Aminomethyltransferase

Overview
NameAminomethyltransferase
Smed IDSMED30012816
Length (bp)3107
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aminomethyltransferase (SMED30012816) t-SNE clustered cells

Violin plots show distribution of expression levels for Aminomethyltransferase (SMED30012816) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aminomethyltransferase (SMED30012816) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aminomethyltransferase (SMED30012816) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012816

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30012816SMESG000012592.1 dd_Smed_v4_3994_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012816SMESG000012592.1 dd_Smed_v4_3994_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012816SMESG000012592.1 dd_Smed_v4_3994_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30012816SMESG000012592.1 dd_Smed_v4_3994_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aminomethyltransferase vs. Ensembl Human
Match: AMT (aminomethyltransferase [Source:HGNC Symbol;Acc:HGNC:473])

HSP 1 Score: 211.075 bits (536), Expect = 4.704e-60
Identity = 118/248 (47.58%), Postives = 153/248 (61.69%), Query Frame = 1
Query: 2227 KFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            + + Q +++ +E ++  L+ALQGP  A VLQ G+   L+ L F       VFG+  CRVTRCGYTGEDGVEISV  A A  LA  +L N  V   GL ARD+LRLEAGLCLYGNDIDEHTTP E SLSWT+ K R+  +      FPG   I+ Q+     + +RRVGL+   G P R+ S IL++    +G VTSGC SP+L  N+ MGY+  +Y +  T +   +R K     V K+PFV  NYY+
Sbjct:  106 ELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM-----DFPGAKVIVPQLKGR--VQRRRVGLM-CEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYT 345          
BLAST of Aminomethyltransferase vs. Ensembl Human
Match: AMT (aminomethyltransferase [Source:HGNC Symbol;Acc:HGNC:473])

HSP 1 Score: 211.075 bits (536), Expect = 5.943e-60
Identity = 118/248 (47.58%), Postives = 153/248 (61.69%), Query Frame = 1
Query: 2227 KFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            + + Q +++ +E ++  L+ALQGP  A VLQ G+   L+ L F       VFG+  CRVTRCGYTGEDGVEISV  A A  LA  +L N  V   GL ARD+LRLEAGLCLYGNDIDEHTTP E SLSWT+ K R+  +      FPG   I+ Q+     + +RRVGL+   G P R+ S IL++    +G VTSGC SP+L  N+ MGY+  +Y +  T +   +R K     V K+PFV  NYY+
Sbjct:  114 ELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM-----DFPGAKVIVPQLKGR--VQRRRVGLMC-EGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYT 353          
BLAST of Aminomethyltransferase vs. Ensembl Human
Match: AMT (aminomethyltransferase [Source:HGNC Symbol;Acc:HGNC:473])

HSP 1 Score: 210.69 bits (535), Expect = 7.693e-60
Identity = 118/249 (47.39%), Postives = 153/249 (61.45%), Query Frame = 1
Query: 2224 EKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
             + + Q +++ +E ++  L+ALQGP  A VLQ G+   L+ L F       VFG+  CRVTRCGYTGEDGVEISV  A A  LA  +L N  V   GL ARD+LRLEAGLCLYGNDIDEHTTP E SLSWT+ K R+  +      FPG   I+ Q+     + +RRVGL+   G P R+ S IL++    +G VTSGC SP+L  N+ MGY+  +Y +  T +   +R K     V K+PFV  NYY+
Sbjct:  117 RELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM-----DFPGAKVIVPQLKGR--VQRRRVGLM-CEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYT 357          
BLAST of Aminomethyltransferase vs. Ensembl Human
Match: AMT (aminomethyltransferase [Source:HGNC Symbol;Acc:HGNC:473])

HSP 1 Score: 210.69 bits (535), Expect = 1.300e-59
Identity = 118/249 (47.39%), Postives = 153/249 (61.45%), Query Frame = 1
Query: 2224 EKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
             + + Q +++ +E ++  L+ALQGP  A VLQ G+   L+ L F       VFG+  CRVTRCGYTGEDGVEISV  A A  LA  +L N  V   GL ARD+LRLEAGLCLYGNDIDEHTTP E SLSWT+ K R+  +      FPG   I+ Q+     + +RRVGL+   G P R+ S IL++    +G VTSGC SP+L  N+ MGY+  +Y +  T +   +R K     V K+PFV  NYY+
Sbjct:  134 RELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM-----DFPGAKVIVPQLKGR--VQRRRVGLM-CEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYT 374          
BLAST of Aminomethyltransferase vs. Ensembl Human
Match: AMT (aminomethyltransferase [Source:HGNC Symbol;Acc:HGNC:473])

HSP 1 Score: 210.69 bits (535), Expect = 2.639e-59
Identity = 118/248 (47.58%), Postives = 153/248 (61.69%), Query Frame = 1
Query: 2227 KFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            + + Q +++ +E ++  L+ALQGP  A VLQ G+   L+ L F       VFG+  CRVTRCGYTGEDGVEISV  A A  LA  +L N  V   GL ARD+LRLEAGLCLYGNDIDEHTTP E SLSWT+ K R+  +      FPG   I+ Q+     + +RRVGL+   G P R+ S IL++    +G VTSGC SP+L  N+ MGY+  +Y +  T +   +R K     V K+PFV  NYY+
Sbjct:  162 ELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM-----DFPGAKVIVPQLKGR--VQRRRVGLM-CEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYT 401          
BLAST of Aminomethyltransferase vs. Ensembl Celegans
Match: gcst-1 (Aminomethyltransferase [Source:UniProtKB/TrEMBL;Acc:Q22968])

HSP 1 Score: 192.2 bits (487), Expect = 2.692e-53
Identity = 114/258 (44.19%), Postives = 156/258 (60.47%), Query Frame = 1
Query: 2215 AWEEKFRKQNKNIQVEWVE-KGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISV--XXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILS-VNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSNR 2976
            AW    R + K++++E ++ +GL+A+QGP++A VLQ G D  L  L F +     VFGI  CRVTRCGYTGEDGVEISV  +KA             +V   GLGARD LRLEAGLCLYG+DI+E+TTP EA L++ + K R+  +      FPG + I+ Q+ KE    KRRVGL++  G  PRS   ++  ++   +G VTSGC SPTL  NI + Y++  + K  T+       K  P  V K+PFV  NY++ +
Sbjct:  155 AW----RSKGKDVKIETLDNRGLVAVQGPEMAKVLQEGTDIDLSKLTFMKTTVGKVFGIDGCRVTRCGYTGEDGVEISVDPTKAEQLVERLLASQAGSVKLAGLGARDALRLEAGLCLYGSDIEENTTPIEAGLAFVVAKRRRETL-----DFPGAEHIVKQL-KEKSWPKRRVGLLAPAGRCPRSHLPLIDPLDKCSIGFVTSGCPSPTLGKNIAIAYVDKSHSKIGTKFVVDFGAKQAPVEVVKMPFVPTNYFTGK 402          
BLAST of Aminomethyltransferase vs. Ensembl Celegans
Match: gcst-1 (Aminomethyltransferase [Source:UniProtKB/TrEMBL;Acc:Q22968])

HSP 1 Score: 192.2 bits (487), Expect = 2.692e-53
Identity = 114/258 (44.19%), Postives = 156/258 (60.47%), Query Frame = 1
Query: 2215 AWEEKFRKQNKNIQVEWVE-KGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISV--XXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILS-VNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSNR 2976
            AW    R + K++++E ++ +GL+A+QGP++A VLQ G D  L  L F +     VFGI  CRVTRCGYTGEDGVEISV  +KA             +V   GLGARD LRLEAGLCLYG+DI+E+TTP EA L++ + K R+  +      FPG + I+ Q+ KE    KRRVGL++  G  PRS   ++  ++   +G VTSGC SPTL  NI + Y++  + K  T+       K  P  V K+PFV  NY++ +
Sbjct:  155 AW----RSKGKDVKIETLDNRGLVAVQGPEMAKVLQEGTDIDLSKLTFMKTTVGKVFGIDGCRVTRCGYTGEDGVEISVDPTKAEQLVERLLASQAGSVKLAGLGARDALRLEAGLCLYGSDIEENTTPIEAGLAFVVAKRRRETL-----DFPGAEHIVKQL-KEKSWPKRRVGLLAPAGRCPRSHLPLIDPLDKCSIGFVTSGCPSPTLGKNIAIAYVDKSHSKIGTKFVVDFGAKQAPVEVVKMPFVPTNYFTGK 402          
BLAST of Aminomethyltransferase vs. Ensembl Fly
Match: CG6415 (gene:FBgn0032287 transcript:FBtr0080108)

HSP 1 Score: 216.468 bits (550), Expect = 1.283e-61
Identity = 124/264 (46.97%), Postives = 169/264 (64.02%), Query Frame = 1
Query: 2206 IFEAWEEKFRKQNKNIQVEWV---EKGLIALQGPKVADVLQPGL--DKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGL--ISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSNR 2976
            I +   + F+ Q K++ +E++   ++ L+A+QGP+VA  L   L    SL  LYF      ++ GIPN R+TRCGYTGEDGVEISV+ + A++L E LL +  +   GLGARD+LRLEAGLCLYG+DID  TTP EA+L+W + K R+T        FPG D I+ Q+ +   +++RRVGL  + T  PP RSG  I S   +V GQVTSGC SP+   NI MGY+        T+++F++R K+Y   V K+PFVK NYY NR
Sbjct:  148 IMKTAVDNFKSQGKDVSIEFLTPADQSLVAVQGPQVAKELSKLLTGKASLDQLYFMSSFVTTLAGIPNVRITRCGYTGEDGVEISVASSQAQKLTESLLESGVLKLAGLGARDSLRLEAGLCLYGSDIDSKTTPVEAALAWLVTKRRRTT-----RDFPGADVILGQLKE--GVSRRRVGLQMLGTKPPPARSGVAIFSQGQQV-GQVTSGCPSPSAGRNIAMGYVAENLKAPGTKVEFKVRDKLYEAEVTKMPFVKANYY-NR 402          
BLAST of Aminomethyltransferase vs. Ensembl Zebrafish
Match: amt (aminomethyltransferase [Source:ZFIN;Acc:ZDB-GENE-041010-114])

