Protein CWC15-like protein

Overview
NameProtein CWC15-like protein
Smed IDSMED30012814
Length (bp)827
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein CWC15-like protein (SMED30012814) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein CWC15-like protein (SMED30012814) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein CWC15-like protein (SMED30012814) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein CWC15-like protein (SMED30012814) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012814

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30012814SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30012814SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30012814SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx pouchSMED30012814SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30012814SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
posterior region of the whole animalSMED30012814SMESG000010770.1 SMESG000012375.1 tr5_7361mu_Smed_v1PMID:25558068
Reuter et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30012814SMESG000010770.1 dd_Smed_v4_2881_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012814SMESG000010770.1 dd_Smed_v4_2881_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012814SMESG000010770.1 dd_Smed_v4_2881_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012814SMESG000010770.1 dd_Smed_v4_2881_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012814SMESG000010770.1 dd_Smed_v4_2881_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012814SMESG000010770.1 dd_Smed_v4_2881_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein CWC15-like protein vs. Ensembl Human
Match: CWC15 (CWC15 spliceosome associated protein homolog [Source:HGNC Symbol;Acc:HGNC:26939])

HSP 1 Score: 144.821 bits (364), Expect = 7.008e-42
Identity = 105/229 (45.85%), Postives = 149/229 (65.07%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNRENDSSANKRVKLDKLP--NIDKDD---NREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL--------AYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSK-RGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK E DLS +S+Q S RDLP H K+KYR+  Q  PE+V+ R+ +RE EE+E++  +    +   R     SS +K+ +LD++P  N+D DD   + E E   +   +DD   L AEL+KIK+E+  E+A+ E E+KA+E+ IR++++             +   NF VKRRWDDDV+FKNCAKG  D  K + F+NDTLRSEFHKKFM +YI+
Sbjct:    1 MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK 229          
BLAST of Protein CWC15-like protein vs. Ensembl Celegans
Match: cwc-15 (Spliceosome-associated protein CWC15 homolog [Source:UniProtKB/Swiss-Prot;Acc:O45766])

HSP 1 Score: 107.457 bits (267), Expect = 5.854e-28
Identity = 92/233 (39.48%), Postives = 132/233 (56.65%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNRENDSSANKRVKLDKL-----PNIDKDDNREY--XXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIR----------LKDLAYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKR-GFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T+  A+GG  + E DLS +S Q S +D+P H K+KYR+ GQ    D+++++L     E E  +  +I    +  +  + SS +KR ++D++      ++D D+  +    S+ D   EDD   L AEL+KIK+E+  EKA  + E K +E+  R          L D          +F VKRRWDDDV+FKNCAKG  +  K   FIND +RSEFHKKFM +YI+
Sbjct:    1 MTTAHRPTFHPARGGTARGEGDLSKLSNQYSSKDMPSHTKMKYRQTGQETEADLRKKDL---RRELEDKERNAIREKRARDSASSSSSHSKRQRMDQIAAESAASVDADEAVDELNSSDDDDSDEDDTAALMAELEKIKKERAEEKAARDEEIKEKEEKQRMENILAGNPLLNDTPAGSSTSGGDFTVKRRWDDDVVFKNCAKGVEERKKEVTFINDAIRSEFHKKFMDKYIK 230          
BLAST of Protein CWC15-like protein vs. Ensembl Fly
Match: c12.1 (gene:FBgn0040235 transcript:FBtr0071324)

HSP 1 Score: 113.62 bits (283), Expect = 6.907e-30
Identity = 103/262 (39.31%), Postives = 147/262 (56.11%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXS---------------ITSNYSDRNRENDSSANKRVKLD------------KLPNIDKD---DNREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL-----AYDFERKST------------NFNVKRRWDDDVIFKNCAKGEIDCSKRGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T+D A+GG G+ E DLSA+S+Q S RDLPGH KLKYR+ GQ   ++ + R+ ++E EE+E+                    +       N    SSA KR K D            +  N+D D   DN   +S+SDSD +D  L+  AELQKIK+E+ +E A+ E+EKK +++ IR++++       ++E  +             +  +KRRWDDDV+FKNCA+   D  K  F+ND LRS+FHKKFM +YI+
Sbjct:    1 MTTAARPTFDPARGGSGRGEKDLSALSKQYSSRDLPGHTKLKYRETGQGTSDENRNRDFRKELEEREREARSGTGATSSSSGKALPSIVRKAIEANNAGGGSSAAKRSKPDAGQQQAQQAAQQQAANMDADEPLDNDSSDSDSDSDDDDAALL--AELQKIKQERLQETARRESEKKQEDERIRMENILSGNPLMNYEPGTAASAAGRASGLGGDLKIKRRWDDDVVFKNCARSAPD-KKTHFVNDALRSDFHKKFMDKYIK 259          
BLAST of Protein CWC15-like protein vs. Ensembl Zebrafish
Match: cwc15 (CWC15 spliceosome associated protein homolog [Source:NCBI gene;Acc:415140])

