATGCATTCCGTTTTTCTGTTCCATGCAATTA
AAGCTGGAATGGATATGGGAATCGTTAATGCTGGCTGCTTACCAGTTTAT
GATGACATTGAACCCCGTTTGTTGGAGTTGTGTGAAGACATTTTGTGGAA
TAAACGACAAGACGCAACAGATAGACTACTTGAATATGCCGAAAATTTGT
TGAAATCTGATGATGTCGGAATCTTAAAAACTGAAGATGCTTGGAGATCT
CTTTCTGTATCAGAAAGATTGGAACATTCTCTTGTTAAAGGAATCGATAA
ATATATTATCGAAGATACCGAAGAAGCCAGAAAATGTCATGTTAGACCTC
TTCATGTAATTGAAGGTCCGTTGATGCGAGGAATGTCTACAGTTGGAGAT
TTATTTGGGGCTGGGAAAATGTTTCTGCCTCAAGTTATTAAGTCAGCGCG
AGTAATGAAACGTGCTGTTGGTTATCTAATTCCATTTATGGAAGAAGAAA
AAAGGTTAGCAATGGAAGTATCAGGAATCTATTCAAATGAACCACAATAT
GTTGGAACGATGGTCATTGCCACAGTTAAAGGAGATGTTCATGATATTGG
AAAAAACATTGTCGGAGTTGTCATGGGGTGCAACAATTACAGGGTTATTG
ACCTTGGTGTTATGTGCCCAAGTGAAAAAATTTTGCAATGTGCTCTTGAA
GAAAAAGCAGATGTTATTGGATTATCTGGTCTTATTACACCCTCTTTAGA
AGAAATGATGCATGTCGCTAGGGAAATGGAACGTCTGGGTATGAGAACTC
CATTGTTAATAGGAGGGGCAACAACATCTAGGCAGCACACAGCTGTCAAA
ATTGCCCCGAAATATTCGGGACCAACTGTTCATGTTTTGGATGCTTCAAA
GAGTGTTGTGGTTACAAATAGTTTGTTAGATGACACAAAACATCAGGAAT
TTGAAGAAAATATCCAAGAAGAATATGAAGAAATTCGAAAGGAACACTAT
GAATCGCTAGCAGAAAGAATTTACCTTTCAATTGACGAAGCCCGCAAGCG
AAAATTGCAGTTAAATTGGTCTATTGACCATTTCCAAAGCCATCGTCCTA
ATTTTCTTGGATCTAAAATTGTGGAAAATATTGATATTAATATTCTTTTA
CCGTATATTGATTGGAAACCATTTTTCGATGTCTGGCAGCTAAGAGGTAA
ATATCCTAATAGAGGCTATCCTAAGATTTTCAATGATAAGGATGTTGGAA
AAGAAGCACAAATATTGTTTTCTGATGCTCAAAAAGTTCTATTCGAAATC
ATTCAATATAAACTTCTGCATGTTAATGGAGTGATTGGATTTTATCCAGC
CCATTCTGAAGGCGACGATATTTTGCTTTATGATCCTGATTCTTTTAATG
TCAATCGTAAGAATCATTTGACTACTTTATTCGGTCTGAGACAACAGGAA
GAACGAGAAGATCCGAATTATTTATGTATATCAGATTTTATTGCTCCGAT
TGAAAGTGGTTGTGACGATTATGTTGGTATGTTTGCAGTGACAGCGGGCA
TCGGGGCAGATAGTTTAGCTCAAAAATTTCAAGATCAAGGAGATGATTAT
AATAGTTTAATGGTTAAAGCACTAGCTGATCGATTAGCTGAAGCATCAGC
GGAATATCTCCATCATATTGTTAGAACCACATTATGGGGTTACAGCCCAA
ATGAAAATCTAACTCCAGAAGATTATATTAAGGTAATGTATGATGGAATC
CGCCCGGCTCCTGGATATCCAACACAACCTGATCATTCTGAACAAGCAAC
TGTGTGGGATTTATTAAAACCAGAACGGATTGGAATCAATCTTCACAAGG
ATTCTTTAGGAATGTCTCCGGCTGCAAGTGTATCTGGTCTCTATTTTTCT
CACCCGAAATCTAAATATTTCTCAGTCGGAAAGATCTCTAAAGACCAAGT
ATATGATTATGCTAAAAGAAAACAAATTTCTATTGGGGAATCTGAGAAGC
GACTGCAATCTATTTTATCCTATGAAACAGATGAATATTAATTATTTGAT
TTTCTATTAAATTTTTCGAATAAATAATCTTGGTTGTTTTTTGAAAAAAA
A
back to top

protein sequence of SMED30012817-orf-1

>SMED30012817-orf-1 ID=SMED30012817-orf-1|Name=SMED30012817-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1255bp
MRKNIKSVLFSTLRERIMILDGAMGTMIQTYKLEENDFRGEIFKDHPKLL
RGNNDLLSLTKPDIVFNIHKEFLDSGADIIETNTFSGTAIAQADYGLEHM
VYKLNYESAILARKACDLVSSKSGISRFVAGAIGPTNRTLSISPSVEKPE
YRNITFDQLVTAYKEQAHALLDGGVDILLIETIFDTANAKAAVFALFEVF