HSP 1 Score: 239.195 bits (609), Expect = 1.437e-69
Identity = 132/253 (52.17%), Postives = 165/253 (65.22%), Query Frame = 1
Query: 2209 FEAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYY 2967
             +A  ++F+    ++ +E++E+ LIALQGP +A VLQ G+   LK L F   +   VFGI  CRVTRCGYTGEDGVEISV       L EKLL++  V   GLGARD+LRLEAGLCLYGNDIDE TTP EA+L WTI K R+         FPG D I+ QI  ++P  ++RVGLIS TGPP R  + ILS +  V+G+VTSGC SP L  N+ MGY+E+ + K  T IQ  +R K  P  V K+PFV   YY
Sbjct:  163 MQARLQEFKSAGHDVDLEFMEESLIALQGPSMARVLQKGVGDDLKKLTFMTSVLTPVFGIQGCRVTRCGYTGEDGVEISVPSKEVVSLTEKLLADSEVKLAGLGARDSLRLEAGLCLYGNDIDETTTPVEATLVWTIGKRRRQA-----RDFPGADIIVPQIKAKTP--RKRVGLIS-TGPPVRQHTPILSSDGRVIGEVTSGCPSPCLKQNVAMGYVETAFSKAGTSIQVEVRKKAVPAVVSKMPFVPTKYY 407          
BLAST of Aminomethyltransferase vs. Ensembl Zebrafish
Match: amt (aminomethyltransferase [Source:ZFIN;Acc:ZDB-GENE-041010-114])

HSP 1 Score: 198.364 bits (503), Expect = 8.516e-57
Identity = 124/256 (48.44%), Postives = 147/256 (57.42%), Query Frame = 1
Query: 2293 GPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVE-------------------------------ISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYY 2967
            GP +A VLQ G+   LK L F   +   VFGI  CRVTRCGYTGEDGVE                               ISV       L EKLL++  V   GLGARD+LRLEAGLCLYGNDIDE TTP EA+L WTI K R+     DF   PG D I+ QI  ++P  ++RVGLIST GPP R  + ILS +  V+G+VTSGC SP L  N+ MGY+E+ + K  T IQ  +R K  P  V K+PFV   YY
Sbjct:   15 GPSMARVLQKGVGDDLKKLTFMTSVLTPVFGIQGCRVTRCGYTGEDGVEVSGFKLFCCCYVIGVHLCGACMSTVIFFFINISVPSKEVVSLTEKLLADSEVKLAGLGARDSLRLEAGLCLYGNDIDETTTPVEATLVWTIGKRRRQ--ARDF---PGADIIVPQIKAKTP--RKRVGLIST-GPPVRQHTPILSSDGRVIGEVTSGCPSPCLKQNVAMGYVETAFSKAGTSIQVEVRKKAVPAVVSKMPFVPTKYY 262          
BLAST of Aminomethyltransferase vs. Ensembl Zebrafish
Match: dmgdh (dimethylglycine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-080227-8])

HSP 1 Score: 54.299 bits (129), Expect = 7.718e-7
Identity = 40/147 (27.21%), Postives = 69/147 (46.94%), Query Frame = 1
Query: 2512 GLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFV 2952
            G  A ++LRLE G   +G +++  T P EA L + IK N+      DF+      +I +Q      +++R   L   T      G+E +  N EVVG  TSG +S + + ++   Y+     +   +++  + G+ Y   V K P +
Sbjct:  708 GTYAMNSLRLEKGFRAWGAEMNCDTNPLEAGLDYFIKLNKPA----DFIGKQALLEIKAQ-----GLSRRLAFLTLNTDDIDPEGNESVWHNGEVVGNTTSGSYSYSTHQSVAFAYLPVGLTQLGQKVEVELLGQKYSATVTKEPLI 845          
BLAST of Aminomethyltransferase vs. Ensembl Xenopus
Match: AMT (aminomethyltransferase [Source:NCBI gene;Acc:100491726])

HSP 1 Score: 230.335 bits (586), Expect = 7.305e-67
Identity = 125/249 (50.20%), Postives = 167/249 (67.07%), Query Frame = 1
Query: 2224 EKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            ++F+   +++ +E ++  L+A+QGP  A VLQ G++  L  L F   +Y +VFGIP CRVTRCGYTGEDGVEISV    A ELA+KLL N +V   GL ARD+LRLEAGLCLYGNDIDE T+P EASL WT+ K R+T +      FPG   I+ QI  +  +  +RVGL S TGPP R  + IL+    ++G+VTSGC SP+L +N+ MGY+E +Y K  T ++F +R K+  G   K+PFV   YY+
Sbjct:  113 QEFKAAGRDVDLEHIDCALLAVQGPLSARVLQAGMNDDLSKLPFMTSVYTAVFGIPGCRVTRCGYTGEDGVEISVPAQRAVELADKLLQNSDVKLAGLAARDSLRLEAGLCLYGNDIDETTSPVEASLVWTLGKRRRTAM-----DFPGASIIVPQIKGK--VKHKRVGLTS-TGPPVRQHAPILNQEGRIIGEVTSGCPSPSLRVNVAMGYVEPEYAKAGTAVRFEVRKKIVDGVTTKMPFVPTKYYT 353          
BLAST of Aminomethyltransferase vs. Ensembl Xenopus
Match: AMT (aminomethyltransferase [Source:NCBI gene;Acc:100491726])

HSP 1 Score: 229.95 bits (585), Expect = 2.067e-66
Identity = 125/249 (50.20%), Postives = 167/249 (67.07%), Query Frame = 1
Query: 2224 EKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            ++F+   +++ +E ++  L+A+QGP  A VLQ G++  L  L F   +Y +VFGIP CRVTRCGYTGEDGVEISV    A ELA+KLL N +V   GL ARD+LRLEAGLCLYGNDIDE T+P EASL WT+ K R+T +      FPG   I+ QI  +  +  +RVGL S TGPP R  + IL+    ++G+VTSGC SP+L +N+ MGY+E +Y K  T ++F +R K+  G   K+PFV   YY+
Sbjct:  139 QEFKAAGRDVDLEHIDCALLAVQGPLSARVLQAGMNDDLSKLPFMTSVYTAVFGIPGCRVTRCGYTGEDGVEISVPAQRAVELADKLLQNSDVKLAGLAARDSLRLEAGLCLYGNDIDETTSPVEASLVWTLGKRRRTAM-----DFPGASIIVPQIKGK--VKHKRVGLTS-TGPPVRQHAPILNQEGRIIGEVTSGCPSPSLRVNVAMGYVEPEYAKAGTAVRFEVRKKIVDGVTTKMPFVPTKYYT 379          
BLAST of Aminomethyltransferase vs. Ensembl Xenopus
Match: AMT (aminomethyltransferase [Source:NCBI gene;Acc:100491726])

HSP 1 Score: 229.95 bits (585), Expect = 2.332e-66
Identity = 125/249 (50.20%), Postives = 167/249 (67.07%), Query Frame = 1
Query: 2224 EKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            ++F+   +++ +E ++  L+A+QGP  A VLQ G++  L  L F   +Y +VFGIP CRVTRCGYTGEDGVEISV    A ELA+KLL N +V   GL ARD+LRLEAGLCLYGNDIDE T+P EASL WT+ K R+T +      FPG   I+ QI  +  +  +RVGL S TGPP R  + IL+    ++G+VTSGC SP+L +N+ MGY+E +Y K  T ++F +R K+  G   K+PFV   YY+
Sbjct:  144 QEFKAAGRDVDLEHIDCALLAVQGPLSARVLQAGMNDDLSKLPFMTSVYTAVFGIPGCRVTRCGYTGEDGVEISVPAQRAVELADKLLQNSDVKLAGLAARDSLRLEAGLCLYGNDIDETTSPVEASLVWTLGKRRRTAM-----DFPGASIIVPQI--KGKVKHKRVGLTS-TGPPVRQHAPILNQEGRIIGEVTSGCPSPSLRVNVAMGYVEPEYAKAGTAVRFEVRKKIVDGVTTKMPFVPTKYYT 384          
BLAST of Aminomethyltransferase vs. Ensembl Xenopus
Match: AMT (aminomethyltransferase [Source:NCBI gene;Acc:100491726])

HSP 1 Score: 229.565 bits (584), Expect = 2.671e-66
Identity = 125/249 (50.20%), Postives = 167/249 (67.07%), Query Frame = 1
Query: 2224 EKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            ++F+   +++ +E ++  L+A+QGP  A VLQ G++  L  L F   +Y +VFGIP CRVTRCGYTGEDGVEISV    A ELA+KLL N +V   GL ARD+LRLEAGLCLYGNDIDE T+P EASL WT+ K R+T +      FPG   I+ QI  +  +  +RVGL S TGPP R  + IL+    ++G+VTSGC SP+L +N+ MGY+E +Y K  T ++F +R K+  G   K+PFV   YY+
Sbjct:  140 QEFKAAGRDVDLEHIDCALLAVQGPLSARVLQAGMNDDLSKLPFMTSVYTAVFGIPGCRVTRCGYTGEDGVEISVPAQRAVELADKLLQNSDVKLAGLAARDSLRLEAGLCLYGNDIDETTSPVEASLVWTLGKRRRTAM-----DFPGASIIVPQIKGK--VKHKRVGLTS-TGPPVRQHAPILNQEGRIIGEVTSGCPSPSLRVNVAMGYVEPEYAKAGTAVRFEVRKKIVDGVTTKMPFVPTKYYT 380          
BLAST of Aminomethyltransferase vs. Ensembl Xenopus
Match: AMT (aminomethyltransferase [Source:NCBI gene;Acc:100491726])