HSP 1 Score: 128.642 bits (322), Expect = 1.469e-35
Identity = 107/245 (43.67%), Postives = 157/245 (64.08%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXX----SITSNYSDRNRENDSSANKRVKLDKLPNIDKD-----DNREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL-------------------AYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRG--FINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK E DLSA+S+Q S RDLPGH K+KYR+  Q  PE+V+ R+ +RE EE+E++  K        + +  +  + SS++KR +LD++P  + D      + E +S SDSDS+DD   L AEL+KIK+E+  E+ + E E+KA+E+ IR++++                        +    F+VKRRWDDDV+FKNCAKG +D S++   F+NDTLRSEFHKKFM +Y++
Sbjct:    1 MTTAARPTFEPARGGRGKGEGDLSALSKQYSSRDLPGHTKIKYRQPTQDAPEEVRARDFRRELEERERAAVKGRDRGAREHTTSSSSSSSSSSSKRPRLDQIPAANLDADDPLTDDEDDSGSDSDSDDDTAALLAELEKIKKERAEEQERKEREQKAEEERIRMENILSGNPLLNLAGQQQQQQQQQQQQTQTKNTFSVKRRWDDDVVFKNCAKG-VDESRKEKRFVNDTLRSEFHKKFMEKYVK 244          
BLAST of Protein CWC15-like protein vs. Ensembl Zebrafish
Match: acsl4b (acyl-CoA synthetase long chain family member 4b [Source:ZFIN;Acc:ZDB-GENE-030131-6493])

HSP 1 Score: 128.642 bits (322), Expect = 1.469e-35
Identity = 107/245 (43.67%), Postives = 157/245 (64.08%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXX----SITSNYSDRNRENDSSANKRVKLDKLPNIDKD-----DNREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL-------------------AYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRG--FINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK E DLSA+S+Q S RDLPGH K+KYR+  Q  PE+V+ R+ +RE EE+E++  K        + +  +  + SS++KR +LD++P  + D      + E +S SDSDS+DD   L AEL+KIK+E+  E+ + E E+KA+E+ IR++++                        +    F+VKRRWDDDV+FKNCAKG +D S++   F+NDTLRSEFHKKFM +Y++
Sbjct:    1 MTTAARPTFEPARGGRGKGEGDLSALSKQYSSRDLPGHTKIKYRQPTQDAPEEVRARDFRRELEERERAAVKGRDRGAREHTTSSSSSSSSSSSKRPRLDQIPAANLDADDPLTDDEDDSGSDSDSDDDTAALLAELEKIKKERAEEQERKEREQKAEEERIRMENILSGNPLLNLAGQQQQQQQQQQQQTQTKNTFSVKRRWDDDVVFKNCAKG-VDESRKEKRFVNDTLRSEFHKKFMEKYVK 244          
BLAST of Protein CWC15-like protein vs. Ensembl Xenopus
Match: ptrh2 (peptidyl-tRNA hydrolase 2 [Source:Xenbase;Acc:XB-GENE-5849009])

HSP 1 Score: 144.436 bits (363), Expect = 8.843e-42
Identity = 107/231 (46.32%), Postives = 153/231 (66.23%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDR-NRENDSSANKRVKLDKLP--NIDKDD---NREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL--------AYDFERKSTNFNVKRRWDDDVIFKNCAKG--EIDCSKRGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK E+DLS +S+Q S RDLP H K+KYR+  Q  PE+V+ R+      E E+ +  ++     DR  RE+ SS +K+ +LD++P  N+D DD   + + + +SD DS+DD   L AEL+KIK+E+  E+A+ E E+KA+E+ IR++++             +    F VKRRWDDDV+FKNCAKG  E+   KR F+NDTLRSEFHKKFM +YI+
Sbjct:    1 MTTAARPTFEPARGGRGKGEADLSQLSKQYSSRDLPSHTKIKYRQATQDAPEEVRSRDF---RRELEERERVAVREKNRDRPTREHASSVSKKPRLDQIPAANLDADDPLTDEDADDDSDEDSDDDTAALLAELEKIKKERAEEQARKELEQKAEEERIRMENILSGNPLLNLTGPAQSVAAFKVKRRWDDDVVFKNCAKGVDEMKKDKR-FVNDTLRSEFHKKFMEKYIK 227          
BLAST of Protein CWC15-like protein vs. Ensembl Mouse
Match: Cwc15 (CWC15 spliceosome-associated protein [Source:MGI Symbol;Acc:MGI:1913320])