EEAGYEVPVFISGTIVDKSGRNLSGQTTEAFLTSISHIKPICIGLNCALG
ASDMRPFIETISANTTSFVICYPNAGLPNTFGAYDEKPEYTGEILSQFAK
DGLINIVGGCCGTTPAHIAAIKKAVRGYSPRIPPTTLFEDCLVLSGLERF
IINPRTTLFVNIGERCNVAGSRRFLRLIKTDKYEEALSIAKEQVENGAQV
IDLNMDEGMLEGKLAMTKFINLISSEPDISKVPLCIDSSNFAVIEAGLKC
TQGKCIVNSISLKEGELDFYRKLKIIKKFGAAVVIMAFDEQGQAADYDRK
IAICCRIYDLLVNKMDFNPNDIIFDLNILTIGTGMEEHNGYGMDFIRATE
FVKKNLPHAKVSGGVSNISFSFRGKEVVREAMHSVFLFHAIKAGMDMGIV
NAGCLPVYDDIEPRLLELCEDILWNKRQDATDRLLEYAENLLKSDDVGIL
KTEDAWRSLSVSERLEHSLVKGIDKYIIEDTEEARKCHVRPLHVIEGPLM
RGMSTVGDLFGAGKMFLPQVIKSARVMKRAVGYLIPFMEEEKRLAMEVSG
IYSNEPQYVGTMVIATVKGDVHDIGKNIVGVVMGCNNYRVIDLGVMCPSE
KILQCALEEKADVIGLSGLITPSLEEMMHVAREMERLGMRTPLLIGGATT
SRQHTAVKIAPKYSGPTVHVLDASKSVVVTNSLLDDTKHQEFEENIQEEY
EEIRKEHYESLAERIYLSIDEARKRKLQLNWSIDHFQSHRPNFLGSKIVE
NIDINILLPYIDWKPFFDVWQLRGKYPNRGYPKIFNDKDVGKEAQILFSD
AQKVLFEIIQYKLLHVNGVIGFYPAHSEGDDILLYDPDSFNVNRKNHLTT
LFGLRQQEEREDPNYLCISDFIAPIESGCDDYVGMFAVTAGIGADSLAQK
FQDQGDDYNSLMVKALADRLAEASAEYLHHIVRTTLWGYSPNENLTPEDY
IKVMYDGIRPAPGYPTQPDHSEQATVWDLLKPERIGINLHKDSLGMSPAA
SVSGLYFSHPKSKYFSVGKISKDQVYDYAKRKQISIGESEKRLQSILSYE
TDEY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036589HCY_dom_sf
IPR037010VitB12-dep_Met_synth_activ_sf
IPR036594Meth_synthase_dom
IPR033706Met_synthase_B12-bd
IPR036724Cobalamin-bd_sf
IPR003759Cbl-bd_cap
IPR011822MetH
IPR003726HCY_dom
IPR004223VitB12-dep_Met_synth_activ_dom
IPR006158Cobalamin-bd
IPR000489Pterin-binding_dom
IPR011005Dihydropteroate_synth-like
Vocabulary: biological process
TermDefinition
GO:0009086methionine biosynthetic process
GO:0042558pteridine-containing compound metabolic process
GO:0044237cellular metabolic process
GO:0008652cellular amino acid biosynthetic process
GO:0032259methylation
Vocabulary: molecular function
TermDefinition
GO:0031419cobalamin binding
GO:0008705methionine synthase activity
GO:0008270zinc ion binding
GO:0008898S-adenosylmethionine-homocysteine S-methyltransferase activity
GO:0046872metal ion binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003759Cobalamin (vitamin B12)-binding module, cap domainSMARTSM01018B12_binding_2_2coord: 659..742
e-value: 5.0E-42
score: 155.6
IPR003759Cobalamin (vitamin B12)-binding module, cap domainPFAMPF02607B12-binding_2coord: 662..734
e-value: 4.6E-22
score: 78.2
IPR003759Cobalamin (vitamin B12)-binding module, cap domainPROSITEPS51337B12_BINDING_NTERcoord: 652..746
score: 35.422
IPR036589Homocysteine-binding domain superfamilyGENE3DG3DSA:3.20.20.330coord: 2..341
e-value: 3.7E-134
score: 449.2
IPR036589Homocysteine-binding domain superfamilySUPERFAMILYSSF82282Homocysteine S-methyltransferasecoord: 8..402