HSP 1 Score: 229.95 bits (585), Expect = 2.822e-66
Identity = 125/249 (50.20%), Postives = 167/249 (67.07%), Query Frame = 1
Query: 2224 EKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            ++F+   +++ +E ++  L+A+QGP  A VLQ G++  L  L F   +Y +VFGIP CRVTRCGYTGEDGVEISV    A ELA+KLL N +V   GL ARD+LRLEAGLCLYGNDIDE T+P EASL WT+ K R+T +      FPG   I+ QI  +  +  +RVGL S TGPP R  + IL+    ++G+VTSGC SP+L +N+ MGY+E +Y K  T ++F +R K+  G   K+PFV   YY+
Sbjct:  148 QEFKAAGRDVDLEHIDCALLAVQGPLSARVLQAGMNDDLSKLPFMTSVYTAVFGIPGCRVTRCGYTGEDGVEISVPAQRAVELADKLLQNSDVKLAGLAARDSLRLEAGLCLYGNDIDETTSPVEASLVWTLGKRRRTAM-----DFPGASIIVPQIKGK--VKHKRVGLTS-TGPPVRQHAPILNQEGRIIGEVTSGCPSPSLRVNVAMGYVEPEYAKAGTAVRFEVRKKIVDGVTTKMPFVPTKYYT 388          
BLAST of Aminomethyltransferase vs. Ensembl Mouse
Match: Amt (aminomethyltransferase [Source:MGI Symbol;Acc:MGI:3646700])

HSP 1 Score: 216.853 bits (551), Expect = 1.133e-61
Identity = 124/249 (49.80%), Postives = 154/249 (61.85%), Query Frame = 1
Query: 2224 EKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            ++F+ +  ++ +E VE  L+ALQGP    VLQ G+   +K L F       VFG+  CRVTRCGYTGEDGVEISV    A  LA  LL N  V   GL ARD+LRLEAGLCLYGNDIDEHTTP E SLSWT+ K R+  +      FPG   I+ Q+  E  + +RRVGLI   G P R+ S IL+    V+G VTSGC SP+L  N+ MGY+  KY +  TQ+   +R K     V K+PFV  NYY+
Sbjct:  161 KEFQNRGLDVGLEVVENALLALQGPTATQVLQAGVTDDMKKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPATGAVHLATTLLKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRIAM-----DFPGAKIIVPQLKGE--VQRRRVGLIC-EGAPVRAHSPILNTEGTVIGTVTSGCPSPSLKKNVAMGYVPFKYSRPGTQLLVEVRRKQQMTVVSKMPFVPTNYYT 401          
BLAST of Aminomethyltransferase vs. Ensembl Mouse
Match: Dmgdh (dimethylglycine dehydrogenase precursor [Source:MGI Symbol;Acc:MGI:1921379])

HSP 1 Score: 65.0846 bits (157), Expect = 4.220e-10
Identity = 64/233 (27.47%), Postives = 103/233 (44.21%), Query Frame = 1
Query: 2269 EKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVT--RCGYTGEDGVEI---SVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFV 2952
            E G++ + GP    VLQ    + L D  F + +    F I +  VT  R  YTGE G E+       A   E        E +   G  A + LRLE     +G++++  T P EA L + +K N+      DF+      + + QI  E  + +R V L   T      G+E +    +VVG  TSG +S ++  ++   Y+  +  +   Q++  + GK YP  + + P V
Sbjct:  619 EFGVLGVAGPYARRVLQKLTSEDLSDDAF-KFLQTKSFNISDIPVTAIRISYTGELGWELYHRREDSATLYERIMSAGQEEGIGDFGTYALNALRLEKAFRAWGSEMNCDTNPLEAGLEYFVKLNKPA----DFIG----KQALKQIKTEG-LKRRLVCLTVATDDVDPEGNESIWYKGKVVGNTTSGSYSYSIQKSLAFAYVPVQLSEVGQQVEVELLGKNYPATIIQEPLV 841          
BLAST of Aminomethyltransferase vs. Ensembl Mouse
Match: Sardh (sarcosine dehydrogenase [Source:MGI Symbol;Acc:MGI:2183102])