HSP 1 Score: 143.665 bits (361), Expect = 1.436e-41
Identity = 105/229 (45.85%), Postives = 149/229 (65.07%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNRENDSSANKRVKLDKLP--NIDKDD---NREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL--------AYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSK-RGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK E DLS +S+Q S RDLP H K+KYR+  Q  PE+V+ R+ +RE EE+E++  +    +   R     SS +K+ +LD++P  N+D DD   + E E   +   +DD   L AEL+KIK+E+  E+A+ E E+KA+E+ IR++++             +   NF VKRRWDDDV+FKNCAKG  D  K + F+NDTLRSEFHKKFM +YI+
Sbjct:    1 MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAARDKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGIDDQKKDKRFVNDTLRSEFHKKFMEKYIK 229          
BLAST of Protein CWC15-like protein vs. Ensembl Mouse
Match: Cwc15 (CWC15 spliceosome-associated protein [Source:MGI Symbol;Acc:MGI:1913320])

HSP 1 Score: 143.665 bits (361), Expect = 1.436e-41
Identity = 105/229 (45.85%), Postives = 149/229 (65.07%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNRENDSSANKRVKLDKLP--NIDKDD---NREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL--------AYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSK-RGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK E DLS +S+Q S RDLP H K+KYR+  Q  PE+V+ R+ +RE EE+E++  +    +   R     SS +K+ +LD++P  N+D DD   + E E   +   +DD   L AEL+KIK+E+  E+A+ E E+KA+E+ IR++++             +   NF VKRRWDDDV+FKNCAKG  D  K + F+NDTLRSEFHKKFM +YI+
Sbjct:    1 MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAARDKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGIDDQKKDKRFVNDTLRSEFHKKFMEKYIK 229          
BLAST of Protein CWC15-like protein vs. Ensembl Mouse
Match: Cwc15 (CWC15 spliceosome-associated protein [Source:MGI Symbol;Acc:MGI:1913320])

HSP 1 Score: 68.1662 bits (165), Expect = 1.799e-14
Identity = 32/59 (54.24%), Postives = 43/59 (72.88%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNL 292
            MTTA R T++ A+GG+GK E DLS +S+Q S RDLP H K+KYR+  Q  PE+V+ R+ 
Sbjct:    1 MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDF 59          
BLAST of Protein CWC15-like protein vs. UniProt/SwissProt
Match: sp|Q6DKE6|CW15B_XENLA (Protein CWC15 homolog B OS=Xenopus laevis OX=8355 GN=cwc15-b PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.795e-42
Identity = 106/233 (45.49%), Postives = 152/233 (65.24%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDR-NRENDSSANKRVKLDKLP--NIDKDD---NREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLK---------DLAYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRG---FINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK ESDLS +S+Q S RDLP H K+KYR+  Q  PE+V+ R+      E E+ +  ++     DR  RE+ SS +K+ +LD++P  N+D DD   + + + +SD DS+DD   L AEL+KIK+E+  E+ + E E+KA+E+ IR++         +L     +   +F VKRRWDDDV+FKNCAKG  +  KR    F+NDTLRSEFHKKFM +Y++
Sbjct:    1 MTTAARPTFEPARGGRGKGESDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRSRDF---RRELEERERVAVRDKNRDRPTREHTSSVSKKPRLDQIPAANLDADDPLTDEDADEDSDEDSDDDTAALLAELEKIKKERAEEQVRKELEQKAEEERIRMENILSGNPLLNLTGPAAQSQASFKVKRRWDDDVVFKNCAKGVDEMKKRQDKRFVNDTLRSEFHKKFMEKYVK 230          
BLAST of Protein CWC15-like protein vs. UniProt/SwissProt
Match: sp|Q6NUB2|CW15A_XENLA (Protein CWC15 homolog A OS=Xenopus laevis OX=8355 GN=cwc15-a PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.480e-41
Identity = 110/231 (47.62%), Postives = 154/231 (66.67%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNRENDSSANKRVKLDKLP--NIDKDD---NREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLK---------DLAYDFERKSTNFNVKRRWDDDVIFKNCAKG--EIDCSKRGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK E DLS +S+Q S RDLP H K+KYR+  Q  PE+V+ R+ +RE EE+E+   +    N     RE+ SS +K+ +LD++P  N+D DD   + + + +SD DS+DD   L AEL+KIK+E+  EK + E E+KA+E+ IR++         +L     +   +F VKRRWDDDV+FKNCAKG  E+   KR F+NDTLRSEFHKKFM +YI+
Sbjct:    1 MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQATQDAPEEVRSRDFRRELEERERVVARD--KNRDRPTREHTSSVSKKPRLDQIPAANLDADDPLTDEDGDEDSDEDSDDDTAALLAELEKIKKERAEEKDRKELEQKAEEERIRMENILSGNPLLNLTGPAAQSQASFKVKRRWDDDVVFKNCAKGVDEMKKQKR-FVNDTLRSEFHKKFMEKYIK 228          
BLAST of Protein CWC15-like protein vs. UniProt/SwissProt
Match: sp|Q5RE65|CWC15_PONAB (Spliceosome-associated protein CWC15 homolog OS=Pongo abelii OX=9601 GN=CWC15 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.365e-41
Identity = 105/229 (45.85%), Postives = 149/229 (65.07%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNRENDSSANKRVKLDKLP--NIDKDD---NREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL--------AYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSK-RGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK E DLS +S+Q S RDLP H K+KYR+  Q  PE+V+ R+ +RE EE+E++  +    +   R     SS +K+ +LD++P  N+D DD   + E E   +   +DD   L AEL+KIK+E+  E+A+ E E+KA+E+ IR++++             +   NF VKRRWDDDV+FKNCAKG  D  K + F+NDTLRSEFHKKFM +YI+
Sbjct:    1 MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK 229          
BLAST of Protein CWC15-like protein vs. UniProt/SwissProt
Match: sp|Q9P013|CWC15_HUMAN (Spliceosome-associated protein CWC15 homolog OS=Homo sapiens OX=9606 GN=CWC15 PE=1 SV=2)