NoneNo IPR availableGENE3DG3DSA:1.10.288.10coord: 952..1117
e-value: 6.3E-133
score: 444.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.280coord: 758..908
e-value: 7.9E-56
score: 189.8
NoneNo IPR availablePANTHERPTHR11103:SF11coord: 7..1252
NoneNo IPR availablePANTHERPTHR11103FAMILY NOT NAMEDcoord: 7..1252
NoneNo IPR availableCDDcd00740MeTrcoord: 359..615
e-value: 3.23489E-125
score: 384.051
IPR011822Cobalamin-dependent methionine synthaseTIGRFAMTIGR02082TIGR02082coord: 14..1217
e-value: 0.0
score: 1725.3
IPR011822Cobalamin-dependent methionine synthasePIRSFPIRSF000381Met_synth_MetHcoord: 2..1220
e-value: 0.0
score: 1689.0
IPR004223Vitamin B12-dependent methionine synthase, activation domainPFAMPF02965Met_synt_B12coord: 954..1233
e-value: 3.5E-110
score: 367.8
IPR004223Vitamin B12-dependent methionine synthase, activation domainPROSITEPS50974ADOMET_ACTIVATIONcoord: 910..1252
score: 89.18
IPR011005Dihydropteroate synthase-likeGENE3DG3DSA:3.20.20.20coord: 342..645
e-value: 8.0E-131
score: 437.3
IPR011005Dihydropteroate synthase-likeSUPERFAMILYSSF51717Dihydropteroate synthetase-likecoord: 359..633
IPR037010Vitamin B12-dependent methionine synthase, activation domain superfamilyGENE3DG3DSA:3.10.196.10coord: 917..1245
e-value: 6.3E-133
score: 444.9
IPR037010Vitamin B12-dependent methionine synthase, activation domain superfamilySUPERFAMILYSSF56507Methionine synthase activation domain-likecoord: 916..1251
IPR003726Homocysteine-binding domainPFAMPF02574S-methyl_transcoord: 18..325
e-value: 8.2E-77
score: 258.6
IPR003726Homocysteine-binding domainPROSITEPS50970HCYcoord: 6..325
score: 55.444
IPR006158Cobalamin (vitamin B12)-binding domainPFAMPF02310B12-bindingcoord: 762..851
e-value: 2.3E-17
score: 63.1
IPR006158Cobalamin (vitamin B12)-binding domainPROSITEPS51332B12_BINDINGcoord: 759..894
score: 42.912
IPR036594Methionine synthase domainGENE3DG3DSA:1.10.1240.10coord: 651..739
e-value: 3.6E-38
score: 131.3
IPR036594Methionine synthase domainSUPERFAMILYSSF47644Methionine synthase domaincoord: 654..741
IPR000489Pterin-binding domainPFAMPF00809Pterin_bindcoord: 363..601
e-value: 1.3E-53
score: 182.2
IPR000489Pterin-binding domainPROSITEPS50972PTERIN_BINDINGcoord: 359..620
score: 26.152
IPR033706Methionine synthase, B12-binding domainCDDcd02069methionine_synthase_B12_BDcoord: 661..884
e-value: 2.92189E-122
score: 374.679
IPR036724Cobalamin-binding domain superfamilySUPERFAMILYSSF52242Cobalamin (vitamin B12)-binding domaincoord: 756..908