HSP 1 Score: 55.4546 bits (132), Expect = 3.991e-7
Identity = 54/200 (27.00%), Postives = 86/200 (43.00%), Query Frame = 1
Query: 2275 GLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPN-CRVTRCGYTGEDGVEISVXXXX---XXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYI 2862
            G++++QGP   D+LQ  LD  L +  F    +  V    +  R  R  + GE G E+ V +A+            +   ++  G  A D+L +E G   +  D+    +P EA L++T K           V F G + +  Q    +   +RR+  ++     P  G E +  N +VVG V    F  T+N  I  GYI
Sbjct:  682 GMLSIQGPASRDILQDVLDADLSNEAFPFSTHQLVRAAGHLVRAIRLSFVGELGWELHVPRASCLPVYRAVMAAGARHGLVNAGYRAIDSLSIEKGYRHWHADLRPDDSPLEAGLAFTCKLKTS-------VPFLGREALEKQ---RATGLRRRLICLTVEEEVPMFGLEAIWRNGQVVGHVRRADFGFTVNKTIAYGYI 871          
BLAST of Aminomethyltransferase vs. UniProt/SwissProt
Match: sp|Q8CFA2|GCST_MOUSE (Aminomethyltransferase, mitochondrial OS=Mus musculus OX=10090 GN=Amt PE=1 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 7.923e-61
Identity = 124/249 (49.80%), Postives = 154/249 (61.85%), Query Frame = 1
Query: 2224 EKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            ++F+ +  ++ +E VE  L+ALQGP    VLQ G+   +K L F       VFG+  CRVTRCGYTGEDGVEISV    A  LA  LL N  V   GL ARD+LRLEAGLCLYGNDIDEHTTP E SLSWT+ K R+  +      FPG   I+ Q+  E  + +RRVGLI   G P R+ S IL+    V+G VTSGC SP+L  N+ MGY+  KY +  TQ+   +R K     V K+PFV  NYY+
Sbjct:  161 KEFQNRGLDVGLEVVENALLALQGPTATQVLQAGVTDDMKKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPATGAVHLATTLLKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRIAM-----DFPGAKIIVPQLKGE--VQRRRVGLIC-EGAPVRAHSPILNTEGTVIGTVTSGCPSPSLKKNVAMGYVPFKYSRPGTQLLVEVRRKQQMTVVSKMPFVPTNYYT 401          
BLAST of Aminomethyltransferase vs. UniProt/SwissProt
Match: sp|P28337|GCST_CHICK (Aminomethyltransferase, mitochondrial OS=Gallus gallus OX=9031 GN=AMT PE=1 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 1.896e-60
Identity = 124/254 (48.82%), Postives = 154/254 (60.63%), Query Frame = 1
Query: 2206 IFEAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYY 2967
            + E    + R    ++ +E   +    +QGP +A VLQ GL   L  L F      +VFG+P CRVTRCGYTGEDGVEISV    A ELAE+LL    V P GL ARD+LRLEAGLCLYGNDIDE TTP EA L WT+ K R+T +      FPG   IM Q+ KE P  ++RVGL S  GPP R  + IL      VG VTSGC SP+L  NI MGY+++ + +  T +   +R K +P  V K+PFV  +YY
Sbjct:  144 VMEGRAAELRAAGGDVHLEVSGQRAAGVQGPSMAQVLQAGLPDDLTKLTFMTSTATTVFGVPGCRVTRCGYTGEDGVEISVPAGRAVELAERLLGCPEVWPAGLAARDSLRLEAGLCLYGNDIDESTTPVEAGLLWTLGKRRRTAM-----DFPGAAIIMEQV-KEKP-KRKRVGLTS-VGPPLRPPAAILGPEGTPVGTVTSGCPSPSLGKNIAMGYVQAAHSRPGTTLTVEVRKKQHPALVTKMPFVPTHYY 389          
BLAST of Aminomethyltransferase vs. UniProt/SwissProt
Match: sp|P25285|GCST_BOVIN (Aminomethyltransferase, mitochondrial OS=Bos taurus OX=9913 GN=AMT PE=1 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 7.970e-60
Identity = 127/253 (50.20%), Postives = 157/253 (62.06%), Query Frame = 1
Query: 2218 WEEKFRK-QNK--NIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYY 2967
             ++K R+ QNK  ++ +E ++  L+ALQGP  A VLQ G+   L+ L F       VFG+  CRVTRCGYTGEDGVEISV  A A  LA  LL N  V   GL ARD+LRLEAGLCLYGNDIDEHTTP E SLSWT+ K R+  +      FPG   I+ Q+  +S   +RRVGL+   G P R+ S ILS    V+G VTSGC SP L  N+ MGY+  +Y +  T +   +R K  P  V K+PFV  NYY
Sbjct:  150 MQDKVRELQNKGSDVALEVMDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPAAEAVHLAAALLKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM-----DFPGASVIVPQL--KSKAQRRRVGLM-CDGAPVRAQSPILSPEGTVIGAVTSGCPSPCLKKNVAMGYVPYEYSRPGTPLLVEVRRKQQPAVVSKMPFVSTNYY 394          
BLAST of Aminomethyltransferase vs. UniProt/SwissProt
Match: sp|P48728|GCST_HUMAN (Aminomethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=AMT PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.267e-58
Identity = 118/248 (47.58%), Postives = 153/248 (61.69%), Query Frame = 1
Query: 2227 KFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            + + Q +++ +E ++  L+ALQGP  A VLQ G+   L+ L F       VFG+  CRVTRCGYTGEDGVEISV  A A  LA  +L N  V   GL ARD+LRLEAGLCLYGNDIDEHTTP E SLSWT+ K R+  +      FPG   I+ Q+     + +RRVGL+   G P R+ S IL++    +G VTSGC SP+L  N+ MGY+  +Y +  T +   +R K     V K+PFV  NYY+
Sbjct:  162 ELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM-----DFPGAKVIVPQLKGR--VQRRRVGLM-CEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNVAMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYT 401          
BLAST of Aminomethyltransferase vs. UniProt/SwissProt
Match: sp|Q9TSZ7|GCST_CANLF (Aminomethyltransferase, mitochondrial OS=Canis lupus familiaris OX=9615 GN=AMT PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 4.164e-58
Identity = 120/255 (47.06%), Postives = 156/255 (61.18%), Query Frame = 1
Query: 2206 IFEAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            + +    + +    ++ +E V+  L+ALQGP    VLQ G+   L+ L F       VFG+  CRVTRCGYTGEDGVEISV  AAA  LA  LL N  V   GL ARD+LRLEAGLCLYG+DIDEHTTP E SLSWT+ K R+  +      FPG   I++Q+  +  + +RRVGL +  G P R+ S IL++   V+G VTSGC SP L  N+ MGY+ S+Y +  T +   +R K     V K+PFV  NYY+
Sbjct:  155 LMQGKVRELQNMGSDVSLEVVDNALLALQGPTATQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPAAAAVRLAAALLENPEVKLAGLAARDSLRLEAGLCLYGSDIDEHTTPVEGSLSWTLGKRRRAAM-----DFPGASVIIAQLKGK--VQRRRVGL-TCEGAPVRAHSPILNMEGTVIGTVTSGCPSPCLKKNVAMGYVPSEYSRPGTPLLVEVRRKQQMAVVSKMPFVTTNYYT 401          
BLAST of Aminomethyltransferase vs. TrEMBL
Match: A0A3Q2CTK3 (Aminomethyltransferase OS=Cyprinodon variegatus OX=28743 PE=3 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 6.048e-67
Identity = 137/254 (53.94%), Postives = 171/254 (67.32%), Query Frame = 1
Query: 2209 FEAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
             +A   +++    ++ +E++++ L+ALQGP +A VLQ GL   L  L F      +VFGIP+CRVTRCGYTGEDGVEISV ++   ELAEKLLSN  V   GLGARD+LRLEAGLCLYGNDIDE TTP EASL WTI K R+         FPG D I+ QI  ++   +RRVGL+ST GPP R  + ILS   +V+G+VTSGC SP L  NI MGY+++ + K+ T IQ  IR K  P  V K+PFV  NYYS
Sbjct:  166 MKAKLAEYKAAGFDVDLEFIDEALVALQGPIMAQVLQAGLKGDLSKLTFMSSTLVTVFGIPDCRVTRCGYTGEDGVEISVPRSKVVELAEKLLSNSEVKLAGLGARDSLRLEAGLCLYGNDIDETTTPVEASLVWTIGKRRRQT-----KDFPGADIIIPQIKAKT--ARRRVGLVST-GPPVRQHTPILSPAGQVIGEVTSGCPSPCLRKNIAMGYVDAAFAKNGTAIQVEIRKKTVPATVTKMPFVPTNYYS 411          
BLAST of Aminomethyltransferase vs. TrEMBL
Match: A0A3Q3ETZ5 (Aminomethyltransferase OS=Labrus bergylta OX=56723 PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 1.066e-66
Identity = 133/254 (52.36%), Postives = 171/254 (67.32%), Query Frame = 1
Query: 2209 FEAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
             +A   +++    N+ +E++++ LIALQGP +A VLQ GL + L  L F      +VFG+P CRVTRCGYTGEDGVEISV +    EL EKLL+N  V   GLGARD+LRLEAGLCLYGNDIDE TTP EA+L WTI K R+     D   FPG D I+ QI  ++   ++RVGL+S TGPP R  + ILS + +V+G+VTSGC SP L  N+ MGY+++ + K+ T IQ  +R K  P  V K+PFV  NYYS
Sbjct:  171 MKARLAEYKAAGYNVDLEFLDEALIALQGPSMAQVLQQGLKEDLSKLTFMTSALATVFGVPGCRVTRCGYTGEDGVEISVPRFRVVELTEKLLANSEVKLAGLGARDSLRLEAGLCLYGNDIDETTTPVEATLVWTIGKRRRQ--NKD---FPGADIIVPQIKAKT--ARKRVGLVS-TGPPVRQHTPILSSDGKVIGEVTSGCPSPCLKKNVAMGYVDAAFAKNGTAIQVEVRKKAVPATVSKMPFVPTNYYS 416          
BLAST of Aminomethyltransferase vs. TrEMBL
Match: A0A1A7WD24 (Aminomethyltransferase OS=Iconisemion striatum OX=60296 GN=AMT PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 1.110e-66
Identity = 132/241 (54.77%), Postives = 168/241 (69.71%), Query Frame = 1
Query: 2248 NIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            ++ +E++++ LIALQGP ++ VLQ GL + L  L F      +VFGIP+CRVTRCGYTGEDGVEISV ++   EL EKLL+N  V   GLGARD+LRLEAGLCLYGNDIDE TTP EASL WTI K R+ +       FPG D ++ QI  ++   ++RVGL+ST GPP R  + ILS + +V+G+VTSGC SP L  NI MGY+++ + K+ T IQ  IR K  P  V K+PFV  NYYS
Sbjct:  184 DVDLEFLDEALIALQGPAMSRVLQEGLKEDLSKLTFMTSTLATVFGIPDCRVTRCGYTGEDGVEISVHQSRIVELTEKLLTNSEVKLAGLGARDSLRLEAGLCLYGNDIDETTTPVEASLVWTIGKRRRQI-----KDFPGADVVVPQIKAKT--ARKRVGLVST-GPPVRQHTPILSPDGQVIGEVTSGCPSPCLKKNIAMGYVDAAFAKNGTNIQVEIRKKTQPATVSKMPFVPTNYYS 416          
BLAST of Aminomethyltransferase vs. TrEMBL
Match: A0A3Q1F0A8 (Aminomethyltransferase OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 1.134e-66
Identity = 132/255 (51.76%), Postives = 172/255 (67.45%), Query Frame = 1
Query: 2206 IFEAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            I E  + +F+    ++ +E++++ LIALQGP ++ VLQ GL   L+ L F      +VFG+PNCRVTRCGYTGEDGVEISV K    EL EKLL+N  V   GLGARD+LRLEAGLCLYGNDIDE TTP +ASL WTI K R+         FPG + I+ QI  ++   ++RVGL+S +GPP R  + ILS +  V+G+VTSGC SP L  N+ MGY+++ + K+ T IQ  +R K  P  V K+PFV+ NYYS
Sbjct:   97 IAELKDNQFKAAGFDVDLEFLDEALIALQGPSMSQVLQKGLKDDLRKLTFMTSTLATVFGVPNCRVTRCGYTGEDGVEISVPKGRVVELTEKLLTNGEVKLAGLGARDSLRLEAGLCLYGNDIDETTTPVDASLVWTIGKRRRQT-----KDFPGANIIVPQIKAKA--DRKRVGLVS-SGPPVRQHTPILSPDGTVIGEVTSGCPSPCLKKNVAMGYVDAAFAKNGTNIQVEVRKKAVPAIVSKMPFVQTNYYS 343          
BLAST of Aminomethyltransferase vs. TrEMBL
Match: A0A3B3UD83 (Aminomethyltransferase OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 2.104e-66
Identity = 132/255 (51.76%), Postives = 170/255 (66.67%), Query Frame = 1
Query: 2206 IFEAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
            I E  + +++    ++ +E++++ LIALQGP  A VLQ GL   L  L F      +VFG+P+CRVTRCGYTGEDGVEISV ++   EL EKLLSN  V   GLGARD+LRLEAGLCLYGNDIDE TTP EASL WTI K R+         FPG D I+ QI  ++   ++RVGL+S TGPP R  + ILS + +V+G+VTSGC SP L  N+ MGY+++ + K+   +Q  IR K  P  V K+PFV  NYY+
Sbjct:  101 IAELKDNQYKAAGFDVDLEFIDEALIALQGPTTAQVLQAGLKGDLSKLTFMTSTLVTVFGVPDCRVTRCGYTGEDGVEISVPRSRVVELTEKLLSNNEVKLAGLGARDSLRLEAGLCLYGNDIDETTTPVEASLVWTIGKRRRQT-----KDFPGADIIVPQIKAKT--ARKRVGLLS-TGPPVRQHTPILSPDGQVIGEVTSGCPSPCLKKNVAMGYVDAAFAKNGAAVQVEIRKKTVPAIVSKMPFVPTNYYT 347          
BLAST of Aminomethyltransferase vs. Ensembl Cavefish
Match: amt (aminomethyltransferase [Source:NCBI gene;Acc:103022813])

HSP 1 Score: 234.958 bits (598), Expect = 2.353e-68
Identity = 130/254 (51.18%), Postives = 168/254 (66.14%), Query Frame = 1
Query: 2209 FEAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYS 2970
             +A   +F+    ++ +E++E+ LIALQGP +A VLQ G+   L  L F   +   VFGIP CRVTRCGYTGEDGVEISV + +   L E+LL+N+ V   GLG+RD+LRLEAGLCLYGNDIDE TTP EA+L WTI K R+ V       FPG D I+ QI  ++   ++RVGLIS  GPP R  + ILS    V+G+VTSGC SP L  N+ MGY+E+ + K  T +Q  +R K+ P  V K+PFV  NYY+
Sbjct:  143 MQARLREFKAAGHDVDLEYLEESLIALQGPSMARVLQEGVGDDLSKLTFMTSVLTPVFGIPGCRVTRCGYTGEDGVEISVPRDSVVALTERLLANDEVKLAGLGSRDSLRLEAGLCLYGNDIDETTTPVEAALVWTIGKRRRQV-----RDFPGADIIIPQIKAKT--QRKRVGLIS-NGPPIRQHTPILSPEGRVIGEVTSGCPSPCLKQNVAMGYVETSFSKAGTPVQVEVRKKMVPAVVSKMPFVPTNYYT 388          
BLAST of Aminomethyltransferase vs. Ensembl Cavefish
Match: amt (aminomethyltransferase [Source:NCBI gene;Acc:103022813])