HSP 1 Score: 144.821 bits (364), Expect = 3.365e-41
Identity = 105/229 (45.85%), Postives = 149/229 (65.07%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNRENDSSANKRVKLDKLP--NIDKDD---NREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL--------AYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSK-RGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK E DLS +S+Q S RDLP H K+KYR+  Q  PE+V+ R+ +RE EE+E++  +    +   R     SS +K+ +LD++P  N+D DD   + E E   +   +DD   L AEL+KIK+E+  E+A+ E E+KA+E+ IR++++             +   NF VKRRWDDDV+FKNCAKG  D  K + F+NDTLRSEFHKKFM +YI+
Sbjct:    1 MTTAARPTFEPARGGRGKGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRDRPTREHTTSSSVSKKPRLDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEKIKKERAEEQARKEQEQKAEEERIRMENILSGNPLLNLTGPSQPQANFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK 229          
BLAST of Protein CWC15-like protein vs. UniProt/SwissProt
Match: sp|Q0VFP5|CWC15_XENTR (Protein CWC15 homolog OS=Xenopus tropicalis OX=8364 GN=cwc15 PE=2 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.685e-41
Identity = 107/231 (46.32%), Postives = 153/231 (66.23%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDR-NRENDSSANKRVKLDKLP--NIDKDD---NREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL--------AYDFERKSTNFNVKRRWDDDVIFKNCAKG--EIDCSKRGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK E+DLS +S+Q S RDLP H K+KYR+  Q  PE+V+ R+      E E+ +  ++     DR  RE+ SS +K+ +LD++P  N+D DD   + + + +SD DS+DD   L AEL+KIK+E+  E+A+ E E+KA+E+ IR++++             +    F VKRRWDDDV+FKNCAKG  E+   KR F+NDTLRSEFHKKFM +YI+
Sbjct:    1 MTTAARPTFEPARGGRGKGEADLSQLSKQYSSRDLPSHTKIKYRQATQDAPEEVRSRDF---RRELEERERVAVREKNRDRPTREHASSVSKKPRLDQIPAANLDADDPLTDEDADDDSDEDSDDDTAALLAELEKIKKERAEEQARKELEQKAEEERIRMENILSGNPLLNLTGPAQSVAAFKVKRRWDDDVVFKNCAKGVDEMKKDKR-FVNDTLRSEFHKKFMEKYIK 227          
BLAST of Protein CWC15-like protein vs. TrEMBL
Match: A0A1S8WLR3 (Cwf15/Cwc15 cell cycle control protein OS=Opisthorchis viverrini OX=6198 GN=X801_08822 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.385e-45
Identity = 113/246 (45.93%), Postives = 147/246 (59.76%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDV-----------KERNLXXXXXXXXXXXXXSITSNYSDRNRENDS---------SANKRVKLDKLP-----NIDKDD--NREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDLAYDFE----RKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRGFINDTLRSEFHKKFMSRYIQ 760
            MTTAGR T+D+AKGG+GKWE DLSAMS+Q SVRDLP H KLK R+EGQ RPED+           KE+ L  E   K  +   SIT+      R + +         SA KR K + +      N+D DD  + +YE +++    +          KIK E+  E A+L  E+KA E+ IR++++            + F VKRRWDDDV+FKNCA+GE+D +KRGFINDTLRSEFHKKFM +YIQ
Sbjct:    1 MTTAGRPTWDSAKGGRGKWEGDLSAMSKQYSVRDLPSHTKLKVRQEGQGRPEDLQGKDFKRMLEEKEKRLALEKTGKASATA-SITAPAPGEKRTSTAVDSASATAGSAIKRPKPETIAAVSTANLDADDPWDEDYEEDANDTQVNA---------KIKRERAEEAARLAVERKAAEETIRMENILRGNPLLNASGPSEFKVKRRWDDDVVFKNCARGEVDHTKRGFINDTLRSEFHKKFMKKYIQ 236          
BLAST of Protein CWC15-like protein vs. TrEMBL
Match: A0A564Y5U9 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2851 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 2.430e-44
Identity = 118/266 (44.36%), Postives = 151/266 (56.77%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPE---------DVKERNLXXXXXXXXXXXXXSITSN----YSDRNR------ENDSSA---NKR----VKLDKLP--NIDKDDNREYXXXXXXXXXXX-------------------XLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDLAYDFE----RKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRGFINDTLRSEFHKKFMSRYIQ 760