HSP 1 Score: 234.958 bits (598), Expect = 4.907e-68
Identity = 130/256 (50.78%), Postives = 168/256 (65.62%), Query Frame = 1
Query: 2209 FEAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSNR 2976
             +A   +F+    ++ +E++E+ LIALQGP +A VLQ G+   L  L F   +   VFGIP CRVTRCGYTGEDGVEISV + +   L E+LL+N+ V   GLG+RD+LRLEAGLCLYGNDIDE TTP EA+L WTI K R+ V       FPG D I+ QI  ++   ++RVGLIS  GPP R  + ILS    V+G+VTSGC SP L  N+ MGY+E+ + K  T +Q  +R K+ P  V K+PFV  NYY+  
Sbjct:  163 MQARLREFKAAGHDVDLEYLEESLIALQGPSMARVLQEGVGDDLSKLTFMTSVLTPVFGIPGCRVTRCGYTGEDGVEISVPRDSVVALTERLLANDEVKLAGLGSRDSLRLEAGLCLYGNDIDETTTPVEAALVWTIGKRRRQV-----RDFPGADIIIPQIKAKT--QRKRVGLIS-NGPPIRQHTPILSPEGRVIGEVTSGCPSPCLKQNVAMGYVETSFSKAGTPVQVEVRKKMVPAVVSKMPFVPTNYYTGH 410          
BLAST of Aminomethyltransferase vs. Ensembl Cavefish
Match: amt (aminomethyltransferase [Source:NCBI gene;Acc:103022813])

HSP 1 Score: 234.572 bits (597), Expect = 7.276e-68
Identity = 130/256 (50.78%), Postives = 168/256 (65.62%), Query Frame = 1
Query: 2209 FEAWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSNR 2976
             +A   +F+    ++ +E++E+ LIALQGP +A VLQ G+   L  L F   +   VFGIP CRVTRCGYTGEDGVEISV + +   L E+LL+N+ V   GLG+RD+LRLEAGLCLYGNDIDE TTP EA+L WTI K R+ V       FPG D I+ QI  ++   ++RVGLIS  GPP R  + ILS    V+G+VTSGC SP L  N+ MGY+E+ + K  T +Q  +R K+ P  V K+PFV  NYY+  
Sbjct:  176 MQARLREFKAAGHDVDLEYLEESLIALQGPSMARVLQEGVGDDLSKLTFMTSVLTPVFGIPGCRVTRCGYTGEDGVEISVPRDSVVALTERLLANDEVKLAGLGSRDSLRLEAGLCLYGNDIDETTTPVEAALVWTIGKRRRQV-----RDFPGADIIIPQIKAKT--QRKRVGLIS-NGPPIRQHTPILSPEGRVIGEVTSGCPSPCLKQNVAMGYVETSFSKAGTPVQVEVRKKMVPAVVSKMPFVPTNYYTGH 423          
BLAST of Aminomethyltransferase vs. Ensembl Cavefish
Match: dmgdh (dimethylglycine dehydrogenase [Source:NCBI gene;Acc:103034486])

HSP 1 Score: 69.707 bits (169), Expect = 1.161e-11
Identity = 65/231 (28.14%), Postives = 102/231 (44.16%), Query Frame = 1
Query: 2275 GLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNC--RVTRCGYTGEDGVEISVXX---XXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFV 2952
            G++ + GP    VLQ    + L D  F + ++C    +     R  R  YTGE G E+ V     AA  +   +    E +   G  A  +LRLE G   +G +++  T P EA L + IK N+      DF+      +I     K   +T++   LI  T      G+E +    +VVG  TSG +S +   ++  GY+  K      +++  + GK YP  V + P V
Sbjct:  640 GVLGVAGPNSRKVLQKLTSEDLSDAAF-KFLHCKSIQLAGVKLRAIRISYTGELGWELYVDMPQLAAVYQAIMEAGQEEGIDNFGTYAMGSLRLEKGFRGWGAEMNCDTNPLEAGLDYFIKLNKPA----DFIGKQALQEI-----KSKGLTRKLAYLIMDTDNIDPEGNETIWHEGKVVGNTTSGAYSYSAEQSLAFGYLPVKLATIGQKVEVELLGKKYPATVVQEPLV 860          
BLAST of Aminomethyltransferase vs. Ensembl Cavefish
Match: si:cabz01113374.3 (pyruvate dehydrogenase phosphatase regulatory subunit [Source:NCBI gene;Acc:103042053])

HSP 1 Score: 55.0694 bits (131), Expect = 3.841e-7
Identity = 62/269 (23.05%), Postives = 106/269 (39.41%), Query Frame = 1
Query: 2215 AWEEKFRKQNKNIQVEWVEKGLIALQ--GPKVADVLQPGLDKSLKDLYFGRGMYC---SVFGIPNCRVTRCGYTGEDGVEISV---XXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPP-----PRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQI-----------QFRIRGKVYPGHVKKLPF 2949
            +W ++    +  + +E V     AL   GP+  DVL      S+   +F   ++C   SV      RV    +TGE G  + +              +     +   G  A  +LR+E     +G D+D  TTP E    + +K ++ T        F G + ++ Q  ++  +T+R + L+           P  G  I   N E+VG  TS  +S TL  ++C+G++    +     +           +  I G+ YP   K  PF
Sbjct:  614 SWLKRHMPSDPQLHLEDVSWKYTALNLIGPRAMDVLSELSYVSMTPEHFP-SLFCKEMSVGYANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAFWGQDLDSFTTPLECGREFRVKFDKHT-------DFLGREALLQQ--RQEGVTRRFIMLVLDDHDTELDLWPWWGEPIYR-NGELVGVTTSSAYSYTLERHVCLGFVSPPSLDGTPAVVTPDFINRGDYEVDIAGQRYPAKAKLYPF 871          
BLAST of Aminomethyltransferase vs. Ensembl Sea Lamprey
Match: amt (aminomethyltransferase [Source:ZFIN;Acc:ZDB-GENE-041010-114])

HSP 1 Score: 203.756 bits (517), Expect = 1.061e-57
Identity = 122/262 (46.56%), Postives = 158/262 (60.31%), Query Frame = 1
Query: 2227 KFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIP-------------VGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSN 2973
            +F+   +++ +E V+  L+A+QGP  A VLQ G+ + L  L F      SVFG+  CRVTRCGYTGEDGVEISV+   A  L E LL  + +                GLGARD+LRLEAGLCLYGNDIDE TTP EA+L WTI K R+   GN    FPG   I+ QI  E P  ++RVGL+S +GPP R  + I+    E +G+VTSGC SP L  NI MGY+ S   K  T+++  +R K+    V K+PFV   Y++ 
Sbjct:  159 EFKSAGRDVDLEVVDAALLAVQGPATARVLQAGVSEDLGGLAFMHSAEMSVFGVAGCRVTRCGYTGEDGVEISVAPEHAVGLVETLLQQQRLRRNVGGEEEEEVVKLAGLGARDSLRLEAGLCLYGNDIDETTTPVEAALLWTIGKRRRAE-GN----FPGAGVILGQI-AERP-ARKRVGLVS-SGPPARQRAPIVDGQGEKIGEVTSGCPSPCLKKNIAMGYVPSGLAKPGTRLRVEVRKKLVDVVVSKMPFVPTRYFAG 412          
BLAST of Aminomethyltransferase vs. Ensembl Sea Lamprey
Match: dmgdh (dimethylglycine dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-080227-8])

HSP 1 Score: 63.5438 bits (153), Expect = 2.203e-10
Identity = 64/233 (27.47%), Postives = 98/233 (42.06%), Query Frame = 1
Query: 2269 EKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVT--RCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVG---LGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFV 2952
            + G++ + GP    VL    D +L D  F R + C    +    VT  R  YTGE G E+   +     L   L+       +G     A ++LR+E     +G +++  T P EA L   IK N+      DF+      +I     K   +T+  V L   T      G+E +  N +VVG  TSG +S T   ++   Y+  +       ++  + GK YP  V K P V
Sbjct:  588 DMGVLGVAGPLSRRVLARLTDAALDDDAF-RFLRCRAVHVAGRAVTAVRISYTGELGWELYHQREDTGALYSALMEAGREFGIGDFGAYAMNSLRMEKAFRAWGAEMNCDTNPFEAGLQPFIKVNKDA----DFIGKEALQRI-----KREGLTRHLVYLTLDTDDVDPEGNESVWCNGKVVGNTTSGAYSYTAGHSVAFAYVPVELSLVGQHVEVELLGKNYPATVAKEPLV 810          
BLAST of Aminomethyltransferase vs. Ensembl Yeast
Match: GCV1 (T subunit of the mitochondrial glycine decarboxylase complex; glycine decarboxylase is required for the catabolism of glycine to 5,10-methylene-THF; expression is regulated by levels of levels of 5,10-methylene-THF in the cytoplasm [Source:SGD;Acc:S000002426])

HSP 1 Score: 174.096 bits (440), Expect = 1.010e-47
Identity = 107/240 (44.58%), Postives = 153/240 (63.75%), Query Frame = 1
Query: 2272 KGLIALQGPKVADVLQPGLDKS-----LKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGL-ISTTGPPPRSGSEILSVNNEV-VGQVTSGCFSPTL-NINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYY 2967
            + L+ALQGPK  DVL+P L K+     LK+L+FG+    ++      ++ R GYTGEDG EIS++   A E AE+LL+N  + P+GL ARD+LRLEAG+CLYG+++DE  TP EA+L+W I K+R+ ++   +  F G+ KIM Q+N ++  +K RVG      GP  R+G +I   + E  VG VTSG  SPTL NINI   Y++  Y K  T++  ++R K YP  + K+P V  +YY
Sbjct:  161 RSLLALQGPKAKDVLEPLLSKTAPGKDLKELFFGQRHEFALKDGSLVQIARGGYTGEDGFEISIANEKAVEFAEQLLANPVMKPIGLAARDSLRLEAGMCLYGHELDESITPVEAALNWVISKSRRDLVDQKYW-FNGYAKIMDQLNNKT-YSKVRVGFKYLKKGPAARNGVKIFLPDAETEVGLVTSGSASPTLNNINIGQAYVQKGYHKKGTKLLVQVRNKFYPIELAKMPLVPTHYY 398          
BLAST of Aminomethyltransferase vs. Ensembl Nematostella
Match: EDO31336 (Aminomethyltransferase [Source:UniProtKB/TrEMBL;Acc:A7SY95])

HSP 1 Score: 206.453 bits (524), Expect = 7.778e-59
Identity = 120/245 (48.98%), Postives = 150/245 (61.22%), Query Frame = 1
Query: 2242 NKNIQVEWVE-KGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXX--XXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYY 2967
            N ++ +E +E K L+ALQGPK A VLQ G+D  L  L F  G+  SV+G+ + RVTRCGYTGEDG E+SV K    +   +        V   GLGARD+LRLEAGLCLYGNDIDE TTP EA L WTI K R+         FPG   I+ QI K+ P  +RRVGL+S  GPP R+G+++L    + VG VTSGC SP+   NI M YI +   K  T +Q  +  K  P  V K+PFV  NY+
Sbjct:  133 NLDVALEILEDKALVALQGPKAAQVLQGGVDGDLSHLTFMHGVSTSVYGLKDVRVTRCGYTGEDGFELSVDKDRVVDLCRSLMSRQEAEVKLAGLGARDSLRLEAGLCLYGNDIDEDTTPVEAVLVWTIGKRRRAE-----ASFPGAKIILQQI-KDKP-KRRRVGLVS-AGPPARAGTKVLDGEGQEVGVVTSGCPSPSSKQNIAMAYISTPQSKIGTALQLSVYKKKVPATVAKMPFVPTNYF 369          
BLAST of Aminomethyltransferase vs. Ensembl Nematostella
Match: EDO40332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7H8])

HSP 1 Score: 68.9366 bits (167), Expect = 8.218e-12
Identity = 66/231 (28.57%), Postives = 107/231 (46.32%), Query Frame = 1
Query: 2281 IALQGPKVADVLQPGLDKSLKDLYFGRGMYCSV-----FGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPV---GLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPF 2949
            + + GPK  DVLQ     + +D+  G+  + +V      G+P  R  R  YTGE G E+  SK    +L   ++       +   G  A  TLR+E G   +G +++  TTP EA L + IK ++        V F G + ++ Q  KE  + +R   L   T      G+E +    +VVG  T+G +S T+N +I   Y+  +     ++++  I G+  P  V K P 
Sbjct:  632 LGVAGPKARDVLQ---KLTTEDMSHGKFKFLNVKDIEMAGVP-VRAIRISYTGELGWELYCSKEHTLKLYNAIMEAGQEFGIDNFGTFAMTTLRVEKGFRAWGLEMNLDTTPLEAGLDFFIKFDKG-------VNFIGREALLKQ--KEEGVKRRLCMLTVETTDTDPEGNESIWFGGKVVGNTTTGTYSYTMNTSISFAYLPLELTTLGSRVEVEILGQKCPATVVKEPL 849          
BLAST of Aminomethyltransferase vs. Ensembl Nematostella
Match: EDO41600 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3V0])

HSP 1 Score: 51.9878 bits (123), Expect = 1.362e-6
Identity = 46/149 (30.87%), Postives = 72/149 (48.32%), Query Frame = 1
Query: 2509 VGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPP---PRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIES-------KYIKDETQIQFRIRGKVYP 2925
            VG  A D LR+E G    G ++     P +A L     ++R  +  N+  +F G   ++S   ++ PITKR + +          P  G  IL  N E+VG  +S  FS TLN  +CMGY+ +       +YI+D  + +  + G+ YP
Sbjct:  612 VGCYAVDALRVEKGYPRLGIELTPFVNPFQAGL-----ESRICMFKNE--EFIGRSALLSL--QDQPITKRLLFMAMEEHDDTNIPWGGEPILR-NGEIVGTTSSASFSFTLNAPVCMGYVSNAGHPVSDEYIRD-GKFEIDVAGQRYP 749          
BLAST of Aminomethyltransferase vs. Ensembl Medaka
Match: amt (aminomethyltransferase [Source:NCBI gene;Acc:101170344])

HSP 1 Score: 226.098 bits (575), Expect = 5.719e-66
Identity = 126/247 (51.01%), Postives = 170/247 (68.83%), Query Frame = 1
Query: 2227 KFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYY 2967
            +F+    ++ +E++++ L+A+QGP ++ VLQ GL  +L  L F      +VFG+P+CR+TRCGYTGEDGVEISVS+  A EL EKLL+N  V   GL ARD+LRLEAGLCLYGNDIDE TTP EA+L WTI K R+     D   FPG + ++ QI  ++   ++RVGL+S TGPP R  + ILS + +V+G+VTSGC SP L  N+ MGY++S++ K+ T IQ  IR K     V ++PFV  NYY
Sbjct:   90 EFKAAGLDVDLEFLDEALLAVQGPSMSRVLQEGLKDNLNKLTFMTSTVATVFGVPDCRITRCGYTGEDGVEISVSRLRAVELIEKLLANSEVKLAGLAARDSLRLEAGLCLYGNDIDETTTPVEATLVWTIGKRRRK--DKD---FPGAEIVVPQIKAKT--VRKRVGLVS-TGPPVRQHTPILSPDGKVIGEVTSGCPSPCLKKNVAMGYVDSEFAKNGTDIQVEIRKKAVRAVVSRMPFVPTNYY 328          
BLAST of Aminomethyltransferase vs. Ensembl Medaka
Match: amt (aminomethyltransferase [Source:NCBI gene;Acc:101170344])

HSP 1 Score: 226.868 bits (577), Expect = 2.416e-65
Identity = 126/247 (51.01%), Postives = 170/247 (68.83%), Query Frame = 1
Query: 2227 KFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYY 2967
            +F+    ++ +E++++ L+A+QGP ++ VLQ GL  +L  L F      +VFG+P+CR+TRCGYTGEDGVEISVS+  A EL EKLL+N  V   GL ARD+LRLEAGLCLYGNDIDE TTP EA+L WTI K R+     D   FPG + ++ QI  ++   ++RVGL+S TGPP R  + ILS + +V+G+VTSGC SP L  N+ MGY++S++ K+ T IQ  IR K     V ++PFV  NYY
Sbjct:  154 EFKAAGLDVDLEFLDEALLAVQGPSMSRVLQEGLKDNLNKLTFMTSTVATVFGVPDCRITRCGYTGEDGVEISVSRLRAVELIEKLLANSEVKLAGLAARDSLRLEAGLCLYGNDIDETTTPVEATLVWTIGKRRRK--DKD---FPGAEIVVPQIKAKT--VRKRVGLVS-TGPPVRQHTPILSPDGKVIGEVTSGCPSPCLKKNVAMGYVDSEFAKNGTDIQVEIRKKAVRAVVSRMPFVPTNYY 392          
BLAST of Aminomethyltransferase vs. Ensembl Medaka
Match: amt (aminomethyltransferase [Source:NCBI gene;Acc:101170344])

HSP 1 Score: 225.713 bits (574), Expect = 8.378e-65
Identity = 126/247 (51.01%), Postives = 170/247 (68.83%), Query Frame = 1
Query: 2227 KFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYY 2967
            +F+    ++ +E++++ L+A+QGP ++ VLQ GL  +L  L F      +VFG+P+CR+TRCGYTGEDGVEISVS+  A EL EKLL+N  V   GL ARD+LRLEAGLCLYGNDIDE TTP EA+L WTI K R+     D   FPG + ++ QI  ++   ++RVGL+S TGPP R  + ILS + +V+G+VTSGC SP L  N+ MGY++S++ K+ T IQ  IR K     V ++PFV  NYY
Sbjct:  174 EFKAAGLDVDLEFLDEALLAVQGPSMSRVLQEGLKDNLNKLTFMTSTVATVFGVPDCRITRCGYTGEDGVEISVSRLRAVELIEKLLANSEVKLAGLAARDSLRLEAGLCLYGNDIDETTTPVEATLVWTIGKRRRK--DKD---FPGAEIVVPQIKAKT--VRKRVGLVS-TGPPVRQHTPILSPDGKVIGEVTSGCPSPCLKKNVAMGYVDSEFAKNGTDIQVEIRKKAVRAVVSRMPFVPTNYY 412          
BLAST of Aminomethyltransferase vs. Ensembl Medaka
Match: dmgdh (dimethylglycine dehydrogenase [Source:NCBI gene;Acc:101169624])

HSP 1 Score: 67.0106 bits (162), Expect = 9.237e-11
Identity = 65/253 (25.69%), Postives = 113/253 (44.66%), Query Frame = 1
Query: 2218 WEEKFRKQNKNIQVEWV--EKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYC---SVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXX---XXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFV 2952
            W E   ++  ++++  V  + G++ + GP    VLQ   D+ L D  F + + C    + G+P  R  R  YTGE G E+ + +     +   ++     + +   G  A  +LRLE G   +G +++  T P EA L + IK N+      DF+      +I     K   + ++   L   T      G+E +  N +VVG  TSG +S +   ++  GY+  +       ++  + GK YP  V + P V
Sbjct:  576 WIEAEAERGYDVEISNVTDQIGVLGIAGPNSRSVLQKLTDEDLSDSAF-KFLQCKTVQLAGVP-VRAIRISYTGELGWELYMEQENMVAVYRAMMEAGKDQGIDNFGTYAMASLRLEKGFRGWGAEMNCDTNPLEAGLDYFIKLNKPA----DFIGKKALKEI-----KAKGLKRKLSYLAVQTDEIDPEGNETIWHNGKVVGNTTSGAYSYSSQQSLAFGYLPVELNSVGQTVEVELLGKKYPATVIQEPLV 817          
BLAST of Aminomethyltransferase vs. Ensembl Medaka
Match: dmgdh (dimethylglycine dehydrogenase [Source:NCBI gene;Acc:101169624])