            MTTAGR T++TAKGGKGKWE DLSA+S+Q SVRDLP H KLKYR+EGQ RPE         D++ER  +   E+  K    +   +    +SD  R      E+D S+   +KR    V +  +P  N+D DD  E +   +                         E  L AEL KIK+E+  E  K  A++KA E+ IR++ +           S  F VKRRWDDDV+FKNCA+GE+D SKRGF+NDTLRSEFHKKFM +YIQ
Sbjct:    1 MTTAGRPTWNTAKGGKGKWEGDLSALSKQYSVRDLPSHTKLKYRQEGQGRPEDLQGKDFKRDLEERERQAALEKAAKKGNLAAPGHAALPHSDEKRPASAITESDRSSGGSSKRPKHTVNVSAVPTANLDADDPWEEDYTEEDQKLTKNDDNSDLSSDDGDDDDDEDEESLLAELAKIKQERAEEAIKAAADRKAAEETIRMEKILKGNPLLNTDNSAEFKVKRRWDDDVVFKNCARGEVDHSKRGFVNDTLRSEFHKKFMKKYIQ 266          
BLAST of Protein CWC15-like protein vs. TrEMBL
Match: A0A1S3I387 (spliceosome-associated protein CWC15 homolog OS=Lingula unguis OX=7574 GN=LOC106160596 PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 2.178e-43
Identity = 114/227 (50.22%), Postives = 153/227 (67.40%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNRENDSSANKRVKLDKLPNID-----KDDNREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKD-------LAYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG GK E DL A+S+Q S RDLP H KLKYR++GQ+  +D++ R+ +   EE+E+           DR+R  DSS++KR +LD++P  +       D+ + E E  SD EDD   L AELQKIK+E+  E AK EAE+KA+E+ IR+++       L    +   T+F VKRRWDDDV+FKNCA+GE D SKRGFIND+LRSEFHKKFM +YI+
Sbjct:    1 MTTAARPTFEPARGGTGKGERDLGALSKQYSSRDLPSHTKLKYRQDGQNTADDLRSRDFRSHLEERER-----AAREKRDRDRGRDSSSSKRPRLDQIPAANLDADDPIDDDDDEEEDSSDDEDDTAALLAELQKIKKERASEAAKKEAERKAEEERIRMENIIKGNPLLHNQADTAKTDFKVKRRWDDDVVFKNCARGEEDKSKRGFINDSLRSEFHKKFMEKYIK 222          
BLAST of Protein CWC15-like protein vs. TrEMBL
Match: I4DK76 (Uncharacterized protein OS=Papilio xuthus OX=66420 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 6.514e-42
Identity = 108/224 (48.21%), Postives = 151/224 (67.41%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNRENDSSANKRVKLDKLP--NIDKDDNREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKD-------LAYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T+D A+GG+G+ E DLSA+SRQ S RDLPGH KLKYR++GQ   E+++ R+ ++E +E+EK       S  S   R+N+  A KR+K+D++P  ++D DD  E +S    DS+DD   L AEL KIK+E+  E+AK +AEKK +E+ IR+++       L Y    +  +  VKRRWDDDV+FKNCA+ E +     FIND+LRSEFHKKFM +Y++
Sbjct:    1 MTTAARPTFDPARGGQGRGEKDLSAISRQYSSRDLPGHTKLKYREQGQGTTEELRSRDFRKELDEREKE------SKGSSARRQNEPPA-KRLKIDQVPAASLDADDPLEGDSTDSDDSDDDTAALLAELNKIKKERAIEQAKKDAEKKQEEERIRMENILSGNPLLNYSAAGQKNDLKVKRRWDDDVVFKNCARSEPEKKLNTFINDSLRSEFHKKFMEKYVK 217          
BLAST of Protein CWC15-like protein vs. TrEMBL
Match: A0A293N5K7 (Uncharacterized protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.583e-41
Identity = 106/220 (48.18%), Postives = 148/220 (67.27%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNRENDSSANKRVKLDKLP--NIDKDDNREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDLAYD---FERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG G+ E DL A+S+Q S RDLPGH KLKYR+ GQ   +++K ++ +RE EE+E+          + R+    SS++KR ++D+LP  N+D DD  E + +S    EDD   L AEL +IK+E+ +E+AK EAE+K QE+ IR++++             F VKRRWDDDV+FKNCAKGE D  ++ FINDTLRSEFHKKFM +Y++
Sbjct:    1 MTTAARPTFEPARGGTGRNEKDLGALSKQYSSRDLPGHTKLKYRQPGQGTSDELKSKDFRRELEERERVVAYERDGKKTSRD---TSSSSKRPRIDQLPAANLDADDPLEEDDDSADSDEDDTAELMAELNRIKKERAQEEAKREAERKLQEEKIRMENILSGNPLLSGGKAEFKVKRRWDDDVVFKNCAKGERDPQEKHFINDTLRSEFHKKFMEKYVK 217          
BLAST of Protein CWC15-like protein vs. Ensembl Cavefish
Match: cwc15 (CWC15 spliceosome associated protein homolog [Source:NCBI gene;Acc:103043448])