HSP 1 Score: 66.6254 bits (161), Expect = 1.163e-10
Identity = 65/253 (25.69%), Postives = 113/253 (44.66%), Query Frame = 1
Query: 2218 WEEKFRKQNKNIQVEWV--EKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYC---SVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXX---XXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFV 2952
            W E   ++  ++++  V  + G++ + GP    VLQ   D+ L D  F + + C    + G+P  R  R  YTGE G E+ + +     +   ++     + +   G  A  +LRLE G   +G +++  T P EA L + IK N+      DF+      +I     K   + ++   L   T      G+E +  N +VVG  TSG +S +   ++  GY+  +       ++  + GK YP  V + P V
Sbjct:  659 WIEAEAERGYDVEISNVTDQIGVLGIAGPNSRSVLQKLTDEDLSDSAF-KFLQCKTVQLAGVP-VRAIRISYTGELGWELYMEQENMVAVYRAMMEAGKDQGIDNFGTYAMASLRLEKGFRGWGAEMNCDTNPLEAGLDYFIKLNKPA----DFIGKKALKEI-----KAKGLKRKLSYLAVQTDEIDPEGNETIWHNGKVVGNTTSGAYSYSSQQSLAFGYLPVELNSVGQTVEVELLGKKYPATVIQEPLV 900          
BLAST of Aminomethyltransferase vs. Planmine SMEST
Match: SMESG000012592.1 (SMESG000012592.1)

HSP 1 Score: 488.419 bits (1256), Expect = 1.432e-164
Identity = 255/255 (100.00%), Postives = 255/255 (100.00%), Query Frame = 1
Query: 2215 AWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSNRF 2979
            AWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVSKAAAEELAEKLLSNENVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSNRF
Sbjct:  103 AWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVSKAAAEELAEKLLSNENVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSNRF 357          
BLAST of Aminomethyltransferase vs. Planmine SMEST
Match: SMESG000012592.1 (SMESG000012592.1)

HSP 1 Score: 488.419 bits (1256), Expect = 1.846e-164
Identity = 255/255 (100.00%), Postives = 255/255 (100.00%), Query Frame = 1
Query: 2215 AWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSNRF 2979
            AWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVSKAAAEELAEKLLSNENVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSNRF
Sbjct:  111 AWEEKFRKQNKNIQVEWVEKGLIALQGPKVADVLQPGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVSKAAAEELAEKLLSNENVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNYYSNRF 365          
BLAST of Aminomethyltransferase vs. Planmine SMEST
Match: SMESG000042264.1 (SMESG000042264.1)

HSP 1 Score: 71.2478 bits (173), Expect = 3.636e-12
Identity = 64/232 (27.59%), Postives = 110/232 (47.41%), Query Frame = 1
Query: 2275 GLIALQGPKVADVLQPGLDKSL--KDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXX---XXXXXXXXXXXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVK 2955
            G++ + GP+  + LQ  +D  L  ++  F +   C +  IP   + R  YTGE G EI       A   ++ +      N+I  G  A ++LR+E G  ++GND+   T P EA L + +K  ++     DF+      +I+     ++PI K+ V L   T      G E + +N++VVG VTSG +   +N ++ M Y+  +   +  ++   + G+     V    FVK
Sbjct:  623 GVLGIAGPRSREYLQSLVDTDLSSQNYKFLQFRRCKISDIP-VNLIRISYTGELGWEIYCPMECLAKLFQILQNHGQAYNLINFGGYAMNSLRIEKGFRMWGNDMTMDTNPIEAGLGFFVKHKKEV----DFIGKASVGEIL-----KNPIKKKLVFLQIDTENVDAEGDESVFLNDKVVGNVTSGSYGFQVNKSLAMAYLPIELAVNGQEVAVDLVGERRCAKVSVNSFVK 844          
BLAST of Aminomethyltransferase vs. Planmine SMEST
Match: SMESG000068610.1 (SMESG000068610.1)

HSP 1 Score: 50.447 bits (119), Expect = 7.223e-6
Identity = 54/200 (27.00%), Postives = 85/200 (42.50%), Query Frame = 1
Query: 2278 LIALQGPKVADVLQ--PGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXX---XXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYI 2862
            L+++QGPK   +LQ     D S +   F       + G+P CR  R  + GE G E+ ++K  A+ +      +  +  V+  G  A D+L +E G   +  D+    TP EA L +T K    T        F G   + +Q        K+++ L S        G E +  N E VG + S  F   ++  I  GY+
Sbjct:  673 LLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLP-CRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDT-------NFLGRSALENQAKNG---LKKKLSLFSLKEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYV 861          
BLAST of Aminomethyltransferase vs. Planmine SMEST
Match: SMESG000068610.1 (SMESG000068610.1)

HSP 1 Score: 50.447 bits (119), Expect = 7.648e-6
Identity = 54/200 (27.00%), Postives = 85/200 (42.50%), Query Frame = 1
Query: 2278 LIALQGPKVADVLQ--PGLDKSLKDLYFGRGMYCSVFGIPNCRVTRCGYTGEDGVEISVXXXXXXXXXXX---XXXXXXVIPVGLGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKFPGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTSGCFSPTLNINICMGYI 2862
            L+++QGPK   +LQ     D S +   F       + G+P CR  R  + GE G E+ ++K  A+ +      +  +  V+  G  A D+L +E G   +  D+    TP EA L +T K    T        F G   + +Q        K+++ L S        G E +  N E VG + S  F   ++  I  GY+
Sbjct:  694 LLSIQGPKSRQILQSISDTDFSNESFPFSTQKLIKINGLP-CRALRLSFVGEMGWELHIAKDYAKSIYNSIIKVGKSHGVVNAGYRAIDSLSIEKGYRHWHADLRPDDTPLEAGLGFTCKLKTDT-------NFLGRSALENQAKNG---LKKKLSLFSLKEKIQLHGLEAIVRNGEYVGFLRSADFGHYIDKAIGYGYV 882          
The following BLAST results are available for this feature:
BLAST of Aminomethyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AMT4.704e-6047.58aminomethyltransferase [Source:HGNC Symbol;Acc:HGN... [more]
AMT5.943e-6047.58aminomethyltransferase [Source:HGNC Symbol;Acc:HGN... [more]
AMT7.693e-6047.39aminomethyltransferase [Source:HGNC Symbol;Acc:HGN... [more]
AMT1.300e-5947.39aminomethyltransferase [Source:HGNC Symbol;Acc:HGN... [more]
AMT2.639e-5947.58aminomethyltransferase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Aminomethyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gcst-12.692e-5344.19Aminomethyltransferase [Source:UniProtKB/TrEMBL;A... [more]
gcst-12.692e-5344.19Aminomethyltransferase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Aminomethyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG64151.283e-6146.97gene:FBgn0032287 transcript:FBtr0080108[more]
back to top
BLAST of Aminomethyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
amt1.437e-6952.17aminomethyltransferase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
amt8.516e-5748.44aminomethyltransferase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
dmgdh7.718e-727.21dimethylglycine dehydrogenase [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Aminomethyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AMT7.305e-6750.20aminomethyltransferase [Source:NCBI gene;Acc:10049... [more]
AMT2.067e-6650.20aminomethyltransferase [Source:NCBI gene;Acc:10049... [more]
AMT2.332e-6650.20aminomethyltransferase [Source:NCBI gene;Acc:10049... [more]
AMT2.671e-6650.20aminomethyltransferase [Source:NCBI gene;Acc:10049... [more]
AMT2.822e-6650.20aminomethyltransferase [Source:NCBI gene;Acc:10049... [more]
back to top
BLAST of Aminomethyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Amt1.133e-6149.80aminomethyltransferase [Source:MGI Symbol;Acc:MGI:... [more]
Dmgdh4.220e-1027.47dimethylglycine dehydrogenase precursor [Source:MG... [more]
Sardh3.991e-727.00sarcosine dehydrogenase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Aminomethyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CFA2|GCST_MOUSE7.923e-6149.80Aminomethyltransferase, mitochondrial OS=Mus muscu... [more]
sp|P28337|GCST_CHICK1.896e-6048.82Aminomethyltransferase, mitochondrial OS=Gallus ga... [more]
sp|P25285|GCST_BOVIN7.970e-6050.20Aminomethyltransferase, mitochondrial OS=Bos tauru... [more]
sp|P48728|GCST_HUMAN1.267e-5847.58Aminomethyltransferase, mitochondrial OS=Homo sapi... [more]
sp|Q9TSZ7|GCST_CANLF4.164e-5847.06Aminomethyltransferase, mitochondrial OS=Canis lup... [more]
back to top
BLAST of Aminomethyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q2CTK36.048e-6753.94Aminomethyltransferase OS=Cyprinodon variegatus OX... [more]
A0A3Q3ETZ51.066e-6652.36Aminomethyltransferase OS=Labrus bergylta OX=56723... [more]
A0A1A7WD241.110e-6654.77Aminomethyltransferase OS=Iconisemion striatum OX=... [more]
A0A3Q1F0A81.134e-6651.76Aminomethyltransferase OS=Acanthochromis polyacant... [more]
A0A3B3UD832.104e-6651.76Aminomethyltransferase OS=Poecilia latipinna OX=48... [more]
back to top
BLAST of Aminomethyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
amt2.353e-6851.18aminomethyltransferase [Source:NCBI gene;Acc:10302... [more]
amt4.907e-6850.78aminomethyltransferase [Source:NCBI gene;Acc:10302... [more]
amt7.276e-6850.78aminomethyltransferase [Source:NCBI gene;Acc:10302... [more]
dmgdh1.161e-1128.14dimethylglycine dehydrogenase [Source:NCBI gene;Ac... [more]
si:cabz01113374.33.841e-723.05pyruvate dehydrogenase phosphatase regulatory subu... [more]
back to top
BLAST of Aminomethyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
amt1.061e-5746.56aminomethyltransferase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
dmgdh2.203e-1027.47dimethylglycine dehydrogenase [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Aminomethyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GCV11.010e-4744.58T subunit of the mitochondrial glycine decarboxyla... [more]
back to top
BLAST of Aminomethyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO313367.778e-5948.98Aminomethyltransferase [Source:UniProtKB/TrEMBL;A... [more]
EDO403328.218e-1228.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416001.362e-630.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aminomethyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
amt5.719e-6651.01aminomethyltransferase [Source:NCBI gene;Acc:10117... [more]
amt2.416e-6551.01aminomethyltransferase [Source:NCBI gene;Acc:10117... [more]
amt8.378e-6551.01aminomethyltransferase [Source:NCBI gene;Acc:10117... [more]
dmgdh9.237e-1125.69dimethylglycine dehydrogenase [Source:NCBI gene;Ac... [more]
dmgdh1.163e-1025.69dimethylglycine dehydrogenase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Aminomethyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012592.11.432e-164100.00SMESG000012592.1[more]
SMESG000012592.11.846e-164100.00SMESG000012592.1[more]
SMESG000042264.13.636e-1227.59SMESG000042264.1[more]
SMESG000068610.17.223e-627.00SMESG000068610.1[more]
SMESG000068610.17.648e-627.00SMESG000068610.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012816 ID=SMED30012816|Name=Aminomethyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=3107bp
CCTCGAAATTTTTTCCCTCCAGTTTTCCAAAAACTGCAAGTGTTTTGGTT
TGGTAAAACAACTCTTGATTTTGTTCCAGAATATTCTGGAATTTCCTATT
GAAATTATTTATAAATTTATAAAATTTTGGGGTTATTAAATTTCCATTTA
TTTTCCCATTAGTTATAAAATTAATTTTTTCTATTTTGTACATTAGATTA
TTAAAATTTGAATTTGTATTTCTAATAAATTTTTCTATATTAGTATTATT
TTTAAATTCTTTTAAATTTACATAAATATTTTCATTTTTATAATTATTTA
AATTATCATTGTTATTATTAAAATTAAAAATTGGTGCGTGGGATTGTTTA
AGTTGATTCTTGGCGGGATAGCTGGAAGTTTTGTTATCTGGTTTGATGTT
GATGTTGATGTAGTACTATTTTTAATTGATGTAGTACTATTTATAATTTT
CAAAATGCTTATTTTGAGAAGCATGGTAATTTCTATTATCATGTTTTTTA
TTAAAAGCAAAAGTATAAGGAGAATTTTTATTCTCAGAATAGGCAATATC
CTTATATTGGAATTTATTTGTGGTTTTATTATTATTATAGGTTCTCGTTT
GATCATTATAATTTTTATTATGATGTCGACTAGATTTATTAAAGGAATTT
GGAGTCTGCTTACCCTGAAAATTTTTGTTTTCAGGATAAGTAGAATCCCT
ATATTGCACATCTTTATCATTGTTTAATTTATTTATTTCTTTTTTCAATA
GGTTGTAGTTCAGGGAGTTGAAGCGAGATGATGATTTATTTATGCCTCCA
TTTGGAGATGCGAACTTATTAGTATTATTTCTGTAAGTATTTTTATAAAA
ATTATTATCATTAAAATCAAAATCTTTATTATAGTTTCTATTGTTCTTAC
TATTTCTATAAATATTATTATTATCAGTAATGCCTTTATTATTATTATTA
TAGCCATTATTAGAATTAATATTATCATTATTATAATCTTTCTTTAATGC
ATTATATCTATTATTATATATATAGCTGTTATTATTATTTTTATAAATAT
TTCTAGTATATTGTCTACTATCAGAGTTTTTATTATTATTATTAGTTGAT
TCATTATTATAAACATCATTATTATACTCTCTATTATAAATATATTTATT
ATTGTTATCATTATTGAATTCCTTTTTATTTTTATTAAAATTACTATATT
TTGTTTTTAAGGTTTCATCTCTGTTGATAAAGGATCCGAATCTATTTCCA
GAATCAATCATTTTAGCATATGTAATTTTATTATTATTAATAGAAGAATT
AGGCACAGGTGGGCCTATATTTTTAATATTATTTTCATTTTTATTATTAT
TTAATTCGATTTTAATTTTAAAATACTTTTGGCAATAAAGATGTAAGGGA
ATGGTCGATTAAACATATTATTTAACTTAATTAATTAAACAATTCAAAAA
ATTGCATATTCATTAATTTAACATTTATTTAGTATTATATGTAAATATAA
TCTCTTGCTCGTGATATTGGATATGTAAAACAATCTTTTGGTTTTAATAT
AATATACTATAAATAAAAAGTTTAAATTTATAAATTATCTTGATTGATGC
AAATAATGCTACACCACGCAATCTAACAAGACAAATTATTTATAACAATA
TAATCCAAACAAATTAACTAATAAGCCAATTCTGAAGTTTTTATTTATTG
AAATATTTACACCTTTAATAGTTTCTGTTCACTCCAATAAAAAATTTAAC
ACCTTTGCTAATTGAATCCTTTTTGAGGTTTCCTGTTTTTGAAGTCGATA
TTTTTCCATATATAAAAAAAATTTCAAAATAAAATTAAAATAAAATTTAA
TTTAATTTTTCAATATTAAAATCTAAATAAATTTATACATTTTTTAATTT
TCGAATTTGCTAAATTTTTATTACATGACATCAAGTCTGGCTTTGACTTG
TTTAAATAAACTTAAAAATAACTTGTCAAAACCGGAATTATTTATAAGAA
TATAATTCAAAAAAAATTAACAGAAAAACCATTTCCCCAGTTAATTCGAT
ATAAATAACATTAAATATTTCATACGGTTATTTGTATATTGCCGCTTAAA
CAATCCTTGTTTTGAAGTTTGTTTTATTAAATGTTATTTTTCTTTTCTTA
AAGTTGTATTTTTTCTAATTTATTTTCTTTATTGAGATTATCAATAACTT
GGTATATTTTTGAGGCATGGGAAGAGAAATTCCGAAAACAAAACAAAAAC
ATTCAAGTAGAATGGGTGGAAAAAGGTCTAATAGCACTGCAGGGACCAAA
AGTAGCAGACGTTCTTCAACCTGGATTAGACAAGTCATTGAAGGATTTAT
ATTTTGGTCGTGGCATGTATTGCTCAGTATTTGGGATTCCAAATTGTAGG
GTTACTCGATGTGGATACACCGGAGAAGATGGGGTAGAAATTAGTGTTTC
TAAGGCAGCGGCAGAAGAATTGGCTGAAAAATTATTGTCTAATGAAAATG
TCATTCCAGTTGGATTGGGAGCTCGAGATACGTTACGTCTTGAAGCCGGA
CTTTGTTTATATGGAAATGATATCGATGAACACACTACACCAGGAGAGGC
ATCTTTATCATGGACTATTAAGAAAAATCGAAAAACTGTCATAGGCAATG
ATTTTGTGAAATTTCCCGGATTCGATAAAATAATGTCTCAAATAAATAAA
GAAAGTCCAATAACTAAACGGAGAGTTGGTTTGATTTCAACTACTGGCCC
TCCTCCGAGAAGTGGTTCAGAAATTTTATCTGTAAATAATGAAGTGGTTG
GACAAGTAACAAGCGGGTGCTTTTCACCTACTTTAAACATTAATATATGC
ATGGGATATATTGAAAGTAAATATATCAAAGATGAAACACAAATCCAATT
TAGAATTCGGGGTAAAGTATACCCCGGCCACGTCAAGAAATTGCCTTTTG
TCAAAAATAATTACTATTCTAATCGTTTCTGAAAAATTATATTTGAAAAT
CATTTATAACGAAAATGGTATTTTTGATTTGCTAGTAAATATATTTTAGA
TTTCTATGTTGATTATTGGATGATTGTTTGATGATTTTTCAGATGATTTT
TGGATTC
back to top

protein sequence of SMED30012816-orf-1

>SMED30012816-orf-1 ID=SMED30012816-orf-1|Name=SMED30012816-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=206bp
MYCSVFGIPNCRVTRCGYTGEDGVEISVSKAAAEELAEKLLSNENVIPVG
LGARDTLRLEAGLCLYGNDIDEHTTPGEASLSWTIKKNRKTVIGNDFVKF
PGFDKIMSQINKESPITKRRVGLISTTGPPPRSGSEILSVNNEVVGQVTS
GCFSPTLNINICMGYIESKYIKDETQIQFRIRGKVYPGHVKKLPFVKNNY
YSNRF*
back to top

protein sequence of SMED30012816-orf-2

>SMED30012816-orf-2 ID=SMED30012816-orf-2|Name=SMED30012816-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MIDSGNRFGSFINRDETLKTKYSNFNKNKKEFNNDNNNKYIYNREYNNDV
YNNESTNNNNKNSDSRQYTRNIYKNNNNSYIYNNRYNALKKDYNNDNINS
NNGYNNNNKGITDNNNIYRNSKNNRNYNKDFDFNDNNFYKNTYRNNTNKF
ASPNGGINKSSSRFNSLNYNLLKKEINKLNNDKDVQYRDSTYPENKNFQG
KQTPNSFNKSSRHHNKNYNDQTRTYNNNKTTNKFQYKDIAYSENKNSPYT
FAFNKKHDNRNYHASQNKHFENYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006222GCV_T_N
IPR027266TrmE/GcvT_dom1
IPR013977GCV_T_C
IPR028896GCST/DmdA
IPR029043GcvT/YgfZ_C
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004047aminomethyltransferase activity
GO:0008168methyltransferase activity
GO:0008483transaminase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006546glycine catabolic process
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:4.10.1250.10coord: 62..111
e-value: 2.4E-18
score: 67.5
NoneNo IPR availableGENE3DG3DSA:2.40.30.110coord: 115..192
e-value: 5.3E-25
score: 88.7
NoneNo IPR availablePANTHERPTHR43757FAMILY NOT NAMEDcoord: 5..202
NoneNo IPR availablePANTHERPTHR43757:SF2AMINOMETHYLTRANSFERASE-RELATEDcoord: 5..202
NoneNo IPR availableSUPERFAMILYSSF103025Folate-binding domaincoord: 5..96
IPR013977Glycine cleavage T-protein, C-terminal barrel domainPFAMPF08669GCV_T_Ccoord: 118..197
e-value: 3.4E-18
score: 65.3
IPR006222Aminomethyltransferase, folate-binding domainPFAMPF01571GCV_Tcoord: 5..83
e-value: 1.6E-28
score: 99.8
IPR027266GTP-binding protein TrmE/Glycine cleavage system T protein, domain 1GENE3DG3DSA:3.30.1360.120coord: 2..61
e-value: 1.8E-21
score: 78.5
IPR029043Glycine cleavage T-protein/YgfZ, C-terminalSUPERFAMILYSSF101790Aminomethyltransferase beta-barrel domaincoord: 112..201