HSP 1 Score: 128.642 bits (322), Expect = 8.714e-36
Identity = 108/241 (44.81%), Postives = 157/241 (65.15%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDR-NRENDSSANKRVKLDKLPNIDKD-----DNREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL------------------AYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRG--FINDTLRSEFHKKFMSRYIQ 760
            MTTA R T++ A+GG+GK E DLSA+S+Q S RDLPGH K+KYR+  Q  PE+++ R+ +RE EE+E+   K       +     + SS++KR +LD++P  + D      + E +S+SDSDS+DD   L AEL+KIK+E+  E+ K E E+KA+E+ IR++++                       +  ++F+VKRRWDDDV+FKNCAKG +D S++   FINDTLRSEFHKKFM +Y++
Sbjct:    1 MTTAARPTFEPARGGRGKGEGDLSALSKQYSSRDLPGHTKIKYRQPTQDAPEEIRNRDFRRELEERERVAVKGRERGAREHTTSSSSSSSSKRPRLDQIPAANLDADDPLTDDEDDSDSDSDSDDDTAALLAELEKIKKERAEEQEKKEREQKAEEERIRMENILSGNPLLNLAGQQQQQQQQQQHTQSQSSFSVKRRWDDDVVFKNCAKG-VDESRKEKRFINDTLRSEFHKKFMEKYVK 240          
BLAST of Protein CWC15-like protein vs. Ensembl Sea Lamprey
Match: cwc15 (CWC15 spliceosome associated protein homolog [Source:NCBI gene;Acc:415140])

HSP 1 Score: 82.4185 bits (202), Expect = 7.864e-20
Identity = 65/142 (45.77%), Postives = 93/142 (65.49%), Query Frame = 2
Query:  374 SSANKRVKLDKLP--NIDKDDNREYXXXXXXXXXXX------XLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDLAYDFE----RKSTNFNVKRRWDDDVIFKNCAKGEIDCSK--RGFINDTLRSEFHKKFMSRYI 757
            SS++KR ++D++P  NID DD  E + + D+  +D          L AEL KIK+E+  E++K E E+K++E+ IR +++           +  F VKRRWDDDV+FKNCAKG +D +K  + F+NDTLRSEFHKKFM +YI
Sbjct:    6 SSSSKRPRIDQIPAANIDADDPIESDEDEDASDKDSDDDEDDTAALLAELSKIKKERAEEQSKREREQKSEEEKIRTENILSGNPLMNLTGAEGFKVKRRWDDDVVFKNCAKG-VDETKNEKQFVNDTLRSEFHKKFMDKYI 146          
BLAST of Protein CWC15-like protein vs. Ensembl Nematostella
Match: EDO36355 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIX1])

HSP 1 Score: 132.494 bits (332), Expect = 6.351e-38
Identity = 98/228 (42.98%), Postives = 143/228 (62.72%), Query Frame = 2
Query:  116 MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNRENDSSANKRVKLDKLPNIDKDDN-----------REYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL--AYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRGFINDTLRSEFHKKFMSRYIQ 760
            MTTA R T+DTA+GG+GK E DLSA+S+Q S RDLP H KLK+R+ GQ   E+++ R+L++E EE+          + + R R  + S    V+L K P +++  +            E +    SD EDD   L AELQ+IK+E+ +E+ + E +KK +E+ +R++++          +NF VKRRWDDDV+FKNCAKGE D   + FIND +RS+FH+KFM +YI+
Sbjct:    1 MTTAARPTWDTARGGRGKGEGDLSALSKQYSSRDLPSHNKLKHRQTGQDTTEEIRSRDLRKELEER---------EHQAARERAKEKSGRGLVELPKRPRLEQAASNLDADDPVDDDDEDDDSDASDDEDDTAELLAELQRIKKERAQEELRKEKQKKEEEEKVRMENIMSGNPLLNPQSNFKVKRRWDDDVVFKNCAKGE-DEKGQHFINDMIRSDFHRKFMEKYIK 218          
BLAST of Protein CWC15-like protein vs. Ensembl Medaka
Match: cwc15 (CWC15 spliceosome associated protein homolog [Source:NCBI gene;Acc:101157557])

HSP 1 Score: 130.954 bits (328), Expect = 4.768e-36
Identity = 104/248 (41.94%), Postives = 151/248 (60.89%), Query Frame = 2
Query:  110 INMTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSRPEDVKERNLXXXXXXXXXXXXXSITSNYSDRNREN----DSSANKRVKLDKLPNID------KDDNREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDL-------------------AYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRG--FINDTLRSEFHKKFMSRYIQ 760
            + MTTA R T++ A+GG+GK E DLSA+S+Q S RDLPGH K+KYR+  Q  PE+V+ R+ +RE EEKE+   +  T     R         SS++KR +LD++P  +        D+ E E+  +   +DD   L AEL+KIK+E+  E+ + E E+KA+E+ IR++++                       +   + F VKRRWDDDV+FKNCAKG +D S++   F+NDTLRSEFHKKFM +Y++
Sbjct:   43 LGMTTAARPTFEPARGGRGKGEGDLSALSKQYSSRDLPGHTKIKYRQPTQDAPEEVRARDFRRELEEKERVAAREKTRERGPREHTTSSSSSSSSSKRPRLDQIPAANLDADDPLTDDDEDENSDEDSDDDDTAALLAELEKIKKERAEEQERKEREQKAEEERIRMENILSGNPLINLAGQQQQQQQQQQQQQLVQSTFRVKRRWDDDVVFKNCAKG-VDESRKEKRFVNDTLRSEFHKKFMEKYVK 289          
BLAST of Protein CWC15-like protein vs. Planmine SMEST
Match: SMESG000010770.1 (SMESG000010770.1)

HSP 1 Score: 221.09 bits (562), Expect = 6.850e-73
Identity = 143/143 (100.00%), Postives = 143/143 (100.00%), Query Frame = 2
Query:  332 SITSNYSDRNRENDSSANKRVKLDKLPNIDKDDNREYXXXXXXXXXXXXLMLQAELQKIXXXXXXXXXXXXXXXXXXXDNIRLKDLAYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRGFINDTLRSEFHKKFMSRYIQ 760
            SITSNYSDRNRENDSSANKRVKLDKLPNIDKDDNREYESESDSDSEDDELMLQAELQKIKEEKNREKAKLEAEKKAQEDNIRLKDLAYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRGFINDTLRSEFHKKFMSRYIQ
Sbjct:   21 SITSNYSDRNRENDSSANKRVKLDKLPNIDKDDNREYESESDSDSEDDELMLQAELQKIKEEKNREKAKLEAEKKAQEDNIRLKDLAYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRGFINDTLRSEFHKKFMSRYIQ 163          
The following BLAST results are available for this feature:
BLAST of Protein CWC15-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CWC157.008e-4245.85CWC15 spliceosome associated protein homolog [Sour... [more]
back to top
BLAST of Protein CWC15-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cwc-155.854e-2839.48Spliceosome-associated protein CWC15 homolog [Sou... [more]
back to top
BLAST of Protein CWC15-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
c12.16.907e-3039.31gene:FBgn0040235 transcript:FBtr0071324[more]
back to top
BLAST of Protein CWC15-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cwc151.469e-3543.67CWC15 spliceosome associated protein homolog [Sour... [more]
acsl4b1.469e-3543.67acyl-CoA synthetase long chain family member 4b [S... [more]
back to top
BLAST of Protein CWC15-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ptrh28.843e-4246.32peptidyl-tRNA hydrolase 2 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protein CWC15-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cwc151.436e-4145.85CWC15 spliceosome-associated protein [Source:MGI S... [more]
Cwc151.436e-4145.85CWC15 spliceosome-associated protein [Source:MGI S... [more]
Cwc151.799e-1454.24CWC15 spliceosome-associated protein [Source:MGI S... [more]
back to top
BLAST of Protein CWC15-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DKE6|CW15B_XENLA3.795e-4245.49Protein CWC15 homolog B OS=Xenopus laevis OX=8355 ... [more]
sp|Q6NUB2|CW15A_XENLA1.480e-4147.62Protein CWC15 homolog A OS=Xenopus laevis OX=8355 ... [more]
sp|Q5RE65|CWC15_PONAB3.365e-4145.85Spliceosome-associated protein CWC15 homolog OS=Po... [more]
sp|Q9P013|CWC15_HUMAN3.365e-4145.85Spliceosome-associated protein CWC15 homolog OS=Ho... [more]
sp|Q0VFP5|CWC15_XENTR4.685e-4146.32Protein CWC15 homolog OS=Xenopus tropicalis OX=836... [more]
back to top
BLAST of Protein CWC15-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WLR34.385e-4545.93Cwf15/Cwc15 cell cycle control protein OS=Opisthor... [more]
A0A564Y5U92.430e-4444.36Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A1S3I3872.178e-4350.22spliceosome-associated protein CWC15 homolog OS=Li... [more]
I4DK766.514e-4248.21Uncharacterized protein OS=Papilio xuthus OX=66420... [more]
A0A293N5K72.583e-4148.18Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
back to top
BLAST of Protein CWC15-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cwc158.714e-3644.81CWC15 spliceosome associated protein homolog [Sour... [more]
back to top
BLAST of Protein CWC15-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cwc157.864e-2045.77CWC15 spliceosome associated protein homolog [Sour... [more]
back to top
BLAST of Protein CWC15-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein CWC15-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO363556.351e-3842.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein CWC15-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cwc154.768e-3641.94CWC15 spliceosome associated protein homolog [Sour... [more]
back to top
BLAST of Protein CWC15-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010770.16.850e-73100.00SMESG000010770.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012814 ID=SMED30012814|Name=Protein CWC15-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=827bp
GAAGTTTTAAAAATGAAAACTATTCAAACTATTACATATTTTATATTGCA
ATATTTGGTTAAATATCATATTTATTTGTTATTATTTTAAACATATACAA
TTATTATTAATCAATATGACAACTGCTGGTAGAGCTACTTATGATACAGC
AAAGGGTGGTAAAGGTAAATGGGAAAGTGATCTTAGTGCTATGTCAAGGC
AAGTTTCAGTCAGAGATCTTCCTGGTCACTTAAAATTGAAATATCGTAAA
GAAGGCCAAAGTCGTCCAGAGGATGTTAAAGAACGAAATCTTAAAAGAGA
ATTTGAAGAAAAAGAAAAGTCAAAATACAAATCAATAACCAGTAATTATA
GTGATCGGAATAGAGAAAACGACAGTAGTGCTAATAAGCGAGTGAAACTT
GATAAATTACCCAACATAGATAAAGATGATAATCGAGAATATGAAAGTGA
AAGTGACTCTGATTCTGAAGATGATGAGTTAATGTTACAAGCAGAGTTGC
AAAAAATTAAAGAAGAAAAAAATAGGGAAAAAGCAAAATTGGAAGCTGAG
AAAAAAGCGCAAGAAGATAATATTAGGTTAAAAGATTTAGCTTATGATTT
TGAAAGAAAATCAACTAATTTTAATGTAAAGAGACGATGGGATGATGATG
TGATTTTTAAAAATTGTGCTAAAGGAGAAATTGATTGTTCTAAACGTGGA
TTTATTAATGACACTCTTCGATCGGAATTTCACAAAAAGTTTATGAGTCG
TTATATTCAGTAACTAGCATTTTAATTTATAAATATCCTGTTAAAGTTTA
AAATATATTCTTTATGTTTAAAAAAAA
back to top

protein sequence of SMED30012814-orf-1

>SMED30012814-orf-1 ID=SMED30012814-orf-1|Name=SMED30012814-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=216bp
MTTAGRATYDTAKGGKGKWESDLSAMSRQVSVRDLPGHLKLKYRKEGQSR
PEDVKERNLKREFEEKEKSKYKSITSNYSDRNRENDSSANKRVKLDKLPN
IDKDDNREYESESDSDSEDDELMLQAELQKIKEEKNREKAKLEAEKKAQE
DNIRLKDLAYDFERKSTNFNVKRRWDDDVIFKNCAKGEIDCSKRGFINDT
LRSEFHKKFMSRYIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000062esophagus
PLANA:0000081pharynx pouch
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR006973Cwf_Cwc_15
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0006397mRNA processing
GO:0008380RNA splicing
Vocabulary: cellular component
TermDefinition
GO:0005681spliceosomal complex
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding