Rho guanine nucleotide exchange factor 38

Overview
NameRho guanine nucleotide exchange factor 38
Smed IDSMED30012806
Length (bp)3653
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho guanine nucleotide exchange factor 38 (SMED30012806) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho guanine nucleotide exchange factor 38 (SMED30012806) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho guanine nucleotide exchange factor 38 (SMED30012806) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho guanine nucleotide exchange factor 38 (SMED30012806) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012806

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30012806SMESG000056121.1 SMESG000056110.1 dd_Smed_v4_7179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012806SMESG000056121.1 SMESG000056110.1 dd_Smed_v4_7179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30012806SMESG000056121.1 SMESG000056110.1 dd_Smed_v4_7179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012806SMESG000056121.1 SMESG000056110.1 dd_Smed_v4_7179_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Human
Match: DNMBP (dynamin binding protein [Source:HGNC Symbol;Acc:HGNC:30373])

HSP 1 Score: 154.451 bits (389), Expect = 1.626e-37
Identity = 160/594 (26.94%), Postives = 280/594 (47.14%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDL-GVFAST----LDMMLVKPLQRFLKYPLFLKTIIENTLPDHPD---INDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYN-QTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K+IEE+L+TE+ +I+DL++ +E     +   ++P+ DF  LFG+++ VI V+++ L+ L   + D     AVG VFL      E  YK YC N+D  + L+    K   +   + D L  L  L   +  T    L   L+KP+QR ++YPL L  ++ +T   HPD   + + + A  E +V    INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E     SA      ++           + V  +RG  D   F++ +   +           + LV++PLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    +++L   RN Y A+N  L  ELP     +  +F  C+  Y +     +   +  LK L+   +++  E       H+       Q  + +F P+   +  K          +     L    Y  Q+E     L  ++ PE L + +++F   +   + +  G LVG++K+ +P G    WL++    + GFV  S+L
Sbjct:   67 QRMLEKRAKVIEELLQTERDYIRDLEMCIERIMVPMQQAQVPNIDFEGLFGNMQMVIKVSKQLLAAL--EISD-----AVGPVFLGHRDELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQDSLADLKSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINV---NINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRE-----SACVKVVAAV---------SMWDVCMERGHRDLEQFERVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEELQSARNNYEALNAQLLDELPKFHQYAQGLFTNCVHGYAEAHCDFVHQALEQLKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTK-GFVYSSFL 631          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Human
Match: DNMBP (dynamin binding protein [Source:HGNC Symbol;Acc:HGNC:30373])

HSP 1 Score: 154.836 bits (390), Expect = 3.721e-37
Identity = 158/596 (26.51%), Postives = 281/596 (47.15%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDL-GVFAST----LDMMLVKPLQRFLKYPLFLKTIIENTLPDHPD---INDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKE--ILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYN-QTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K+IEE+L+TE+ +I+DL++ +E     +   ++P+ DF  LFG+++ VI V+++ L+ L  +        AVG VFL      E  YK YC N+D  + L+    K   +   + D L  L  L   +  T    L   L+KP+QR ++YPL L  ++ +T   HPD   + + + A  E +V    INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E   + + +A++                 + V  +RG  D   F++ +   +           + LV++PLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    +++L   RN Y A+N  L  ELP     +  +F  C+  Y +     +   +  LK L+   +++  E       H+       Q  + +F P+   +  K          +     L    Y  Q+E     L  ++ PE L + +++F   +   + +  G LVG++K+ +P G    WL++    + GFV  S+L
Sbjct:  779 QRMLEKRAKVIEELLQTERDYIRDLEMCIERIMVPMQQAQVPNIDFEGLFGNMQMVIKVSKQLLAALEIS-------DAVGPVFLGHRDELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQDSLADLKSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINV---NINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVS----------------MWDVCMERGHRDLEQFERVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEELQSARNNYEALNAQLLDELPKFHQYAQGLFTNCVHGYAEAHCDFVHQALEQLKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTK-GFVYSSFL 1343          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Human
Match: DNMBP (dynamin binding protein [Source:HGNC Symbol;Acc:HGNC:30373])

HSP 1 Score: 152.91 bits (385), Expect = 9.891e-37
Identity = 158/596 (26.51%), Postives = 281/596 (47.15%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDL-GVFAST----LDMMLVKPLQRFLKYPLFLKTIIENTLPDHPD---INDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKE--ILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYN-QTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K+IEE+L+TE+ +I+DL++ +E     +   ++P+ DF  LFG+++ VI V+++ L+ L  +        AVG VFL      E  YK YC N+D  + L+    K   +   + D L  L  L   +  T    L   L+KP+QR ++YPL L  ++ +T   HPD   + + + A  E +V    INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E   + + +A++                 + V  +RG  D   F++ +   +           + LV++PLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    +++L   RN Y A+N  L  ELP     +  +F  C+  Y +     +   +  LK L+   +++  E       H+       Q  + +F P+   +  K          +     L    Y  Q+E     L  ++ PE L + +++F   +   + +  G LVG++K+ +P G    WL++    + GFV  S+L
Sbjct:  411 QRMLEKRAKVIEELLQTERDYIRDLEMCIERIMVPMQQAQVPNIDFEGLFGNMQMVIKVSKQLLAALEIS-------DAVGPVFLGHRDELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQDSLADLKSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINV---NINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVS----------------MWDVCMERGHRDLEQFERVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEELQSARNNYEALNAQLLDELPKFHQYAQGLFTNCVHGYAEAHCDFVHQALEQLKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTK-GFVYSSFL 975          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Human
Match: ARHGEF38 (Rho guanine nucleotide exchange factor 38 [Source:HGNC Symbol;Acc:HGNC:25968])

HSP 1 Score: 137.117 bits (344), Expect = 3.831e-32
Identity = 190/753 (25.23%), Postives = 331/753 (43.96%), Query Frame = 3
Query: 1458 LEKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAV-GSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFAST---LDM--MLVKPLQRFLKYPLFLKTIIENTLPDHPD---INDLIAASSEFDVLAQKINEKKRFEEL----RQITFDRT--EKWHMRTIHAIQKKPKRVI----VSISGAVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCI-----LDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQL----------STSTLQSNILSLKNLIE-GDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLT-LSPFAANKVD---------------LIGSKVISGN--ATYLNNRHSITADSSFDLMQFSPNNHD-DTLRQISMVEISPVKTRPRAFSTANIIRIALFPHQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLSK 3554
            +++ M KR KII+E+++TEK ++ DL++ +    + L   K    D   LF +++SV  ++ + LS L     D    + V G VFLQ     E++YK YC ++D    ++    K   + + +S  +  L  + +       LDM  +++KP+QR +KYPL L  +  +T P HPD   ++D  AA  + +V    INE KR ++L    ++   D +  +K     IH+I KK KRV     +   G  Q +D  +      F+ L+K +   ++ + +   ++++ + L      D   I  +             K  E DY +      N +C      L  L++ PL+ LL LF GP  LI+KR  K +D  +  QR   +E+        D  + +Y A+N  L  EL      +  I   C+ +++ L          + STL    L + ++ E  +Q+  E +  NC    +    F++R L SF  +    I                      + +QT+    KL   +  E L + K+    T+ + I++  G LV ++++ +P G ++ WLV+    + G+V  S+L   +P    KVD                + S+  S +   T  ++    ++  S    +F  N  D D+ +++                    I  A+   Q+R + E+S+Q+  ++ IL   D S ++ W LA+    G +GYVP NYL K
Sbjct:   88 MKRMMAKREKIIKELIQTEKDYLNDLELCVREVVQPLRNKKTDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPLEDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLKKIYMQEGKPNLLDMGSLMIKPIQRVMKYPLLLCELRNSTPPSHPDYRALDDAFAAVKDINV---NINELKRRKDLVLKYKKNDEDESLKDKLSKLNIHSISKKSKRVTNHLKILTRGESQVKDNTFNREEKLFRALEKTVRLCVKNISLCLQHIQDAMPLALQSVMDLQEISYN-------------KDDEMDYSETLSNALN-SCHDFASHLQRLILTPLSALLSLFPGPHKLIQKRYDKLLDCNSYLQRSTGEES--------DLAKKEYEALNAQLVEELQAFNQAARKILLNCLCSFITLLRDLMLVAQQAYSTLVPMPLLVSSISEIQNQVLEEIQNLNCVKENSA--TFIERKL-SFEKKKPVQI-------------------LPEMPHQTDIHRSKLLSTYSAEELYQAKRKCNATQEYDINLLEGDLVAVIEQKDPLGSTSRWLVDTGNVK-GYVYSSFLKPYNPAKMQKVDAENRFCDDDFENISLFVSSRPASDSVTGTSESSIGDSSSSLSGTCGKFETNGTDVDSFQEVD-----------------EQIFYAVHAFQARSDHELSLQEYQRVHILRFCDLSGNKEWWLAEA--QGQKGYVPANYLGK 773          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Human
Match: ARHGEF37 (Rho guanine nucleotide exchange factor 37 [Source:HGNC Symbol;Acc:HGNC:34430])

HSP 1 Score: 114.775 bits (286), Expect = 2.635e-25
Identity = 138/550 (25.09%), Postives = 230/550 (41.82%), Query Frame = 3
Query: 1578 KIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIA-VGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMR------TIHAIQKKPKR---VIVSISGAV-QNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNL----YSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDK--ETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYL---QLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAF--LQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLTL 3161
            ++P  D  +LF ++  +I V   FL  L        +++  VG++FL+     E+VYK YC +YD+ L L++   K   +   +  G+         +S L  +LV PLQR  +YPL L+ I+ENT+PD      L  A S    +   INE K  +E+    + + E+  +R        H + KK  R   ++   +G + + ED E+ ++  +F+ +  C++     V    DNL+  L      Y+    +  ++   N    LH           + F K+         L+ LV  PL  L +   GP  LIKKR  K +D+    +R ++K  E   V   + +  R+ Y A+N+ L  ELP         FN+ +  +L     +  TLQ ++   K +++      E       +H     AF  L  D L        S  +                    +   +E  V  L  ++ P  L +V  +   T    + +  G +V IL+  + +G+S  WLV+    R G+VP   L L
Sbjct:   62 QLPQGDLDVLFSNIDDIIKVNSRFLHDLQETASKEEEQVQLVGNIFLEFQEELEQVYKVYCASYDQALLLVDTYRKEPELQRHI-QGIVEAVVPQAGSSGLSFLLVIPLQRITRYPLLLQKILENTVPDASAYPVLQRAVSALQDVNTNINEYKMRKEVAS-KYTKVEQLTLRERLARINTHTLSKKTTRLSQLLKQEAGLIPRTEDKEFDDLEERFQWVSLCVTELKNNVAAYLDNLQAFLYFRPHEYNLDIPEGPAVQYCNLARDLHL----------EAFLKFKQR------LEGLVWQPLCSLAKALLGPQNLIKKRLDKLLDF----ERVEEKLLEVGSVTYQE-EAARHTYQALNSLLVAELP--------QFNQLVMQWLGQIMCTFVTLQRDL--AKQVLQ----RAEGSMAQLPHHHVPEPAFRKLVEDALGRTSNQLRSFQE-------TFEKVQPPPTTQPLLPGSERQVQALLSRYGPGKLYQVTSNISGTGTLDLTLPRGQIVAILQNKDTKGNSGRWLVDTGGHR-GYVPAGKLQL 566          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Celegans
Match: Y37A1B.17 (pep chromosome:WBcel235:IV:13964367:13979847:-1 gene:WBGene00044989.1 transcript:Y37A1B.17a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37A1B.17)

HSP 1 Score: 66.2402 bits (160), Expect = 1.634e-10
Identity = 83/326 (25.46%), Postives = 134/326 (41.10%), Query Frame = 3
Query: 1698 VGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQ--ITFDRTEKWHM---RTIHAIQKKPKRVIVSISGAVQN----EDTEYQEIVIKFKELKKCISFFIETVFILRDNL---KEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLD--QLRNQYLAINNTLKHELP 2633
            +G+ FLQ    F + Y  Y  N +    L N       +   + D + R+ + G         + +P+QR  KYPLFL  I++ T   H D   L  A  +   L QK+NE KR +EL Q  ++ D+     M    T H+++KK  R    +  ++       DT++  +V +    ++ +  F   + I R  +     +L     +      +  S    QL  +  A         K + + AN   I D +V         L S P  LIKKR  K +DY A +       T    + K D  +++  Y A+N  +K +LP
Sbjct:  535 IGACFLQLRKPFAQTYGFYFRNIEHINALTNSAKHEKTMESALQDIVKRMRESGSVVIDGPTAVSRPIQRATKYPLFLNEIVKLTPLVHTDHPKLTEAIKQMSNLGQKMNESKRRKELTQKYMSDDKQTFGEMLSKMTFHSLKKKSNRFTYRMGSSLGVVKLLRDTDFDRLVCELDSAERRLVRFNYMMVIYRKKMFHETRVLMHKKVVEPRKKHLSSSEIDLQLQPFNHA--------IKTWASEAN-VRIRDEIV-------KALRSIPKRLIKKRNDKLMDYEASR-------TKEKGLGKRDFAEIQKDYEALNTQVKQQLP 837          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Celegans
Match: Y37A1B.17 (pep chromosome:WBcel235:IV:13964359:13979696:-1 gene:WBGene00044989.1 transcript:Y37A1B.17c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37A1B.17)

HSP 1 Score: 66.2402 bits (160), Expect = 1.683e-10
Identity = 83/326 (25.46%), Postives = 134/326 (41.10%), Query Frame = 3
Query: 1698 VGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQ--ITFDRTEKWHM---RTIHAIQKKPKRVIVSISGAVQN----EDTEYQEIVIKFKELKKCISFFIETVFILRDNL---KEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLD--QLRNQYLAINNTLKHELP 2633
            +G+ FLQ    F + Y  Y  N +    L N       +   + D + R+ + G         + +P+QR  KYPLFL  I++ T   H D   L  A  +   L QK+NE KR +EL Q  ++ D+     M    T H+++KK  R    +  ++       DT++  +V +    ++ +  F   + I R  +     +L     +      +  S    QL  +  A         K + + AN   I D +V         L S P  LIKKR  K +DY A +       T    + K D  +++  Y A+N  +K +LP
Sbjct:  398 IGACFLQLRKPFAQTYGFYFRNIEHINALTNSAKHEKTMESALQDIVKRMRESGSVVIDGPTAVSRPIQRATKYPLFLNEIVKLTPLVHTDHPKLTEAIKQMSNLGQKMNESKRRKELTQKYMSDDKQTFGEMLSKMTFHSLKKKSNRFTYRMGSSLGVVKLLRDTDFDRLVCELDSAERRLVRFNYMMVIYRKKMFHETRVLMHKKVVEPRKKHLSSSEIDLQLQPFNHA--------IKTWASEAN-VRIRDEIV-------KALRSIPKRLIKKRNDKLMDYEASR-------TKEKGLGKRDFAEIQKDYEALNTQVKQQLP 700          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Celegans
Match: Y37A1B.17 (pep chromosome:WBcel235:IV:13964367:13978981:-1 gene:WBGene00044989.1 transcript:Y37A1B.17c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y37A1B.17)

HSP 1 Score: 66.2402 bits (160), Expect = 1.683e-10
Identity = 83/326 (25.46%), Postives = 134/326 (41.10%), Query Frame = 3
Query: 1698 VGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQ--ITFDRTEKWHM---RTIHAIQKKPKRVIVSISGAVQN----EDTEYQEIVIKFKELKKCISFFIETVFILRDNL---KEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLD--QLRNQYLAINNTLKHELP 2633
            +G+ FLQ    F + Y  Y  N +    L N       +   + D + R+ + G         + +P+QR  KYPLFL  I++ T   H D   L  A  +   L QK+NE KR +EL Q  ++ D+     M    T H+++KK  R    +  ++       DT++  +V +    ++ +  F   + I R  +     +L     +      +  S    QL  +  A         K + + AN   I D +V         L S P  LIKKR  K +DY A +       T    + K D  +++  Y A+N  +K +LP
Sbjct:  398 IGACFLQLRKPFAQTYGFYFRNIEHINALTNSAKHEKTMESALQDIVKRMRESGSVVIDGPTAVSRPIQRATKYPLFLNEIVKLTPLVHTDHPKLTEAIKQMSNLGQKMNESKRRKELTQKYMSDDKQTFGEMLSKMTFHSLKKKSNRFTYRMGSSLGVVKLLRDTDFDRLVCELDSAERRLVRFNYMMVIYRKKMFHETRVLMHKKVVEPRKKHLSSSEIDLQLQPFNHA--------IKTWASEAN-VRIRDEIV-------KALRSIPKRLIKKRNDKLMDYEASR-------TKEKGLGKRDFAEIQKDYEALNTQVKQQLP 700          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Celegans
Match: uig-1 (UNC-112-Interacting Guanine nucleotide exchange factor [Source:UniProtKB/TrEMBL;Acc:H1UBJ0])

HSP 1 Score: 60.8474 bits (146), Expect = 5.452e-9
Identity = 54/192 (28.12%), Postives = 92/192 (47.92%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVL---AQKIN-EKKRFEELRQITFDRT--EKW 2084
            + LK+TL+A                 LFG ++ + A  ++  ++L A     LD + +   F++S   FE+ Y EYC NY R +  +    +   V   + +    LN     +  L   L+KP+QR LKY LFL+ I++N +P      +LI      +V+   A +IN EKK+ E + ++   ++  +KW
Sbjct:  258 EKLKVTLDAISS--------------LFGCIERIFAFNKQLYNQLDA---ADLDCVKMSRCFVESSGKFED-YIEYCTNYHRMMSTLYHLQQQPLVARALQERQLALN----HSLQLSAYLLKPVQRILKYHLFLENILKN-MPSTTHPEELIQVKRAHEVMTSQAARINDEKKKAEHIERVGQLQSTLQKW 426          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Celegans
Match: uig-1 (UNC-112-Interacting Guanine nucleotide exchange factor [Source:UniProtKB/TrEMBL;Acc:H1UBJ0])

HSP 1 Score: 60.8474 bits (146), Expect = 5.615e-9
Identity = 54/192 (28.12%), Postives = 92/192 (47.92%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVL---AQKIN-EKKRFEELRQITFDRT--EKW 2084
            + LK+TL+A                 LFG ++ + A  ++  ++L A     LD + +   F++S   FE+ Y EYC NY R +  +    +   V   + +    LN     +  L   L+KP+QR LKY LFL+ I++N +P      +LI      +V+   A +IN EKK+ E + ++   ++  +KW
Sbjct:  291 EKLKVTLDAISS--------------LFGCIERIFAFNKQLYNQLDA---ADLDCVKMSRCFVESSGKFED-YIEYCTNYHRMMSTLYHLQQQPLVARALQERQLALN----HSLQLSAYLLKPVQRILKYHLFLENILKN-MPSTTHPEELIQVKRAHEVMTSQAARINDEKKKAEHIERVGQLQSTLQKW 459          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Fly
Match: sif (gene:FBgn0085447 transcript:FBtr0330126)

HSP 1 Score: 63.929 bits (154), Expect = 1.222e-9
Identity = 48/187 (25.67%), Postives = 87/187 (46.52%), Query Frame = 3
Query: 1575 TKIPDQDFHLLFGDLKSVIAVAEEFLSKL--SANMEDGLDKI-----------AVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMRT 2096
            T + + + + LFG++  ++    +FL  L  S ++E   +K            A+GS FL  V+ F+ +Y  +C ++ +   +++       + +F    L   N     +STL+  L+KP+QR LKYPL L+ +   T     +   L  A    + +A+ INE +R  E     FD   + H ++
Sbjct: 1459 TFLSNAEINALFGNIHEIVTFQRQFLQNLEESLDLEPDFNKFEHCGQFRNVLFAIGSAFLYYVNHFK-LYSSFCASHSKAQKVLHPNEGNHALQEF----LAARNPKQQHSSTLESYLIKPIQRILKYPLLLQQMRNLTDTRADEHVHLCEALKGMEKVAEHINEMQRIHEEYGAIFDHLFRQHQKS 1640          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Fly
Match: sif (gene:FBgn0085447 transcript:FBtr0330123)

HSP 1 Score: 63.929 bits (154), Expect = 1.227e-9
Identity = 48/187 (25.67%), Postives = 87/187 (46.52%), Query Frame = 3
Query: 1575 TKIPDQDFHLLFGDLKSVIAVAEEFLSKL--SANMEDGLDKI-----------AVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMRT 2096
            T + + + + LFG++  ++    +FL  L  S ++E   +K            A+GS FL  V+ F+ +Y  +C ++ +   +++       + +F    L   N     +STL+  L+KP+QR LKYPL L+ +   T     +   L  A    + +A+ INE +R  E     FD   + H ++
Sbjct: 1489 TFLSNAEINALFGNIHEIVTFQRQFLQNLEESLDLEPDFNKFEHCGQFRNVLFAIGSAFLYYVNHFK-LYSSFCASHSKAQKVLHPNEGNHALQEF----LAARNPKQQHSSTLESYLIKPIQRILKYPLLLQQMRNLTDTRADEHVHLCEALKGMEKVAEHINEMQRIHEEYGAIFDHLFRQHQKS 1670          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Fly
Match: sif (gene:FBgn0085447 transcript:FBtr0112709)

HSP 1 Score: 63.5438 bits (153), Expect = 1.401e-9
Identity = 48/187 (25.67%), Postives = 87/187 (46.52%), Query Frame = 3
Query: 1575 TKIPDQDFHLLFGDLKSVIAVAEEFLSKL--SANMEDGLDKI-----------AVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMRT 2096
            T + + + + LFG++  ++    +FL  L  S ++E   +K            A+GS FL  V+ F+ +Y  +C ++ +   +++       + +F    L   N     +STL+  L+KP+QR LKYPL L+ +   T     +   L  A    + +A+ INE +R  E     FD   + H ++
Sbjct: 1450 TFLSNAEINALFGNIHEIVTFQRQFLQNLEESLDLEPDFNKFEHCGQFRNVLFAIGSAFLYYVNHFK-LYSSFCASHSKAQKVLHPNEGNHALQEF----LAARNPKQQHSSTLESYLIKPIQRILKYPLLLQQMRNLTDTRADEHVHLCEALKGMEKVAEHINEMQRIHEEYGAIFDHLFRQHQKS 1631          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Fly
Match: sif (gene:FBgn0085447 transcript:FBtr0112712)

HSP 1 Score: 63.5438 bits (153), Expect = 1.411e-9
Identity = 48/187 (25.67%), Postives = 87/187 (46.52%), Query Frame = 3
Query: 1575 TKIPDQDFHLLFGDLKSVIAVAEEFLSKL--SANMEDGLDKI-----------AVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMRT 2096
            T + + + + LFG++  ++    +FL  L  S ++E   +K            A+GS FL  V+ F+ +Y  +C ++ +   +++       + +F    L   N     +STL+  L+KP+QR LKYPL L+ +   T     +   L  A    + +A+ INE +R  E     FD   + H ++
Sbjct: 1470 TFLSNAEINALFGNIHEIVTFQRQFLQNLEESLDLEPDFNKFEHCGQFRNVLFAIGSAFLYYVNHFK-LYSSFCASHSKAQKVLHPNEGNHALQEF----LAARNPKQQHSSTLESYLIKPIQRILKYPLLLQQMRNLTDTRADEHVHLCEALKGMEKVAEHINEMQRIHEEYGAIFDHLFRQHQKS 1651          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Fly
Match: sif (gene:FBgn0085447 transcript:FBtr0112710)

HSP 1 Score: 63.5438 bits (153), Expect = 1.414e-9
Identity = 48/187 (25.67%), Postives = 87/187 (46.52%), Query Frame = 3
Query: 1575 TKIPDQDFHLLFGDLKSVIAVAEEFLSKL--SANMEDGLDKI-----------AVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMRT 2096
            T + + + + LFG++  ++    +FL  L  S ++E   +K            A+GS FL  V+ F+ +Y  +C ++ +   +++       + +F    L   N     +STL+  L+KP+QR LKYPL L+ +   T     +   L  A    + +A+ INE +R  E     FD   + H ++
Sbjct: 1459 TFLSNAEINALFGNIHEIVTFQRQFLQNLEESLDLEPDFNKFEHCGQFRNVLFAIGSAFLYYVNHFK-LYSSFCASHSKAQKVLHPNEGNHALQEF----LAARNPKQQHSSTLESYLIKPIQRILKYPLLLQQMRNLTDTRADEHVHLCEALKGMEKVAEHINEMQRIHEEYGAIFDHLFRQHQKS 1640          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Zebrafish
Match: dnmbp (dynamin binding protein [Source:NCBI gene;Acc:100005174])

HSP 1 Score: 151.369 bits (381), Expect = 2.293e-36
Identity = 145/572 (25.35%), Postives = 256/572 (44.76%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILD-----------SLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQ-YRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            +DL++ ++   + L   ++   DF  LFG++ SVI ++      L        D  ++G VFL      E+VYK YC N+D  + L+    K  N+   V + L +L     + + L   L+KP+QR ++YPL L  ++  T   H D   L  A      +   INE KR ++L    R+   DR  +K    ++H+I KK  RV   +  ++G + Q +D  + +   +F+  ++ I  FI  + +   +++E  ++       F  I           Y    ++ + + F++ +      CI D           +LV+ PL +LL +F+GP  LI+KR+ K +DY   K+R +  +  RVQ ++L   RN Y A+N  L  ELP     +  +F  C+  ++Q     +   +  L  L+        EG+ +S  +E+         +L  LQ    SF P+    ++ K                       QT+     L  ++ PENL + +++F   +   + +  G +VG++K+ +P G    WL++    + GFV  S+L
Sbjct:  769 KDLQMCVKEIIQPLQKKQVQGIDFDGLFGNISSVIDLSRRLNKTLQ-------DTDSIGQVFLSYKDQLEDVYKIYCQNHDDAISLLETYEKDENIQKHVLECLEKLRGKTNYIN-LGSFLIKPVQRVMRYPLLLMELLNTTPESHHDRQQLSEAVMSIKEINVNINEYKRRKDLVVKYRKGDEDRLIDKISKLSMHSIIKKSNRVSSHLKHLTGISPQIKDEAFDDAEKRFRLQERLIKSFIRNISLYLQHIRESASVKVLAAISFCDI-----------YTERQQQMDPERFQRAHR-----CISDKQFTEFKERTEALVITPLTQLLNMFTGPHKLIQKRRDKLLDYDNCKERAERLKDKRVQ-EELQTARNNYEALNAQLLDELPKFHRAAEDLFTSCVRGFVQAQRDFISLTLGELTPLLQLSGLGGTEGNLVSLFQEE------HTRVLDLLQS--FSFFPENLPTTVRKTFEKKTLEKQYTKKPQAPPNYVLQTDEHRAGLLVRYGPENLYQAERNFNAAQDLDVSVLEGDIVGVIKQQDPMGSQNRWLIDNGVTK-GFVYSSFL 1306          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Zebrafish
Match: dnmbp (dynamin binding protein [Source:NCBI gene;Acc:100005174])

HSP 1 Score: 150.984 bits (380), Expect = 3.072e-36
Identity = 146/579 (25.22%), Postives = 257/579 (44.39%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFAS-------TLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILD-----------SLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQ-YRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            +DL++ ++   + L   ++   DF  LFG++ SVI ++      L        D  ++G VFL      E+VYK YC N+D  + L+    K  N+   V + L +L   G++          L   L+KP+QR ++YPL L  ++  T   H D   L  A      +   INE KR ++L    R+   DR  +K    ++H+I KK  RV   +  ++G + Q +D  + +   +F+  ++ I  FI  + +   +++E  ++       F  I           Y    ++ + + F++ +      CI D           +LV+ PL +LL +F+GP  LI+KR+ K +DY   K+R +  +  RVQ ++L   RN Y A+N  L  ELP     +  +F  C+  ++Q     +   +  L  L+        EG+ +S  +E+         +L  LQ    SF P+    ++ K                       QT+     L  ++ PENL + +++F   +   + +  G +VG++K+ +P G    WL++    + GFV  S+L
Sbjct:  769 KDLQMCVKEIIQPLQKKQVQGIDFDGLFGNISSVIDLSRRLNKTLQ-------DTDSIGQVFLSYKDQLEDVYKIYCQNHDDAISLLETYEKDENIQKHVLECLEKLR--GIYREWGKTNYINLGSFLIKPVQRVMRYPLLLMELLNTTPESHHDRQQLSEAVMSIKEINVNINEYKRRKDLVVKYRKGDEDRLIDKISKLSMHSIIKKSNRVSSHLKHLTGISPQIKDEAFDDAEKRFRLQERLIKSFIRNISLYLQHIRESASVKVLAAISFCDI-----------YTERQQQMDPERFQRAHR-----CISDKQFTEFKERTEALVITPLTQLLNMFTGPHKLIQKRRDKLLDYDNCKERAERLKDKRVQ-EELQTARNNYEALNAQLLDELPKFHRAAEDLFTSCVRGFVQAQRDFISLTLGELTPLLQLSGLGGTEGNLVSLFQEE------HTRVLDLLQS--FSFFPENLPTTVRKTFEKKTLEKQYTKKPQAPPNYVLQTDEHRAGLLVRYGPENLYQAERNFNAAQDLDVSVLEGDIVGVIKQQDPMGSQNRWLIDNGVTK-GFVYSSFL 1312          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Zebrafish
Match: dnmbp (dynamin binding protein [Source:NCBI gene;Acc:100005174])

HSP 1 Score: 150.599 bits (379), Expect = 4.206e-36
Identity = 145/568 (25.53%), Postives = 254/568 (44.72%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFAS-------TLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQ-YRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            +DL++ ++   + L   ++   DF  LFG++ SVI ++      L        D  ++G VFL      E+VYK YC N+D  + L+    K  N+   V + L +L   G++          L   L+KP+QR ++YPL L  ++  T   H D   L  A      +   INE KR ++L    R+   DR  +K    ++H+I KK  RV   +  ++G + Q +D  + +   +F+  ++ I  FI  + +   +++E  ++       F  I                 R  +D  K++     +T   ++LV+ PL +LL +F+GP  LI+KR+ K +DY   K+R +  +  RVQ ++L   RN Y A+N  L  ELP     +  +F  C+  ++Q     +   +  L  L+        EG+ +S  +E+         +L  LQ    SF P+    ++ K                       QT+     L  ++ PENL + +++F   +   + +  G +VG++K+ +P G    WL++    + GFV  S+L
Sbjct:  867 KDLQMCVKEIIQPLQKKQVQGIDFDGLFGNISSVIDLSRRLNKTLQ-------DTDSIGQVFLSYKDQLEDVYKIYCQNHDDAISLLETYEKDENIQKHVLECLEKLR--GIYREWGKTNYINLGSFLIKPVQRVMRYPLLLMELLNTTPESHHDRQQLSEAVMSIKEINVNINEYKRRKDLVVKYRKGDEDRLIDKISKLSMHSIIKKSNRVSSHLKHLTGISPQIKDEAFDDAEKRFRLQERLIKSFIRNISLYLQHIRESASVKVLAAISFCDIYTERQQQMDPERFQRAHRCISD--KQFTEFKERT---EALVITPLTQLLNMFTGPHKLIQKRRDKLLDYDNCKERAERLKDKRVQ-EELQTARNNYEALNAQLLDELPKFHRAAEDLFTSCVRGFVQAQRDFISLTLGELTPLLQLSGLGGTEGNLVSLFQEE------HTRVLDLLQS--FSFFPENLPTTVRKTFEKKTLEKQYTKKPQAPPNYVLQTDEHRAGLLVRYGPENLYQAERNFNAAQDLDVSVLEGDIVGVIKQQDPMGSQNRWLIDNGVTK-GFVYSSFL 1410          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Zebrafish
Match: arhgef38 (Rho guanine nucleotide exchange factor (GEF) 38 [Source:ZFIN;Acc:ZDB-GENE-090313-83])

HSP 1 Score: 135.576 bits (340), Expect = 6.842e-32
Identity = 180/730 (24.66%), Postives = 323/730 (44.25%), Query Frame = 3
Query: 1455 ILEKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMED-GLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSD-------GLNRLNDLGVFASTLDM--MLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTE-------KWHMRTIHAIQKKPKR------VIVSISGAVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLA-MKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQLSTEE---EQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLTLSPFAANKVDLIGSKVISGNATYLNNRHSITADSSFD-LMQFSPNNHDDTLRQISMVE-ISPVKTRPRAFSTANIIRI-ALFPHQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLSK 3554
            I  +KM KRSK+IEE++ TE  + +DL++ +      L   ++ D D   LF +++SV  V+ + L +L   + D   +   +G VF+Q+ +  EEVYK YC ++D      N   K+    + +          L ++ DL    + LDM  +L+KP+QR +KYPL L  +   T  DHPD   L  A +   ++   INE KR +++  + + R++       K +   IH+I+KK  R      ++  +   V++E  + +E +  F+ L+K +   ++ +       +E++++      D  SI+K     ++       K+   D +K +         ++ LVV PL+ LL +F+ P  LI+KR  K +DY + +  R  ++E    + D        Y A+N  L  EL      +  I   C+   ++L           ++ L++  Q   ++      N    QN I+  L    L F  +     N        ++       +   +  QTE    +L E++  + L ++K++    +   I +  G LV +L+  +P G S+ WLV     + G+V  S+L                       Y   R        FD L  F   +   ++R  S  + +SP         T++     A++  ++R E E+++Q+   + IL+  D   +++W LA++   G +GYVP NYL K
Sbjct:  105 IRHRKMIKRSKVIEELVRTEGDYQRDLELCINEVLLPLREAQVVDVD--RLFTNIESVCDVSNDLLLRLQDAIADPDPETQLIGEVFIQTKAVIEEVYKIYCYHHDE----ANASLKSYEAQEDIQQQFRRCISALKKIYDLEGKPNLLDMGSLLIKPVQRIMKYPLLLAELWNATPTDHPDHRPLQEALTTVKIINININEFKRRKDI-VLKYKRSDDETSLMGKLNKFNIHSIRKKSDRLTSYFKILTGVEPQVRDEAFDKEEKL--FRNLEKAVRQLVKNISCYLLYTQEMISVAVQNAQDLESIMKD--PDKIDTNGFHQKKNGNDPYKHFKDH------MEHLVVAPLSSLLGMFASPQKLIQKRYDKLLDYCSQLDSRSSNEEQGLAKRD--------YEALNAQLLEELQCFNQAARTILTNCLICIVKL-----------IRKLMDAAQPPVQQLPVPLSNFNEVQNSIMEELSN--LGFFKE-----NSQKLMERKVSFEKREKKMAPEILRQTEEQRARLLEEYPVKQLYQLKRNCNACQEKDISLLEGELVALLEDRDPMGSSSRWLVHTGSVQ-GYVYSSFLK---------------------AYNPQREVTERPDDFDNLSLFVSASRSSSMRSFSTSDSVSPQSAPQDELDTSDDQHFYAVYAFKARCEQELTLQEYQHVRILQFSDLGGNKDWWLAES--NGQKGYVPANYLGK 767          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Zebrafish
Match: arhgef37 (Rho guanine nucleotide exchange factor (GEF) 37 [Source:ZFIN;Acc:ZDB-GENE-100514-3])

HSP 1 Score: 95.5153 bits (236), Expect = 1.906e-19
Identity = 151/592 (25.51%), Postives = 236/592 (39.86%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKL-SANMEDGLDKI--AVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINK-KSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTE------KWHMRTIHAIQKKPKRVIVSISGAVQNEDTEYQEIVIKFK--ELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFY--LVACKRGETD---------YFKKYYTVANKTCI-------LDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKS-----------SVIFNECIGNYLQLSTS---TLQSNILSLKNLIEGDQLSTEEEQRN----CRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLT 3158
            + L+I     + NL   + P  +   +F  +  V+ V+   LS L  A M+    K    +   FL      E  YKEY  NY+    L N  K K +   + V    +   D  V ASTL   LV P+QR  +YPL  +TI ++T P HP   +L   +     +  +INE KRF E+    + +TE      K +  + H+I KK  R     S  +++E      IV K K  E      FF    F+L   + E               +  N  + LH     ++C+  E D          F K  TVA +  I       L +LV  PL+ L EL +GP  LI+KRQ K +DY  +      +E S +  ++   + N Y  +N  L +ELP    K+           SV+  +   +  QL+TS    L  + L   +  +  + S  E        CR+ Q+E+ A + + L        N+++K                            ++ L      E + ++    V T+   + +  G LV ++   + +G    WLV+    R G+VP S L 
Sbjct:   75 KHLQICTVTINSNLQKLQPPPPNLENMFQHIDEVMEVSSRLLSLLDQAQMQHSDPKYLETLCDSFLSLSQDIEMAYKEYLANYNNITALENSYKQKEALWMEMVRIIKSSAPD--VNASTLSFFLVMPVQRIARYPLLFQTIQKHTDPQHPAYPELEHTAHTAIQINCRINEYKRFREVAD-KYKKTENLTIKDKLNRLSGHSIAKKTAR----FSQYIKHETG----IVPKLKDEEFDALAGFF----FVLERGVSE---------------LHDNLLTYLHHLQRFLSCRPEEADLDLEGEKTALFSKEITVALRQWIYPSYEKRLKTLVFKPLSSLRELMAGPRNLIRKRQDKLLDYEPI------EEKSNLTFEE-QAIANTYKTMNTLLLNELPQFNGKALQLMWAALEAFSVLQRDLATDMEQLATSFTHQLPHSYLEAGDFWKWAETSVLEGSWRMESLCRSVQDELNAPIVQAL--------NTVSK--------------------------KRLMYLNANHGSEKIYQLTGPVVGTRDLDLTLNKGELVAVVCEMDTRGDRRRWLVDAGGPR-GYVPASKLA 594          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Xenopus
Match: tlx3 (T cell leukemia homeobox 3 [Source:Xenbase;Acc:XB-GENE-495044])

HSP 1 Score: 163.31 bits (412), Expect = 5.234e-40
Identity = 196/808 (24.26%), Postives = 363/808 (44.93%), Query Frame = 3
Query: 1434 ESIKLGSILE----KKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSK----ASNVTDFVSDGLNRLNDLGVFAS-TLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL--------RQITFDRTEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKE--------ILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDL-LSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLT-LSPFAANKVDLIGSKVISGNATYLNNRHSITADSSFDLMQFSPNNHD-------------DTLRQISMVEISP-------------------------VKTRPRAFSTANIIR------------------------IALFPHQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLSK 3554
            +++  GS  E    + ++KRSK+IEE+L+TE+ +++DL+  +E     + P ++   DF +LFG+++SVI ++++FL+ L ++        +VG+VFL   S  E VYKEYC N++  + L+    K      N+ + +    N   + G      L   L+KP+QR ++YPL L  ++  T   HPD   L  A      +   INE KR ++L             D+  K +   IH+I KK  RV   I  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E         ++++   +D  TS ++     + H Y+   ++  TD+ ++           + LV++PLN+LL +F+GP  L++KR  K +D+    +R +  +  + Q ++L   RN Y A+N  L  ELP   + +  +F  C+  Y       ++  +  LK L+        EG+ ++  +E+ +    Q ++  F   +L  S  P  R +I +               + R  + +  +   + +  ++ PE L +  + +   +   + +  G LVG++K+ +P G    WL++    + GFV  S+L   +P  ++    +GS+  S  + Y  +  + +  +S + + F+P N               D+    S  E SP                         V  + + F +   IR                         A++  +SR  +E+S+  N ++ ILE  D + +  W LA+    G +GYVP+NY+ K
Sbjct:  404 QTLSTGSTTENSEQRMLEKRSKVIEELLQTEQDYLRDLETCVEHI---MGPLQMASVDFDVLFGNIQSVIDISKKFLTALGSS-------DSVGTVFLDHASDLENVYKEYCQNHEETIALLEAYDKDEKFQKNLLECMETVKNLYQEWGRTNYINLGSFLIKPVQRIMRYPLLLMELLGATPDSHPDKAPLREAVQSVKDINGNINEYKRRKDLVLKYRKGDENSLIDKISKLN---IHSIIKKSNRVSSHIKQLTGFAPQIKDEAFEETEKNFRMQERLIKSFIRDLSVYLQHVRESACVKVLAAMSMWDLYSDKGTSDLEK--FHKAHRYI--SEKLFTDFKQR----------TEKLVISPLNQLLNMFAGPHKLVQKRFDKLLDFHNCTERAEKLKDKKTQ-EELQSARNNYEALNAQLLDELPKFHNFAKELFASCMRGYASAHCEFVKLALEELKPLLTLLGVGATEGNLIAVFQEEHSKVLQQLQVFTFFPENLPPSKKPFERKTIER--------------QSARKTIPSPLDEHRVAVLARYPPEKLFQADRIYNAAQDLDVSLQEGDLVGVIKQQDPMGSQNRWLIDNGVTK-GFVYCSFLKPYNPRQSHSDASVGSQS-STESGYGGSSPNFSRQNSNNTLTFNPGNSTVAFTAGSIAKHSMDSTSTSSGQEDSPVCLPDGNLSKKSSETEVRQTENENSVGDKEQTFESRKAIRKKTASPAHSDCEQDVCELEGNQVYYAVYTFKSRSPNELSVSANQRVNILEFRDMNGNGEWWLAE--VEGRRGYVPSNYIRK 1165          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Xenopus
Match: tlx3 (T cell leukemia homeobox 3 [Source:Xenbase;Acc:XB-GENE-495044])

HSP 1 Score: 157.147 bits (396), Expect = 5.902e-38
Identity = 169/664 (25.45%), Postives = 314/664 (47.29%), Query Frame = 3
Query: 1422 ENDYESIKLGSILE----KKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSK----ASNVTDFVSDGLNRLN--DLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL--------RQITFDRTEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKE--------ILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDL-LSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL-TLSPFAANKVDLIGSKVISGNATYLNNRHSITADSSFDLMQFSPNN 3293
            E   +++  GS  E    + ++KRSK+IEE+L+TE+ +++DL+  +E     L   ++   DF +LFG+++SVI ++++FL+ L ++        +VG+VFL   S  E VYKEYC N++  + L+    K      N+ + +     R N  +LG F       L+KP+QR ++YPL L  ++  T   HPD   L  A      +   INE KR ++L             D+  K +   IH+I KK  RV   I  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E         ++++   +D  TS ++     + H Y+   ++  TD+ ++           + LV++PLN+LL +F+GP  L++KR  K +D+    +R +  +  + Q ++L   RN Y A+N  L  ELP   + +  +F  C+  Y       ++  +  LK L+        EG+ ++  +E+ +    Q ++  F   +L  S  P  R +I +                       Q +   + +  ++ PE L +  + +   +   + +  G LVG++K+ +P G    WL++    + GFV  S+L   +P  ++    +GS+  S  + Y  +  + +  +S + + F+P N
Sbjct:  629 EGAEQTLSTGSTTENSEQRMLEKRSKVIEELLQTEQDYLRDLETCVEHIMGPLQAKQMASVDFDVLFGNIQSVIDISKKFLTALGSS-------DSVGTVFLDHASDLENVYKEYCQNHEETIALLEAYDKDEKFQKNLLECMETVKGRTNYINLGSF-------LIKPVQRIMRYPLLLMELLGATPDSHPDKAPLREAVQSVKDINGNINEYKRRKDLVLKYRKGDENSLIDKISKLN---IHSIIKKSNRVSSHIKQLTGFAPQIKDEAFEETEKNFRMQERLIKSFIRDLSVYLQHVRESACVKVLAAMSMWDLYSDKGTSDLEKFH--KAHRYI--SEKLFTDFKQR----------TEKLVISPLNQLLNMFAGPHKLVQKRFDKLLDFHNCTERAEKLKDKKTQ-EELQSARNNYEALNAQLLDELPKFHNFAKELFASCMRGYASAHCEFVKLALEELKPLLTLLGVGATEGNLIAVFQEEHSKVLQQLQVFTFFPENLPPSKKPFERKTIER--------QSARKTIPSPAKYIPQLDEHRVAVLARYPPEKLFQADRIYNAAQDLDVSLQEGDLVGVIKQQDPMGSQNRWLIDNGVTK-GFVYCSFLKPYNPRQSHSDASVGSQS-STESGYGGSSPNFSRQNSNNTLTFNPGN 1250          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Xenopus
Match: tlx3 (T cell leukemia homeobox 3 [Source:Xenbase;Acc:XB-GENE-495044])

HSP 1 Score: 154.836 bits (390), Expect = 3.141e-37
Identity = 167/663 (25.19%), Postives = 312/663 (47.06%), Query Frame = 3
Query: 1422 ENDYESIKLGSILE----KKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSK----ASNVTDFVSDGLNRLNDLG-VFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL--------RQITFDRTEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKE--------ILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDL-LSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL-TLSPFAANKVDLIGSKVISGNATYLNNRHSITADSSFDLMQFSPNN 3293
            E   +++  GS  E    + ++KRSK+IEE+L+TE+ +++DL+  +E     L   ++   DF +LFG+++SVI ++++FL+ L ++        +VG+VFL   S  E VYKEYC N++  + L+    K      N+ + +    N   + G      L   L+KP+QR ++YPL L  ++  T   HPD   L  A      +   INE KR ++L             D+  K +   IH+I KK  RV   I  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E         ++++   +D  TS ++     + H Y+   ++  TD+ ++           + LV++PLN+LL +F+GP  L++KR  K +D+    +R +  +  + Q ++L   RN Y A+N  L  ELP   + +  +F  C+  Y       ++  +  LK L+        EG+ ++  +E+ +    Q ++  F   +L  S  P  R +I +                       Q +   + +  ++ PE L +  + +   +   + +  G LVG++K+ +P G    WL++    + GFV  S+L   +P  ++    +GS+  S  + Y  +  + +  +S + + F+P N
Sbjct:  707 EGAEQTLSTGSTTENSEQRMLEKRSKVIEELLQTEQDYLRDLETCVEHIMGPLQAKQMASVDFDVLFGNIQSVIDISKKFLTALGSS-------DSVGTVFLDHASDLENVYKEYCQNHEETIALLEAYDKDEKFQKNLLECMETVKNLYQEWGRTNYINLGSFLIKPVQRIMRYPLLLMELLGATPDSHPDKAPLREAVQSVKDINGNINEYKRRKDLVLKYRKGDENSLIDKISKLN---IHSIIKKSNRVSSHIKQLTGFAPQIKDEAFEETEKNFRMQERLIKSFIRDLSVYLQHVRESACVKVLAAMSMWDLYSDKGTSDLEKFH--KAHRYI--SEKLFTDFKQR----------TEKLVISPLNQLLNMFAGPHKLVQKRFDKLLDFHNCTERAEKLKDKKTQ-EELQSARNNYEALNAQLLDELPKFHNFAKELFASCMRGYASAHCEFVKLALEELKPLLTLLGVGATEGNLIAVFQEEHSKVLQQLQVFTFFPENLPPSKKPFERKTIER--------QSARKTIPSPAKYIPQLDEHRVAVLARYPPEKLFQADRIYNAAQDLDVSLQEGDLVGVIKQQDPMGSQNRWLIDNGVTK-GFVYCSFLKPYNPRQSHSDASVGSQS-STESGYGGSSPNFSRQNSNNTLTFNPGN 1334          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Xenopus
Match: tlx3 (T cell leukemia homeobox 3 [Source:Xenbase;Acc:XB-GENE-495044])

HSP 1 Score: 154.451 bits (389), Expect = 3.572e-37
Identity = 172/679 (25.33%), Postives = 322/679 (47.42%), Query Frame = 3
Query: 1422 ENDYESIKLGSILE----KKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSK----ASNVTDFVSDGLNRLNDLG-VFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL--------RQITFDRTEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKE--------ILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDL-LSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL-TLSPFAANKVDLIGSKVISGNATYLNNRHSITADSSFDLMQFSPNNHDDTLRQISMVEISPV 3341
            E   +++  GS  E    + ++KRSK+IEE+L+TE+ +++DL+  +E     + P ++   DF +LFG+++SVI ++++FL+ L ++        +VG+VFL   S  E VYKEYC N++  + L+    K      N+ + +    N   + G      L   L+KP+QR ++YPL L  ++  T   HPD   L  A      +   INE KR ++L             D+  K +   IH+I KK  RV   I  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E         ++++   +D  TS ++     + H Y+   ++  TD+ ++           + LV++PLN+LL +F+GP  L++KR  K +D+    +R +  +  + Q ++L   RN Y A+N  L  ELP   + +  +F  C+  Y       ++  +  LK L+        EG+ ++  +E+ +    Q ++  F   +L  S  P  R +I +               + R  + +  +   + +  ++ PE L +  + +   +   + +  G LVG++K+ +P G    WL++    + GFV  S+L   +P  ++    +GS+  S  + Y  +  + +  +S + + F+P N        S +E SPV
Sbjct:  744 EGAEQTLSTGSTTENSEQRMLEKRSKVIEELLQTEQDYLRDLETCVEHI---MGPLQMASVDFDVLFGNIQSVIDISKKFLTALGSS-------DSVGTVFLDHASDLENVYKEYCQNHEETIALLEAYDKDEKFQKNLLECMETVKNLYQEWGRTNYINLGSFLIKPVQRIMRYPLLLMELLGATPDSHPDKAPLREAVQSVKDINGNINEYKRRKDLVLKYRKGDENSLIDKISKLN---IHSIIKKSNRVSSHIKQLTGFAPQIKDEAFEETEKNFRMQERLIKSFIRDLSVYLQHVRESACVKVLAAMSMWDLYSDKGTSDLEKFH--KAHRYI--SEKLFTDFKQR----------TEKLVISPLNQLLNMFAGPHKLVQKRFDKLLDFHNCTERAEKLKDKKTQ-EELQSARNNYEALNAQLLDELPKFHNFAKELFASCMRGYASAHCEFVKLALEELKPLLTLLGVGATEGNLIAVFQEEHSKVLQQLQVFTFFPENLPPSKKPFERKTIER--------------QSARKTIPSPLDEHRVAVLARYPPEKLFQADRIYNAAQDLDVSLQEGDLVGVIKQQDPMGSQNRWLIDNGVTK-GFVYCSFLKPYNPRQSHSDASVGSQS-STESGYGGSSPNFSRQNSNNTLTFNPGNSTVAFTAGS-IEDSPV 1377          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Xenopus
Match: tlx3 (T cell leukemia homeobox 3 [Source:Xenbase;Acc:XB-GENE-495044])

HSP 1 Score: 140.969 bits (354), Expect = 5.103e-33
Identity = 157/651 (24.12%), Postives = 286/651 (43.93%), Query Frame = 3
Query: 1422 ENDYESIKLGSILEKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSK----ASNVTDFVSDGLNRLNDLG-VFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL--------RQITFDRTEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDL-LSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL-TLSPFAANKVDLIGSKVISGNATYLNNRHSITADSSFDLMQFSPNN 3293
            E   +++  GS  E   Q+  +   +++E   +  QD    LE   ++++     + DF +LFG+++SVI ++++FL+ L ++        +VG+VFL   S  E VYKEYC N++  + L+    K      N+ + +    N   + G      L   L+KP+QR ++YPL L  ++  T   HPD   L  A      +   INE KR ++L             D+  K +   IH+I KK  RV   I  ++G A Q +D  ++E    F+  ++ I  FI      RD                           L  YL   ++  T                + LV++PLN+LL +F+GP  L++KR  K +D+    +R +  +  + Q ++L   RN Y A+N  L  ELP   + +  +F  C+  Y       ++  +  LK L+        EG+ ++  +E+ +    Q ++  F   +L  S  P  R +I +           ++   + +    Q +   + +  ++ PE L +  + +   +   + +  G LVG++K+ +P G    WL++    + GFV  S+L   +P  ++    +GS+  S  + Y  +  + +  +S + + F+P N
Sbjct:  728 EGAEQTLSTGSTTENSEQRMLEKRSKVIEELLQTEQDYLRDLETCVEHIMGPLQANVDFDVLFGNIQSVIDISKKFLTALGSS-------DSVGTVFLDHASDLENVYKEYCQNHEETIALLEAYDKDEKFQKNLLECMETVKNLYQEWGRTNYINLGSFLIKPVQRIMRYPLLLMELLGATPDSHPDKAPLREAVQSVKDINGNINEYKRRKDLVLKYRKGDENSLIDKISKLN---IHSIIKKSNRVSSHIKQLTGFAPQIKDEAFEETEKNFRMQERLIKSFI------RD---------------------------LSVYLQHVRKQRT----------------EKLVISPLNQLLNMFAGPHKLVQKRFDKLLDFHNCTERAEKLKDKKTQ-EELQSARNNYEALNAQLLDELPKFHNFAKELFASCMRGYASAHCEFVKLALEELKPLLTLLGVGATEGNLIAVFQEEHSKVLQQLQVFTFFPENLPPSKKPFERKTIER----------QSARKTIPSPYIPQLDEHRVAVLARYPPEKLFQADRIYNAAQDLDVSLQEGDLVGVIKQQDPMGSQNRWLIDNGVTK-GFVYCSFLKPYNPRQSHSDASVGSQS-STESGYGGSSPNFSRQNSNNTLTFNPGN 1306          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Mouse
Match: Dnmbp (dynamin binding protein [Source:MGI Symbol;Acc:MGI:1917352])

HSP 1 Score: 157.532 bits (397), Expect = 9.124e-39
Identity = 158/601 (26.29%), Postives = 285/601 (47.42%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSK----ASNVTDFVSDGLNRLNDLGVFAS-TLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPD---INDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K++ E+L+TE+ +I+DL++ +E     L   ++P+ DF  LFG++++VI V+++ L+ L  +        AVG VFL      E  Y+ YC N+D  + L+    K      ++ D+++D  +  ++ G      L   L+KP+QR ++YPL L  ++ +T   HPD   + + + A  E +V    INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E            ++ +K    + +  + +  +RG  D   F+K +   +           + LV+NPLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    +++L   RN Y A+N+ L  ELP     +  +F  CI  Y +     +Q  +  L+ L+        EG+ ++   E+ +    Q ++  F    L    P  R    +                       Q+E     L  ++ PE L  V+++F   +   + +  G LVG++K+ +P G    WLV+    + GFV  S+L
Sbjct:   25 QRMLEKRAKVVAELLQTERDYIRDLEMCIERVMVPLQQAQVPNVDFEGLFGNMQTVIKVSKQLLAALEIS-------DAVGPVFLDHRDELEGTYRVYCQNHDEAISLLEMYEKDEKTQKHLQDYLADLKSLYHEWGCTNYINLGSFLIKPVQRIMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINV---NINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSSRVSSHLKHLTGFAPQLKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRE------------SACVK--VVAAMSIWDLCMERGHHDLEQFEKVHRYISDQLFTRFKERTERLVINPLNQLLNMFTGPYKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEELQSARNNYEALNSQLLDELPKFQQYAQSLFTNCIHGYAEAHCDFVQQALEQLQPLLSLLKATDREGNLIAIFLEEHSRVLQQLQVFTFFPESL----PAPRKPFERKTTDRQSSRKTLLGMPSYML---QSEELRSSLLARYPPEKLFHVQRNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLVDNGVTK-GFVYSSFL 589          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Mouse
Match: Dnmbp (dynamin binding protein [Source:MGI Symbol;Acc:MGI:1917352])

HSP 1 Score: 158.303 bits (399), Expect = 1.822e-38
Identity = 160/605 (26.45%), Postives = 289/605 (47.77%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGL---DKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSK----ASNVTDFVSD--GLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPD---INDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K++ E+L+TE+ +I+DL++ +E     L   ++P+ DF  LFG++++VI V+++ L+ L  +   G+   D +  G VFL      E  Y+ YC N+D  + L+    K      ++ D+++D  G     +LG F       L+KP+QR ++YPL L  ++ +T   HPD   + + + A  E +V    INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E            ++ +K    + +  + +  +RG  D   F+K +   +           + LV+NPLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    +++L   RN Y A+N+ L  ELP     +  +F  CI  Y +     +Q  +  L+ L+        EG+ ++   E+ +    Q ++  F    L    P  R    +    +     +            Q+E     L  ++ PE L  V+++F   +   + +  G LVG++K+ +P G    WLV+    + GFV  S+L
Sbjct:  778 QRMLEKRAKVVAELLQTERDYIRDLEMCIERVMVPLQQAQVPNVDFEGLFGNMQTVIKVSKQLLAALEISDAVGMSSCDCLVPGPVFLDHRDELEGTYRVYCQNHDEAISLLEMYEKDEKTQKHLQDYLADLKGCTNYINLGSF-------LIKPVQRIMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINV---NINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSSRVSSHLKHLTGFAPQLKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRE------------SACVK--VVAAMSIWDLCMERGHHDLEQFEKVHRYISDQLFTRFKERTERLVINPLNQLLNMFTGPYKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEELQSARNNYEALNSQLLDELPKFQQYAQSLFTNCIHGYAEAHCDFVQQALEQLQPLLSLLKATDREGNLIAIFLEEHSRVLQQLQVFTFFPESL----PAPRKPFER---KTTDRQSSRKTLLGMPSYMLQSEELRSSLLARYPPEKLFHVQRNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLVDNGVTK-GFVYSSFL 1346          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Mouse
Match: Dnmbp (dynamin binding protein [Source:MGI Symbol;Acc:MGI:1917352])

HSP 1 Score: 158.303 bits (399), Expect = 1.822e-38
Identity = 160/605 (26.45%), Postives = 289/605 (47.77%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGL---DKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSK----ASNVTDFVSD--GLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPD---INDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K++ E+L+TE+ +I+DL++ +E     L   ++P+ DF  LFG++++VI V+++ L+ L  +   G+   D +  G VFL      E  Y+ YC N+D  + L+    K      ++ D+++D  G     +LG F       L+KP+QR ++YPL L  ++ +T   HPD   + + + A  E +V    INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E            ++ +K    + +  + +  +RG  D   F+K +   +           + LV+NPLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    +++L   RN Y A+N+ L  ELP     +  +F  CI  Y +     +Q  +  L+ L+        EG+ ++   E+ +    Q ++  F    L    P  R    +    +     +            Q+E     L  ++ PE L  V+++F   +   + +  G LVG++K+ +P G    WLV+    + GFV  S+L
Sbjct:  778 QRMLEKRAKVVAELLQTERDYIRDLEMCIERVMVPLQQAQVPNVDFEGLFGNMQTVIKVSKQLLAALEISDAVGMSSCDCLVPGPVFLDHRDELEGTYRVYCQNHDEAISLLEMYEKDEKTQKHLQDYLADLKGCTNYINLGSF-------LIKPVQRIMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINV---NINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSSRVSSHLKHLTGFAPQLKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRE------------SACVK--VVAAMSIWDLCMERGHHDLEQFEKVHRYISDQLFTRFKERTERLVINPLNQLLNMFTGPYKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEELQSARNNYEALNSQLLDELPKFQQYAQSLFTNCIHGYAEAHCDFVQQALEQLQPLLSLLKATDREGNLIAIFLEEHSRVLQQLQVFTFFPESL----PAPRKPFER---KTTDRQSSRKTLLGMPSYMLQSEELRSSLLARYPPEKLFHVQRNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLVDNGVTK-GFVYSSFL 1346          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Mouse
Match: Dnmbp (dynamin binding protein [Source:MGI Symbol;Acc:MGI:1917352])

HSP 1 Score: 155.992 bits (393), Expect = 9.501e-38
Identity = 158/601 (26.29%), Postives = 287/601 (47.75%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSK----ASNVTDFVSDGLNRLNDLGVFAS-TLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPD---INDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K++ E+L+TE+ +I+DL++ +E     L   ++P+ DF  LFG++++VI V+++ L+ L  +        AVG VFL      E  Y+ YC N+D  + L+    K      ++ D+++D  +  ++ G      L   L+KP+QR ++YPL L  ++ +T   HPD   + + + A  E +V    INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E            ++ +K    + +  + +  +RG  D   F+K +   +           + LV+NPLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    +++L   RN Y A+N+ L  ELP     +  +F  CI  Y +     +Q  +  L+ L+        EG+ ++   E+ +    Q ++  F    L    P  R    +    +     +            Q+E     L  ++ PE L  V+++F   +   + +  G LVG++K+ +P G    WLV+    + GFV  S+L
Sbjct:  778 QRMLEKRAKVVAELLQTERDYIRDLEMCIERVMVPLQQAQVPNVDFEGLFGNMQTVIKVSKQLLAALEIS-------DAVGPVFLDHRDELEGTYRVYCQNHDEAISLLEMYEKDEKTQKHLQDYLADLKSLYHEWGCTNYINLGSFLIKPVQRIMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINV---NINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSSRVSSHLKHLTGFAPQLKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRE------------SACVK--VVAAMSIWDLCMERGHHDLEQFEKVHRYISDQLFTRFKERTERLVINPLNQLLNMFTGPYKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEELQSARNNYEALNSQLLDELPKFQQYAQSLFTNCIHGYAEAHCDFVQQALEQLQPLLSLLKATDREGNLIAIFLEEHSRVLQQLQVFTFFPESL----PAPRKPFER---KTTDRQSSRKTLLGMPSYMLQSEELRSSLLARYPPEKLFHVQRNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLVDNGVTK-GFVYSSFL 1342          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Mouse
Match: Dnmbp (dynamin binding protein [Source:MGI Symbol;Acc:MGI:1917352])

HSP 1 Score: 155.221 bits (391), Expect = 1.435e-37
Identity = 163/604 (26.99%), Postives = 292/604 (48.34%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSK----ASNVTDFVSDGLNRLNDLGVFAS-TLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPD---INDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLST--EEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYN-QTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K++ E+L+TE+ +I+DL++ +E     L   ++P+ DF  LFG++++VI V+++ L+ L  +        AVG VFL      E  Y+ YC N+D  + L+    K      ++ D+++D  +  ++ G      L   L+KP+QR ++YPL L  ++ +T   HPD   + + + A  E +V    INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E            ++ +K    + +  + +  +RG  D   F+K +   +           + LV+NPLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    +++L   RN Y A+N+ L  ELP     +  +F  CI  Y +     +Q  +  L+ L+        EG+ ++   EE  R        +L  LQ  + +F P+   +  K          ++    L    Y  Q+E     L  ++ PE L  V+++F   +   + +  G LVG++K+ +P G    WLV+    + GFV  S+L
Sbjct:  466 QRMLEKRAKVVAELLQTERDYIRDLEMCIERVMVPLQQAQVPNVDFEGLFGNMQTVIKVSKQLLAALEIS-------DAVGPVFLDHRDELEGTYRVYCQNHDEAISLLEMYEKDEKTQKHLQDYLADLKSLYHEWGCTNYINLGSFLIKPVQRIMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINV---NINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSSRVSSHLKHLTGFAPQLKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRE------------SACVK--VVAAMSIWDLCMERGHHDLEQFEKVHRYISDQLFTRFKERTERLVINPLNQLLNMFTGPYKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEELQSARNNYEALNSQLLDELPKFQQYAQSLFTNCIHGYAEAHCDFVQQALEQLQPLLSLLKATDREGNLIAIFLEEHSR--------VLQQLQ--VFTFFPESLPAPRKPFERKTTDRQSSRKTLLGMPSYMLQSEELRSSLLARYPPEKLFHVQRNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLVDNGVTK-GFVYSSFL 1030          
BLAST of Rho guanine nucleotide exchange factor 38 vs. UniProt/SwissProt
Match: sp|M0R4F8|DNMBP_RAT (Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 6.768e-39
Identity = 162/591 (27.41%), Postives = 280/591 (47.38%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDL-GVFAST----LDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYN-QTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K++ E+L+TEK +I+DL++ +E     L   ++P+ DF  LFG++++VI V+++ L+ L           AVG VFL      E  Y+ YC N+D  + L++   K   +   + D L  L  L   +  T    L   L+KP+QR ++YPL L  ++ +T   HPD   L +A      +   INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E            ++ +K    + +  + +  +RG  D   F+K +   +           + LV+NPLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    ++ L   RN Y A+N+ L  ELP     +  +F  CI  Y +     +Q  +  L+ L+   + S  E       H+       Q  + +F P+   +  K          ++  A L    Y  Q+E     L  ++ PE L  V+++F   +   + +  G LVG++K+ +P G    WLV+    + GFV  S+L
Sbjct:  779 QRMLEKRAKVVAELLQTEKDYIRDLEMCVERVMVPLQQAQVPNIDFEGLFGNMQTVIKVSKQLLAALEIT-------DAVGPVFLDHRDELEGTYRLYCQNHDEAISLLDIYEKDERIQKHLQDYLADLKSLYHEWGCTNYINLGSFLIKPVQRIMRYPLLLMELLNSTPESHPDKAPLTSAVLAIKEINANINEYKRRKDLVLKYRKADEDSLMEKISKLNIHSIIKKSSRVSSHLKHLTGFAPQLKDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRE------------SACVK--VVAAMSIWDLCMERGHHDLEQFEKVHRYISDQLFTRFKERTERLVINPLNQLLNMFTGPYKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEDLQSARNNYEALNSQLLDELPKFQQYAQSLFTNCIHGYAEAHCDFVQKALEQLQPLLSLLKASDREGNLIAIFHEEHSRVLQQLQVFTFFPEALPAPRKPFERKTTDRQSSRKALLGMPSYMLQSEELRSSLLARYPPEKLFHVQRNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLVDNGVTK-GFVYSSFL 1343          
BLAST of Rho guanine nucleotide exchange factor 38 vs. UniProt/SwissProt
Match: sp|E2RP94|DNMBP_CANLF (Dynamin-binding protein OS=Canis lupus familiaris OX=9615 GN=DNMBP PE=3 SV=2)

HSP 1 Score: 160.229 bits (404), Expect = 3.346e-38
Identity = 161/593 (27.15%), Postives = 281/593 (47.39%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGV-FAST----LDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKE--ILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYN-QTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K+IEE+L+TE+ +++DL++ +E     L  T+IP+ DF  LFG+++ VI V+++ L+ L   + D     AVG VFL      E  YK YC N+D  + L+    K   +   + D L  L  L   +  T    L   L+KP+QR ++YPL L  ++ +T   HPD   L +A      +   INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E   + + +A++                 + V  ++G  D   F+K +   +           + LV++PLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    +++L   RN Y A+N  L  ELP     +  +F  CI  Y +     ++  +  LK L+   +++  E       H+       Q  + +F P+   +  K          +     L    Y  Q+E     L  ++ PE L + +++F   +   + +  G LVG++K+ +P G    WL++    + GFV  S+L
Sbjct:  786 QRMLEKRAKVIEELLQTERDYVRDLEMCIEHIMAPLQQTQIPNIDFEGLFGNMQMVIKVSKQLLADL--EISD-----AVGPVFLDHRDELEGTYKVYCQNHDEAISLLEIYEKDEKIQKHLQDSLADLKSLYTEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKAPLTSAVLAVKEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVS----------------MWDVCMEKGHRDLEQFEKVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEELQSARNNYEALNAQLLDELPKFHQYAQGLFTNCIHGYAEAHCDFVRQALEQLKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPAARKPFERKTLDRQSARKPLLGLPSYMLQSEELRASLLTRYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVSQ-GFVYSSFL 1350          
BLAST of Rho guanine nucleotide exchange factor 38 vs. UniProt/SwissProt
Match: sp|Q6TXD4|DNMBP_MOUSE (Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 1.296e-37
Identity = 160/605 (26.45%), Postives = 289/605 (47.77%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGL---DKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSK----ASNVTDFVSD--GLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPD---INDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K++ E+L+TE+ +I+DL++ +E     L   ++P+ DF  LFG++++VI V+++ L+ L  +   G+   D +  G VFL      E  Y+ YC N+D  + L+    K      ++ D+++D  G     +LG F       L+KP+QR ++YPL L  ++ +T   HPD   + + + A  E +V    INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E            ++ +K    + +  + +  +RG  D   F+K +   +           + LV+NPLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    +++L   RN Y A+N+ L  ELP     +  +F  CI  Y +     +Q  +  L+ L+        EG+ ++   E+ +    Q ++  F    L    P  R    +    +     +            Q+E     L  ++ PE L  V+++F   +   + +  G LVG++K+ +P G    WLV+    + GFV  S+L
Sbjct:  778 QRMLEKRAKVVAELLQTERDYIRDLEMCIERVMVPLQQAQVPNVDFEGLFGNMQTVIKVSKQLLAALEISDAVGMSSCDCLVPGPVFLDHRDELEGTYRVYCQNHDEAISLLEMYEKDEKTQKHLQDYLADLKGCTNYINLGSF-------LIKPVQRIMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINV---NINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSSRVSSHLKHLTGFAPQLKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRE------------SACVK--VVAAMSIWDLCMERGHHDLEQFEKVHRYISDQLFTRFKERTERLVINPLNQLLNMFTGPYKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEELQSARNNYEALNSQLLDELPKFQQYAQSLFTNCIHGYAEAHCDFVQQALEQLQPLLSLLKATDREGNLIAIFLEEHSRVLQQLQVFTFFPESL----PAPRKPFER---KTTDRQSSRKTLLGMPSYMLQSEELRSSLLARYPPEKLFHVQRNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLVDNGVTK-GFVYSSFL 1346          
BLAST of Rho guanine nucleotide exchange factor 38 vs. UniProt/SwissProt
Match: sp|Q6XZF7|DNMBP_HUMAN (Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.787e-36
Identity = 158/596 (26.51%), Postives = 281/596 (47.15%), Query Frame = 3
Query: 1461 EKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDL-GVFAST----LDMMLVKPLQRFLKYPLFLKTIIENTLPDHPD---INDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKE--ILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDY--FKKYYTVANKTCIL------DSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYN-QTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            ++ ++KR+K+IEE+L+TE+ +I+DL++ +E     +   ++P+ DF  LFG+++ VI V+++ L+ L  +        AVG VFL      E  YK YC N+D  + L+    K   +   + D L  L  L   +  T    L   L+KP+QR ++YPL L  ++ +T   HPD   + + + A  E +V    INE KR ++L    R+   D   EK     IH+I KK  RV   +  ++G A Q +D  ++E    F+  ++ I  FI  + +   +++E   + + +A++                 + V  +RG  D   F++ +   +           + LV++PLN+LL +F+GP  L++KR  K +D+    +R +   DK+T    +++L   RN Y A+N  L  ELP     +  +F  C+  Y +     +   +  LK L+   +++  E       H+       Q  + +F P+   +  K          +     L    Y  Q+E     L  ++ PE L + +++F   +   + +  G LVG++K+ +P G    WL++    + GFV  S+L
Sbjct:  779 QRMLEKRAKVIEELLQTERDYIRDLEMCIERIMVPMQQAQVPNIDFEGLFGNMQMVIKVSKQLLAALEIS-------DAVGPVFLGHRDELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQDSLADLKSLYNEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAVLAVKEINV---NINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVSSHLKHLTGFAPQIKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVS----------------MWDVCMERGHRDLEQFERVHRYISDQLFTNFKERTERLVISPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERAEKLKDKKT----LEELQSARNNYEALNAQLLDELPKFHQYAQGLFTNCVHGYAEAHCDFVHQALEQLKPLLSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKKPFERKTIDRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTK-GFVYSSFL 1343          
BLAST of Rho guanine nucleotide exchange factor 38 vs. UniProt/SwissProt
Match: sp|E7F1U2|DNMBP_DANRE (Dynamin-binding protein OS=Danio rerio OX=7955 GN=dnmbp PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 3.175e-35
Identity = 145/568 (25.53%), Postives = 254/568 (44.72%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFAS-------TLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQ-YRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            +DL++ ++   + L   ++   DF  LFG++ SVI ++      L        D  ++G VFL      E+VYK YC N+D  + L+    K  N+   V + L +L   G++          L   L+KP+QR ++YPL L  ++  T   H D   L  A      +   INE KR ++L    R+   DR  +K    ++H+I KK  RV   +  ++G + Q +D  + +   +F+  ++ I  FI  + +   +++E  ++       F  I                 R  +D  K++     +T   ++LV+ PL +LL +F+GP  LI+KR+ K +DY   K+R +  +  RVQ ++L   RN Y A+N  L  ELP     +  +F  C+  ++Q     +   +  L  L+        EG+ +S  +E+         +L  LQ    SF P+    ++ K                       QT+     L  ++ PENL + +++F   +   + +  G +VG++K+ +P G    WL++    + GFV  S+L
Sbjct:  867 KDLQMCVKEIIQPLQKKQVQGIDFDGLFGNISSVIDLSRRLNKTLQ-------DTDSIGQVFLSYKDQLEDVYKIYCQNHDDAISLLETYEKDENIQKHVLECLEKLR--GIYREWGKTNYINLGSFLIKPVQRVMRYPLLLMELLNTTPESHHDRQQLSEAVMSIKEINVNINEYKRRKDLVVKYRKGDEDRLIDKISKLSMHSIIKKSNRVSSHLKHLTGISPQIKDEAFDDAEKRFRLQERLIKSFIRNISLYLQHIRESASVKVLAAISFCDIYTERQQQMDPERFQRAHRCISD--KQFTEFKERT---EALVITPLTQLLNMFTGPHKLIQKRRDKLLDYDNCKERAERLKDKRVQ-EELQTARNNYEALNAQLLDELPKFHRAAEDLFTSCVRGFVQAQRDFISLTLGELTPLLQLSGLGGTEGNLVSLFQEE------HTRVLDLLQS--FSFFPENLPTTVRKTFEKKTLEKQYTKKPQAPPNYVLQTDEHRAGLLVRYGPENLYQAERNFNAAQDLDVSVLEGDIVGVIKQQDPMGSQNRWLIDNGVTK-GFVYSSFL 1410          
BLAST of Rho guanine nucleotide exchange factor 38 vs. TrEMBL
Match: A0A1S3HMN3 (dynamin-binding protein OS=Lingula unguis OX=7574 GN=LOC106156567 PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 4.321e-50
Identity = 191/718 (26.60%), Postives = 339/718 (47.21%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPT--KIPDQDFHLLFGDLKSVIAVAEEFLSKL--SANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLND-LGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL-----RQITFDRTEKWHMRTIHAIQKKPKRVIVSISG----AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQ-LHFYLVACKR-GETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDY---LAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQL-STEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSI--NKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLTLSPFAANKVDLIGSKVISGNATYLNNRHSITADSSF--DLMQFSPNN-------HDDTLRQI----SMVEISPVK---------TRPRAFSTANIIRIALFPHQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYL 3548
            +DL++ +EAF   L P   K+ D D   LFG+++ V  +++  LS+L  + N ++  +++ +G+ F+Q     + VY  YC N+D  L L+ K     ++ D+ + GL ++     VF   L  +L+KP+QR LKYPL L  ++++T   HPD   L+ A +    +A  INE KR ++L     ++     ++K    +IH+I KK  R+ + ++     + Q +D ++ +  I+F+ L+K I  F+  V    D ++E +     + +D + +   N   Q +  Y  A +  G+   F     V  +  I       PLNKLL +F GP  +I+KR  K +DY    A  +   D++  ++  D+L + +N Y A+N  L  ELP L + S  +FNECIG+++Q     ++  +  +  L+E   +  T  E      +Q  +    Q   LSF P+  +S   +K D     L  ++        V +QTE+  + +R+++  + L  V +         I +  G +VG++K  +P G+   W V+    + GFVP +  +L+PFA+             ++ Y +      +  SF  DLM+ SP          +D L ++     M E    +         T P   +       A +  ++R  +EIS+++   + +L+  D+  + +W +      G QGY P NYL
Sbjct:  879 KDLQLCVEAF---LSPASEKMKDVDMETLFGNIEEVANLSQRMLSQLERAVNGKEFYEQV-LGNCFVQIAEDMKHVYALYCRNHDDVLALLEKCESQQDIQDYFNRGLEKVRQHTTVF--DLGSLLIKPVQRILKYPLLLNELLKSTEDSHPDKFPLLTAINAMTDVATAINEYKRRKDLVYKYRKEADSKLSDKISRLSIHSIMKKSNRLSMKLTSNLGLSSQTKDQQFNKEEIRFRNLEKAIKLFVRNVGQYIDQIQESVGCQETMAEDISDLYAENNSCQEVQQYRAAFRMLGDESIFTFKSHVERRVTI-------PLNKLLSMFHGPLNVIQKRDDKLLDYDSWAAKVKSTKDQDRLKMSKDQLQKAKNNYEALNAQLLDELPKLSNMSLQLFNECIGSFVQAHKVFIEGTLRHMYPLMELPIMNGTGGENVLGMFNQAHVEVVDQLADLSFVPKGFSSRKDSKPDVKLKRLPSDSKFYQELPAVSSQTESQRMSVRQQYPSDKLYTVTQTQSSRDAMSISLAEGDIVGVIKEQDPMGNKDKWFVDNGAIK-GFVPSN--SLAPFAS-------------SSPYPSPERPRASTPSFPTDLMELSPTQPSMKRQESEDFLSELDKFSDMYEQYEKEHEAQGYEGYTNPTLSAQVPQYYYAQYQFEARNSNEISLREGQPVTVLQKYDEQGNPDWWMVD--IDGVQGYAPANYL 1565          
BLAST of Rho guanine nucleotide exchange factor 38 vs. TrEMBL
Match: K7JLL0 (Uncharacterized protein OS=Nasonia vitripennis OX=7425 GN=100677917 PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 3.660e-44
Identity = 193/715 (26.99%), Postives = 321/715 (44.90%), Query Frame = 3
Query: 1527 QDLKITLEAFDKN----LIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGL--DKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL--RQITFDRTEKWHMRTI--HAIQKKPKRVIVSISGAVQNE----DTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGET-------DYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIG---NYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLTLSPFAA------------NKVDLIG--SKVISGNATYLNNRHSITADSSFDLMQFSPNNHDDTLRQISMVEISPVKTRPRAFSTANIIRIALFP-HQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLSK 3554
            +DLK+T E F  +    L   KI   D   LFG++  +I VAEE L  +   M+ G+  D  ++G  FL+        Y++YC N++  L L+ K     ++    + G+  L  + V    +  +L+KP+QR LKYPL L  +++ T   HPD   +  AS     +A  INE KR ++L  + +  + T    M  +  H++ KK  R+   +S  +       D +++E+V  F  L+K    F++ V    D   + L+  +   +  T         QLH Y    +  E           +  Y    K+CI +  V++PLN L+ L SGP LLI KR  K +DY       D   + R + + +   ++ + A+N  L  ELP+ I  S+ I   CIG   N  +L    +    +++  +++  Q S E+   +   H + +   + R  LS+     N+  + D     L               Q+E     ++EK+ P  L  + +      PH +    GTLVG++K  NP G ++ W V+    + GFV   YL +S  A             + VDL+   S V   N  Y  +  S+ +D S DL    P N+++      + +I+P + R    +       AL+  +       +S+++   L++LE  D+ N+ +W L ++ RTG +GYVP NYL K
Sbjct:  510 RDLKMTYETFHLHNPAFLESRKI---DVTTLFGNISQIIEVAEELLELIQRAMK-GINEDYQSIGPCFLKMSEKMRVAYEKYCSNHEASLALLQKYKDNEDIMRIFNKGVETLR-VQVHCFDMSSVLIKPVQRILKYPLLLDGLLKCTEDGHPDKPKIEEASKVMADVASYINEYKRKKDLASKYLHSNNTLIGKMANLNMHSVAKKSSRLSAKLSATLGLTNLPIDPKFEELVKDFLSLEKSTKQFLKDV----DQCIQWLDAETYCGEVLT--------EQLHQYYTGVRSDEVWRLREVRQIIRSQYIKDFKSCI-ERRVISPLNALISLLSGPELLINKRHDKMLDY-------DTAISRRDKAEDISSAKSNFEALNQQLLEELPVFIQASTAILYNCIGAFTNARKLYNGKILKKYMNISEVVK--QFSLEDIYESYFVHHHSLYNEITR--LSYGGT--NARVEKDSVDYCL---------------QSEVHKKAVKEKYPPNKLYILTRSITGPTPHDLSATKGTLVGVIKTMNPMGDTSKWFVDNGSMK-GFVESQYLEISDEAKLIEESAAAVSMDSSVDLMSLDSPVKEAN-RYSADIQSLYSDVSDDLD--PPPNYEN------LDDITPKEPRQLYENIHEKFVYALYEFNHPELAGTLSVKEGQALKVLEKHDQKNNPDWWLVED-RTGGKGYVPENYLGK 1167          
BLAST of Rho guanine nucleotide exchange factor 38 vs. TrEMBL
Match: A0A232EUH7 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_006757 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 5.888e-44
Identity = 194/715 (27.13%), Postives = 319/715 (44.62%), Query Frame = 3
Query: 1527 QDLKITLEAFDKN----LIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDK--IAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL--RQITFDRTEKWHMRTI--HAIQKKPKRVIVSISGAVQNE----DTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGET-------DYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIG---NYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLTLSPFAA------------NKVDLIG--SKVISGNATYLNNRHSITADSSFDLMQFSPNNHDDTLRQISMVEISPVKTRPRAFSTANIIRIALFP-HQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLSK 3554
            +DLK+T E F  +    L   KI   D   LFG++  +I VAEE L  +   M+ G+D+   ++G  FL+        Y +YC N++  L L+ K     ++    + G+  L  + V    +  +L+KP+QR LKYPL L  +++ T   HPD   +  AS     +A  INE KR ++L  + +  + T    M  +  H++ KK  R+   +S  +       D +++E+V  F  L+K    F          LK++      +  D  +        QLH Y    +  E           +  Y    K+CI +  V++PLN L+ L SGP LLI KR  K +DY       D   + R + + +   ++ + A+N  L  ELP+ I  S+ I   CIG   N  +L    +    +++  +++  QLS E+   +   H +  L + Q   LS+     N+  + D     L               Q+E     +REK+ P  L  + +      PH +    GTLVG++K  +P G ++ W V+    + GFV   YL +S  A             + VDL+   S V   N  Y  +  S+ +D S DL    P N+++      + +I+P + R    +       AL+  +       +S+++   L++LE  D+ N+ +W L ++ RTG +GYVP NYL K
Sbjct:  510 RDLKMTYETFHLHNPAFLESRKI---DVATLFGNISQIIEVAEELLELIQRAMK-GIDEDYQSIGPCFLKMSEKMRVAYGKYCSNHEASLALLQKYEDNEDIMRIFNKGVETLR-VQVHCFDMSSVLIKPVQRILKYPLLLDGLLKCTEDGHPDKPKIEEASKVMADVASYINEYKRKKDLASKYLHSNNTLIGKMANLNMHSVAKKSSRLSAKLSATLGLTNLPIDPKFEELVKDFLSLEKSTKQF----------LKDVEQCIQCL--DAETYCGEVLTEQLHQYYTGVRSDEVWRLREVRQIIRSQYIKDFKSCI-ERRVISPLNALISLLSGPELLINKRHDKMLDY-------DTAISRRDRAEDISSAKSNFEALNQQLLEELPVFIQASTAILYNCIGAFTNARKLYNGKILKKYMNISEVVK--QLSLEDIYESYFVHHH--LLYNQITRLSYGGT--NARVEKDSVDYCL---------------QSEVHKKAVREKYPPNKLYILTRSITGPTPHDLSATKGTLVGVIKTMDPMGDTSKWFVDNGSMK-GFVESQYLEISDEAKLIEESAAAVSIDSSVDLMSLDSPVKEAN-RYSADIQSLYSDVSDDLD--PPPNYEN------LDDITPKEPRQLYENIHEEFVYALYEFNHPELVGTLSVKEGQALKVLEKHDQKNNPDWWLVED-RTGGKGYVPENYLGK 1167          
BLAST of Rho guanine nucleotide exchange factor 38 vs. TrEMBL
Match: A0A4W6C553 (Dynamin binding protein OS=Lates calcarifer OX=8187 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.642e-41
Identity = 204/752 (27.13%), Postives = 344/752 (45.74%), Query Frame = 3
Query: 1464 KKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLN----DLG-VFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDH---PDINDLIAASSEFDVLAQKINEKKRFEEL-------RQITF-DRTEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIE-GDQLSTEEEQ-RNCRNHQNEILAFLQRDLLSFNPQ----YRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL------------TLSPFAANKVDLIGSKVI----SGNATYLNNRHSITADSSFDLMQFSPNNHDDTLRQISMVEISPVKTRPRAFSTANIIR-------------IALFPHQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLSK 3554
            + ++KRSK+IEE+L+TEK +I+DL++ ++   + L   ++ + DF  LFG++ SVI +++     L        +  ++G VFL   +  EEVYK YC N+D  + L+    K  N+   V + L+RL     D G      L   L+KP+QR ++YPL L  ++  T   H   P + + + A  E +V    INE KR ++L        + TF D+  K  M   H+I KK  RV   +  ++G + Q +D  + E   KF+  ++ I  FI  + +   +++E  ++       F  I           +  A  R  +D  K++     +T   ++LV+NPL +LL +F+GP  LI+KR  K +DY   K+R D  +  RVQ ++L   RN Y A+N  L  ELP   S +  +F  C+  + Q     +++ +  LK L++   ++STE       +     +L  LQ    SF P+       +    +  +     +            QTE     L  ++ PE L + +++F   +   + I  G LVG++K+ +P G    WL++    + GFV  S+L            ++   ++N+    GS  +    + N+T   N+ + T   S    Q   + H       S          P + S +N I               AL+   +R  +E+S+  N +L ILE  D + +  W L +    G +GYVP+NY+ K
Sbjct:   33 RMLEKRSKVIEELLQTEKDYIKDLQMCVKEIIEPLRKKQVKNVDFDGLFGNINSVIDLSQRLFDTLH-------ETDSIGKVFLDFKTELEEVYKIYCQNHDDAISLLESYEKDENIQRHVLECLDRLRAIYRDWGKTNYINLGSFLIKPVQRVMRYPLLLMELLGATPESHHDRPQLTEALQAVKEINV---NINEYKRRKDLVVKYRKGDEDTFIDKISKLSM---HSIIKKSNRVSSHLKHLTGISPQIKDEAFDEAEKKFRLQERLIKSFIRNISLYLQHIRESASVKVLAAISFCDIYTERSMLDPERFQRA-HRCISD--KQFTQFKERT---ETLVINPLTQLLLMFAGPHKLIQKRFDKLLDYDNCKERADRLKDRRVQ-EELQVARNNYEALNAQLLDELPKFHSAAEELFTGCVTAFAQAQKDFMKTTLGELKPLLQFSSKVSTEGNLIAQFQEEYGRVLQLLQS--FSFCPENLPPATTTKKPFERKTLEKQTSKKQLQGPPNCVVQTEEHRAGLLVRYGPEKLFQAERNFNAAQDLDVSIQEGDLVGVIKQQDPMGSHNRWLIDNGVTK-GFVYSSFLKPYNPRRSQSDVSIESQSSNESGYGGSSPVFSRQNSNSTLTFNQETATVSFSTSQAQNHSSPHPSLDSASSRRSHHRDVPNPDSASQSNSINSSYCFVFVFFQIYYALYSFNARCPNELSISANQRLRILEFQDMNGNSEWWLGEA--GGRRGYVPSNYIRK 759          
BLAST of Rho guanine nucleotide exchange factor 38 vs. TrEMBL
Match: A0A195DVB3 (Dynamin-binding protein OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_11228 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.647e-38
Identity = 177/707 (25.04%), Postives = 304/707 (43.00%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQ--DFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDK--IAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRT----EKWHMRTIHAIQKKPKRVIVSISGAVQ----NEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILD------SLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYL---QLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLTLSPFAANKVDLIGSKVISGNATYLNNRHSITADS-SFDLMQFSPNNHDDTLRQISMVEI----SPVKTRPRAFSTANIIRI------ALFPHQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLS 3551
            +DLK+T E F+ +  P+ +  +  D   LFG++  VI VAEE L  +   M+ G D+    VG  F++     + VY +YC N++  L L+ K      +    + G+  L    V    +  +L+KP+QR +KYPL L  +I+ T  +HPD   ++ A      +A  INE KR  ++     D       K    ++H++ K   R+   +S ++       DTE++E+  +F+ ++KC    +          K+I    + ++D+  +I        L  Y       E +  +   +V     I D        V  PL+ L  L  GPA+L+ KR  K +DY A   + +  + S++  ++L   ++ Y A+N  L  ELPIL+  ++ I   CI  +    +L +  +    +SL        LS+++   +   + N I   + R   +        I++G                   +  QTE     LREK+  + L  V +D   T   ++    GTL+G++K+ +P G+S  W V+    + GF+P   L      +   D   S V +      +  + ++ DS   ++ + S ++  D L      ++    S V   PR     NI  I      A++         + +     L +L   D+  +  W L +N R G QGYVP NYLS
Sbjct:  524 RDLKLTYETFNLHK-PSFLESKGIDVATLFGNILEVIHVAEELLDMILRAMK-GCDENLQTVGPCFVKMAEKLKSVYVKYCGNHEAALALLKKYESNEEIMKVFNKGIETLRR-QVACFDMSSILIKPIQRIVKYPLMLYELIKCTEDNHPDKAAIMEAWEAMTNVASYINEYKRRRDIVSKYLDNDNTLFSKMSKLSMHSVAKMSTRLSTRLSASLGLTNVASDTEFEELEKQFRSIEKCTWQLV----------KDIEQCITYLSDE--AISGEAIAELLVHYYQGSPTAEVNKLQDIRSVIWSQYIQDFKSYIEKTVSAPLHFLATLLEGPAMLVSKRHDKLLDYDAAISKSEKYKESKIIQEELFTAKSNYEALNQQLLEELPILLDAAANILVNCINAFAGARKLLSGKITKQYISLCETT--PHLSSQDVLESFLVNHNLIWNQITRFAFAGT---NTRIDEGQ----------------TQLSKQTEEQRSSLREKYTADKLYVVIEDIASTSTLEVDATRGTLIGVIKKQDPMGNSARWYVDTGVTQ-GFLPSQKLRPVQRQSQHHDQTTSDVAAAGRKSASPPNLMSLDSPEKEIKKVSSSHLQDLLSLDQETKVYHNYSNVPETPRVQVYQNIQYIHSEFYYAMYDFAGNMPGTLPITNGQALRLLRPHDEKGNDEWWLVEN-RNGKQGYVPRNYLS 1192          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Cavefish
Match: dnmbp (dynamin binding protein [Source:NCBI gene;Acc:100005174])

HSP 1 Score: 142.124 bits (357), Expect = 1.426e-33
Identity = 151/568 (26.58%), Postives = 258/568 (45.42%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDL-GVFAST----LDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL----RQITFDR-TEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEI--LNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLI--------EGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYN-QTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            +DL++  +   + L   ++ + DF  LFG++ SVI +++     L        D  ++G VFL   S  EEVYK YC N+D  + L+    K  ++   V + L  L  +   +  T    L   L+KP+QR ++YPL L  ++  T   H D   L  A      +   INE KR ++L    R+   DR  +K    ++H+I KK  RV   +  ++G + Q +D  + +   +F+  ++ I  FI  + +   +++E   + + SAI+  F  I                 R  +D  K++     +T   ++LV++PL +LL +F+GP  LI+KR  K +DY   K+R D  +  RVQ ++L   RN Y A+N  L  ELP     +  +F  C+  + Q     ++  +  L  L+        EG  +S  +E+         +L  LQ    SF P+   +  K           +         Y  QT+     L  ++ PE L + +++F   +   + I  G +VG++K+ +P G    WL++    + GFV  S+L
Sbjct:  664 KDLRMCRKEIIEPLRKRQVQNIDFDGLFGNIDSVIHLSQRLNETLQ-------DTDSIGQVFLDFKSELEEVYKVYCQNHDDAISLLETYEKDESIQKHVLECLENLRAIYRGWGKTNYINLGSFLIKPVQRVMRYPLLLMELLNATPQSHHDRKQLEDAVLSVKEINGNINEYKRRKDLVVKYRKGDEDRLIDKISKLSMHSIIKKSNRVSSHLKHLTGISPQIKDEAFDDAEKRFRLQERLIKSFIRDISLYLQHIRESASVKVLSAIS--FCDIYTERQQQLDPERFQRAHRCISD--KQFTQFKERT---ETLVISPLTQLLSMFAGPHKLIQKRFDKLLDYDNCKERADRLKDKRVQ-EELQVARNNYEALNAQLLDELPKFHYAAEELFTSCVRGFAQAQKDFIRLTLGELTPLLQLSGLGGTEGTLVSLFQEE------HGRVLQLLQ--SFSFFPENLPTSRKPFEKKTLEKQTSKKHMQGPPNYVLQTDDHRAGLLARYGPEKLFQAERNFNAAQDLDVSILEGDIVGVIKQQDPMGSQNRWLIDNGATK-GFVYSSFL 1207          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Cavefish
Match: arhgef38 (Rho guanine nucleotide exchange factor (GEF) 38 [Source:ZFIN;Acc:ZDB-GENE-090313-83])

HSP 1 Score: 138.658 bits (348), Expect = 4.138e-33
Identity = 179/719 (24.90%), Postives = 323/719 (44.92%), Query Frame = 3
Query: 1455 ILEKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLS-ANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDM--MLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL----RQITFDRTEKWHMR--TIHAIQKKPKRV------IVSISGAVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQ---LSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRT-GFVPRSYLTLSPFAANKVDLIGSKVISGNATYLNNRHSITADSSFDLMQFSPNNHDDTLRQISMVEISPVKTRPRAFSTANIIRIALFPHQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLSK 3554
            + ++KM KR K+IEE++ TE  ++ DL++ +    + L  T++   D   LF +++ V AV+ E L +L  A  E   +   +G VF+Q+ ++ EEVYK YC ++D    L+   ++   +       ++ L       + LDM  +++KP+QR +KYPL L  + + T PDHPD + L  A +   ++   INE KR +++    ++  ++ + K  +    IH ++KK +R+      +  +   V++E  + +E +  F+ L+K +   ++ +         +L LY+ +        +      L+F     +R   D +K+          L+ ++V PL  L  +FS P  LI+KR  K +   +  +     E S    ++L  LR+ Y A+N  L  EL      ++ I   C+     LST  L      L+ L+E  +   L       N    QN I+  +    LSF    R S  K   S                V  Q+E D  ++   +  + L ++K++    +   + +  G LV +L+  +P G S+ W V+   + T G+V  S+L        KV      V  G+  + N    ++   S  L  F+ +              +P  T+  + + A     A++  Q+R + E+++Q+   + IL+  D   ++ W LA+    G +GYVP NYL +
Sbjct:   41 VRQRKMMKREKVIEELVRTEGDYLTDLELCIREVLQPLRNTQV---DVDRLFTNMECVCAVSGELLHRLQEAITEPDPETQLIGEVFIQAKATIEEVYKIYCYHHDEASALLKSYNQQEEIQQLFRTCVSALKGK---PNLLDMGSLIIKPVQRVMKYPLLLAELWQATPPDHPDHHPLQEALTAAKIINININEFKRRKDIVLKYKRSDYEGSLKGRLNKFNIHTLRKKTERITGYFKILTGVEPQVRDEVFDKEEKM--FRNLEKAVRQLLKNI--------SLLELYAQV--------RYLLSHPLYF---QSRRNGHDPYKQL------GAGLERMLVVPLAALQVMFSAPQKLIQKRYDKLLTCCSCPE-----EASACSEEQLQALRD-YQALNAQLGEELQRFNHAAASILTNCL-----LSTVGL------LRGLMEAARPPVLQLPAPLSNISEVQNSIMEEISN--LSF---VRESSQK--PSMDRKVSFERRERKVPEVPRQSEADRARVLALYPQDRLYQLKRNCNACQEQDVSLLEGELVALLEDRDPLGSSSRWRVDTGGECTQGYVYSSFL--------KVYNPQRDVSEGSEDFDNLSLFVSGSRSCSLYGFTSSGQQG----------APENTQENS-ADAEEHFYAVYAFQARCDKELTLQEYQPVRILQFSDLGGNKEWWLAEA--NGQRGYVPANYLGR 681          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Cavefish
Match: arhgef37 (Rho guanine nucleotide exchange factor 37 [Source:NCBI gene;Acc:103046351])

HSP 1 Score: 95.9005 bits (237), Expect = 1.146e-19
Identity = 153/593 (25.80%), Postives = 240/593 (40.47%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKL-SANMEDGLDKI--AVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMR------TIHAIQKKPKRVIVSI---SGAV-QNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFY-LVACKRGETD---------YFKKYYTVANKTCI-------LDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYL-----------QLSTS---TLQSNILSLKNLIEGDQLSTEEEQRN----CRNHQNEILA-FLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLT 3158
            + L+I       NL   + P  +   +F  +  V+ V+  FLS L  A+M+    +    + + FL      E  YKEY  NY+  +  I    K   V       + + +   V ASTL   LV P+QR  +YPL L+TI ++T P HP    L   +     L  +INE KRF E+    + +TE   ++      + H+I KK  R+   I   +G + + +D E+  +V  F  L+K I   IE    L DN++  L                     +H    ++CK  E D          F K  TVA +  I       L +LV  PL+ L EL +GP  LI+KRQ K +D+  +      +E S +  D+   + N Y  +N  L  ELP    K+  +    +G +            QL+TS    L  + L      E  + S  EE R     C++ Q+E+ A  +Q  ++S                                    E  +  L +K   + + ++    V T+   + +  G LV ++   + +G    WLV+    R G+VP S LT
Sbjct:  100 KHLQICTVTIRSNLEKIQPPLANLDGMFQHIDEVMEVSGRFLSLLHQAHMKPSDPQYLETLCTSFLTLSRDIETAYKEYLANYN-NITAIENGYKQKEVLWMEMVKVIKSSAPEVNASTLSFFLVMPVQRIARYPLLLQTIQKHTDPQHPAYALLEETAHTAVQLNCRINEYKRFREVAD-KYKKTENLTIKDKINRLSGHSIAKKTARLSQYIKHETGMIPKMKDEEFDSLVGFFFVLEKGI---IE----LHDNMEAYL---------------------IHLQRFLSCKPEEADLDLEGEKTALFSKEITVALRQWIYPAYEARLKTLVFKPLSSLRELMTGPRNLIRKRQDKLLDFEMI------EEKSNLSYDE-QAVANTYKTMNTLLLTELPQFNGKALQLLWTTLGAFSCLQRDLSADMEQLATSFTHQLPHSYLDSSAFWEWAEGSVLEEARKLEALCQSVQDELNAPIVQVSVVS------------------------------------EKRLKLLTDKHSSDKIYQLTGPVVATRDLDLTLNKGELVAVISEMDTRGDRRRWLVDAGGPR-GYVPASKLT 618          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Cavefish
Match: arhgef3 (Rho guanine nucleotide exchange factor 3 [Source:NCBI gene;Acc:103038887])

HSP 1 Score: 65.855 bits (159), Expect = 1.642e-10
Identity = 62/209 (29.67%), Postives = 101/209 (48.33%), Query Frame = 3
Query: 1440 IKLGSILEKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQ-DFHLLFGDLKSVIAVAEEFLSKL-SANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMM--LVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELR 2054
            + LG +L  K  KR + I E+ + E+  I+DLK+  +A+   ++   I  + + + +FG L S+I + E+ LS+L  A   DG     VG + +  +   +  Y  YC N      L++ K +   V DF+   L        F+  LD+   L  P  R +KYPL L+ I+++T  DHPD   L  A +    +  +IN +    E R
Sbjct:  109 VGLGQMLSSKEIKRQEAIFELSQGEQDLIEDLKLAKKAYHDPMLKLSIMTELELNQIFGTLDSLIPLHEDLLSRLREARKPDG-STDHVGHILVDWLPCLDS-YNSYCSNQVAAKALLDHKKQDHRVHDFLQRCLE-----SPFSRKLDLWNFLDIPRSRLVKYPLLLREILKHTANDHPDRQHLDEAINMIQSIVAEINTQTGESECR 310          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Cavefish
Match: arhgef3 (Rho guanine nucleotide exchange factor 3 [Source:NCBI gene;Acc:103038887])

HSP 1 Score: 65.4698 bits (158), Expect = 2.253e-10
Identity = 62/209 (29.67%), Postives = 101/209 (48.33%), Query Frame = 3
Query: 1440 IKLGSILEKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQ-DFHLLFGDLKSVIAVAEEFLSKL-SANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMM--LVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELR 2054
            + LG +L  K  KR + I E+ + E+  I+DLK+  +A+   ++   I  + + + +FG L S+I + E+ LS+L  A   DG     VG + +  +   +  Y  YC N      L++ K +   V DF+   L        F+  LD+   L  P  R +KYPL L+ I+++T  DHPD   L  A +    +  +IN +    E R
Sbjct:   84 VGLGQMLSSKEIKRQEAIFELSQGEQDLIEDLKLAKKAYHDPMLKLSIMTELELNQIFGTLDSLIPLHEDLLSRLREARKPDG-STDHVGHILVDWLPCLDS-YNSYCSNQVAAKALLDHKKQDHRVHDFLQRCLE-----SPFSRKLDLWNFLDIPRSRLVKYPLLLREILKHTANDHPDRQHLDEAINMIQSIVAEINTQTGESECR 285          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Sea Lamprey
Match: dnmbp (dynamin binding protein [Source:NCBI gene;Acc:100005174])

HSP 1 Score: 149.443 bits (376), Expect = 1.682e-36
Identity = 144/571 (25.22%), Postives = 254/571 (44.48%), Query Frame = 3
Query: 1530 DLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDK-----IAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL--------RQITFDRTEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGN----YLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQN-EILAFLQRDLLSF-------NPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            DL+   E     L  T++ + D   LFG+L++V+ V   F   L  + +  +       ++ G +FL   S  EEVYK YC N+D  + L+    K  ++   ++  L  + +   + + L  +L+KP+QR ++YPL L  ++  T P HPD   L  A      L   INE KR ++L             D+  K +M   H+I KK  RV   +  ++G A Q  D  ++E    F+ L++ +  F+ ++ +    L+E L      +  F+++       +   Y   C+   T+ F ++         +D LV++PL+ LL  F+GP  L++KR  K +DY A ++   ++   R + ++L   +  Y+A+N  L  ELP+L +    +      N    +  L  + LQ  +  L N++  ++ ST  EQ+     ++   L  LQR   SF        P  RN +      + +        +       QT++   +L  +F P+ L  + +     +   + +  G LV ++K+ +P G    W V       GFV  S+L
Sbjct:  759 DLQFCREEIYIPLRKTQVANLDVEGLFGNLEAVLEVNARFYESLQLSADGRVSYGDDVLLSPGEIFLAFKSELEEVYKVYCRNHDDAISLLEASEKDEDIKAQMAVCLKNMRERSNYIN-LGALLIKPVQRVMRYPLLLTELLGATPPSHPDQPSLSKALVALRQLNHNINEFKRRKDLVVKYRKDDDSSLIDKLSKLNM---HSILKKSSRVSGHLKHLTGMASQIRDEAFEEEERGFRGLERAVKSFLRSLSLYTQQLREALAAELQCSSSFSALHAKPDADR---YQHTCRHIATESFPQFKDR------VDRLVISPLSALLASFAGPHKLVQKRYDKLLDYSARRE-ASERNRDRPESEELQATQKDYVALNAQLLEELPLLRAGGQALLGAAARNLVAVHRDLVLAILQ-QLQPLDNIL--NKKSTAAEQQGAFGARHVHALTELQR--FSFMLSGILVEPGPRNPLATSPDGTRYNVAGVQATSGS----TQTDSGRSQLLARFPPDRLFVLDRKVNVAQDLDLALSEGELVAVIKQQDPMGSHRRWFVSNGEVAQGFVYSSFL 1306          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008024.1 (pep scaffold:Pmarinus_7.0:GL476484:132482:154761:-1 gene:ENSPMAG00000007248.1 transcript:ENSPMAT00000008024.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 8.172e-12
Identity = 52/165 (31.52%), Postives = 79/165 (47.88%), Query Frame = 3
Query: 1569 IPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMED-GLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLND---LGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIA-ASSEFDVLAQKINEKKRFEE 2048
            I  ++P+ D + LFG++K +     E L +L    ED   D +A+   F++    FE +Y +YC N+   ++L+ K  +  +   F  D    L     LG F       L+KP+QR LKY L L+  IE  L    D  +++  A S    +A  INE KR  E
Sbjct:   41 ISQRLPNDDVNTLFGNIKEIYKFNSELLEEL----EDCSNDPVAIAECFVEKSGGFE-IYTQYCTNFPSSMELLTKCMRTKSTAKFFRDHQAALKHNLPLGSF-------LLKPVQRILKYHLLLQE-IEKRLDKSTDGYEVVQDALSAMHGVAWHINEMKRKHE 192          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008020.1 (pep scaffold:Pmarinus_7.0:GL476484:132482:154779:-1 gene:ENSPMAG00000007248.1 transcript:ENSPMAT00000008020.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 9.366e-12
Identity = 52/165 (31.52%), Postives = 79/165 (47.88%), Query Frame = 3
Query: 1569 IPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMED-GLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLND---LGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIA-ASSEFDVLAQKINEKKRFEE 2048
            I  ++P+ D + LFG++K +     E L +L    ED   D +A+   F++    FE +Y +YC N+   ++L+ K  +  +   F  D    L     LG F       L+KP+QR LKY L L+  IE  L    D  +++  A S    +A  INE KR  E
Sbjct:   39 ISQRLPNDDVNTLFGNIKEIYKFNSELLEEL----EDCSNDPVAIAECFVEKSGGFE-IYTQYCTNFPSSMELLTKCMRTKSTAKFFRDHQAALKHNLPLGSF-------LLKPVQRILKYHLLLQE-IEKRLDKSTDGYEVVQDALSAMHGVAWHINEMKRKHE 190          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009021.1 (pep scaffold:Pmarinus_7.0:GL482604:596:7954:-1 gene:ENSPMAG00000008160.1 transcript:ENSPMAT00000009021.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 1.841e-9
Identity = 50/196 (25.51%), Postives = 84/196 (42.86%), Query Frame = 3
Query: 1578 KIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMM---LVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELR-QITFDRTEKWHMRTIHAIQKKPKRVIVSISGAV 2153
            K+   D   L G+L+ V A  +  +  L    +    +  VG  F+  ++    +Y  YC N+   +  + + S+   + +F       +   GV +  L M+   L KP  R  KYP  LK +  +    HPD ND+  A + F  LA +  E ++ +EL  Q+  +    W    + A+       IV +S AV
Sbjct:  126 KLSATDVSTLMGNLEDVCAFQQGLMQALEDCTKVPESQQTVGGCFMSLMNQMHGLYLAYCCNHPWAVRTLQEHSEV--LGEF-------MESKGVSSPGLLMLTTSLSKPFMRLDKYPTLLKELERHMEDIHPDRNDIHGAMTAFKTLATQCREMRKRKELELQMMTEPIRGWEGEDMKALGS-----IVYMSQAV 307          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Sea Lamprey
Match: ARHGEF37 (Rho guanine nucleotide exchange factor 37 [Source:HGNC Symbol;Acc:HGNC:34430])

HSP 1 Score: 60.077 bits (144), Expect = 2.643e-9
Identity = 46/177 (25.99%), Postives = 80/177 (45.20%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDK---IAV-GSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNR--LNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKR 2039
              L++ ++     L  T++   D  L+FG+++ +I V++  L  L      G +    +AV G VF +     E  Y+ YC  Y+     + K  + +  T    +      +  LG+    L  ML+KP+QR ++Y L L+ ++  T   HP+   L  A      +   INE+KR
Sbjct:   48 HHLRLCVDLMLAPLRETQVEGPDVSLVFGNMEEIIGVSQALLQALHDCTRGGSESHSTLAVSGEVFEKFSPDIEAAYRPYCQYYEEAAACL-KCCRGNPATSARIEACEAQLVEQLGMNVD-LSFMLIKPVQRVMRYSLLLQAVLNRTPEGHPEHAALKRAVRALLDVNSSINEQKR 222          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Yeast
Match: LSB1 (Negative regulator of actin nucleation-promoting factor activity; interacts with Las17p, a homolog of human Wiskott-Aldrich Syndrome protein (WASP), via an N-terminal SH3 domain, and along with PIN3 cooperatively inhibits the nucleation of actin filaments; overexpression blocks receptor-mediated endocytosis; protein increases in abundance and forms nuclear foci in response to DNA replication stress; LSB1 has a paralog, PIN3, that arose from the whole genome duplication [Source:SGD;Acc:S000003368])

HSP 1 Score: 51.2174 bits (121), Expect = 2.454e-7
Identity = 23/54 (42.59%), Postives = 37/54 (68.52%), Query Frame = 3
Query:  108 FYKALFDYESTEIQDLHFKTNDIIEFLSKSSPDWYQGRNIMSGDSGLFPTNFVE 269
            + +AL+D+E+ +  DL  KT D I+ L K SPDWY+G++  +   G+FP N+V+
Sbjct:   57 YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKS--NNKIGIFPANYVK 108          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Nematostella
Match: EDO44980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUA3])

HSP 1 Score: 110.923 bits (276), Expect = 1.815e-24
Identity = 110/435 (25.29%), Postives = 188/435 (43.22%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFL------------------KTI--------IENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTE------KWHMRTIHAIQKKPKRVIVSISGAV----QNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFT-SIIKSNFGSQ--LHFYLVACKRGETDYFKKYYTVANKTCILDSL-------VVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCD---DKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNY 2684
            +DL+  L+ F + L  TK+ D +  +LFG++ SV+  +   L    A ++D   +  +G  F +     + VY  YC N+D  + L+ K        +     L+ + D       L   L+KP+QR LKYPL L                  KTI        ++ T   H D ++L+ A S    +A  INE KR ++L  + + +TE      K+   + H++ KK  R    ++ +     Q  D  + E   KF  L+K +   I+ V              S+  + F  ++ +     Q    +YL A    E   ++      +   +LD+        V+ PLN LL +F GP  LI+KR  K +DY +   + +   DK+  +   ++L+  +  Y A+N  L  ELP+   K+  +  +C+ N+
Sbjct:  994 RDLQTCLKYFYEELKNTKVVDAE--VLFGNMHSVVETSTRLLGSFEAALQDDKQQ-ELGKCFAEHAEEIKSVYSTYCKNHDDAIGLLEKYEDCLEAQEAFRKCLDAVRDT-TKCWDLSSFLIKPVQRVLKYPLLLSELLKVIPYKVYGSTAKCKTIRIKYMARLLKCTPQIHKDKDNLVRALSAMTEVAATINEVKRRKDL-VVKYKKTEESGISNKFQKLSWHSVMKKSSRFTQKLTQSTGLVNQTVDKSFNEEEKKFNNLEKTVKNLIKNV--------------SSYVEQFQDTVTRQEVNGQNIQEYYLDASTCTEVTLYQSTQQRISGI-LLDAFMGEVQYCVLTPLNSLLAMFQGPQRLIQKRHHKCLDYDSWSNKMEKIKDKDKLKQAKEELESAKRNYEALNAQLLEELPLFRQKTMSLVKDCVLNF 1408          

HSP 2 Score: 49.6766 bits (117), Expect = 8.244e-6
Identity = 32/84 (38.10%), Postives = 50/84 (59.52%), Query Frame = 3
Query:  600 LHGMKGVFSLKNVYSEKI-SSENIDRKNIWITLFDYSGTHVNDLSIRKGDKLKFLDRIDNNWNLMQNENGKVGMTPVTYVKNIS 848
            L+  KG+F +   Y+EKI +S  IDR  + I    YS     ++S++KGD +K L+ I NNW L  + NG +G+ P  +V++ S
Sbjct:   89 LNSKKGLFPIS--YTEKIDNSYTIDRYVVAIQ--SYSAQRPGEISLKKGDFVKVLEEIGNNW-LRGDINGTIGIFPCVFVEDCS 167          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Nematostella
Match: EDO27464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T967])

HSP 1 Score: 62.3882 bits (150), Expect = 3.761e-10
Identity = 45/152 (29.61%), Postives = 76/152 (50.00%), Query Frame = 3
Query: 1599 HLLFGDLKSVIAVAEEFLSKLSANMEDGLDK-----IAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKR 2039
            +LLF +++ +     EF  KL   +ED   K       +G VFL++   F+ +Y EYC N+   +  +    +++N   F  +    L D+     +LD  L+ P+Q+  KYPL L  ++++T P H D + +  A      +A  INE+KR
Sbjct:   19 YLLFSNIEQIY----EFHQKLLLQLEDCYLKDNPCDSMIGRVFLENKEGFQ-IYSEYCNNHPHAIAELKTLCESNNYKHFF-EACRLLQDM--INISLDGFLLTPVQKICKYPLQLAELLKHTYPTHKDYDAVHDALRTMKEVASLINERKR 162          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Nematostella
Match: EDO45201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTF1])

HSP 1 Score: 61.6178 bits (148), Expect = 1.215e-9
Identity = 45/152 (29.61%), Postives = 76/152 (50.00%), Query Frame = 3
Query: 1599 HLLFGDLKSVIAVAEEFLSKLSANMEDGLDK-----IAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKR 2039
            +LLF +++ +     EF  KL   +ED   K       +G VFL++   F+ +Y EYC N+   +  +    +++N   F  +    L D+     +LD  L+ P+Q+  KYPL L  ++++T P H D + +  A      +A  INE+KR
Sbjct:  135 YLLFSNIEQIY----EFHQKLLLQLEDCYLKDNPCDSMIGRVFLENKEGFQ-IYSEYCNNHPHAIAELKTLCESNNYKHFF-EACRLLQDM--INISLDGFLLTPVQKICKYPLQLAELLKHTYPTHKDYDAVHDALRTMKEVASLINERKR 278          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Nematostella
Match: EDO38076 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE08])

HSP 1 Score: 51.6026 bits (122), Expect = 2.821e-7
Identity = 21/56 (37.50%), Postives = 38/56 (67.86%), Query Frame = 3
Query:  102 MIFYKALFDYESTEIQDLHFKTNDIIEFLSKSSPDWYQGRNIMSGDSGLFPTNFVE 269
            M   +ALFD+E+ E  ++ FK  D IE +  S  +W++G+ + +G+ G+FP+N+V+
Sbjct:  132 MEAVQALFDFEAQEEGEVSFKRGDCIEVIDNSDVNWWRGKVLTTGEIGMFPSNYVK 187          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Nematostella
Match: EDO29864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2F6])

HSP 1 Score: 49.2914 bits (116), Expect = 4.689e-7
Identity = 21/50 (42.00%), Postives = 33/50 (66.00%), Query Frame = 3
Query:  117 ALFDYESTEIQDLHFKTNDIIEFLSKSSPDWYQGRNIMSGDSGLFPTNFV 266
            AL+D+ + E  +L+FK  + IE L K   +W++GR   +G+ GLFP N+V
Sbjct:   63 ALYDFVAQEAGELNFKKGNHIEVLDKEDDNWWKGRVAETGEEGLFPRNYV 112          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Medaka
Match: dnmbp (dynamin binding protein [Source:NCBI gene;Acc:101156363])

HSP 1 Score: 160.999 bits (406), Expect = 2.311e-39
Identity = 157/568 (27.64%), Postives = 263/568 (46.30%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL-------RQITF-DRTEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIE---------GDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQ---YRNSINKG-DXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            +DL + +E   + L   ++ + DF+ LFG++ SVI +++    +L        +  ++G  FL   S  EEVYK YC N+D  + L+    K   +   V + L RL     + + L   L+KP+QR ++YPL L  ++  T   H D   L  A      +   INE KR ++L        + TF D+  K  M   H+I KK  RV   +  ++G A Q +D  + E   KF+  ++ I  FI  + +   +L+E  ++       F  I           +  A  R  +D  +K+     +T   ++LV+NPL +LL +F+GP  LI+KR  K +DY   K+R +  +  RVQ ++L   RN Y A+N  L  ELP  +  +  +F  C+  + Q     +++ +  LK L++         G+ ++  +E+ NC      +L  LQ    SF P+      S  K  +  +     +            QT+     L  ++ PENL + +++F   +   I I  G LVG++K+ +P G    WL++    + GFV  S+L
Sbjct:  860 KDLNMCVEEIIEPLQEKQVKNMDFNGLFGNITSVIELSQRLYDELQ-------ETDSIGKTFLDFRSQMEEVYKLYCQNHDDAISLLESYEKDEGIQRHVLECLERLRGKANYIN-LGSFLIKPVQRVMRYPLLLTELLGATPESHHDRLQLTKAVQVVKEINVNINEYKRRKDLVMKYRKGDEDTFIDKISKLSM---HSIIKKSNRVSSHLKQLTGMAPQFKDEVFDEAEKKFRLQERLIKTFIRDISLYLQHLRESASVKVLAAISFCDIYNERSLMDPECFQRA-HRCISD--RKFTQFKERT---EALVINPLTQLLAMFAGPYKLIQKRFDKLLDYDNCKERAERLKDRRVQ-EELRAARNNYEALNAQLLDELPKFLQTAEEMFLGCVTAFAQAQKDFMRTTMEELKPLLQQFSNKGATSGNLIAQFQEEYNC------VLRLLQS--FSFCPENLPLTTSTKKPVEKKTLDKQTSKKQLQGPPNCSLQTDEHRTALLVRYGPENLFQAERNFNAAQDLDISIQEGDLVGVIKQQDPMGSQNRWLIDNGVTK-GFVYSSFL 1400          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Medaka
Match: dnmbp (dynamin binding protein [Source:NCBI gene;Acc:101156363])

HSP 1 Score: 157.532 bits (397), Expect = 2.789e-38
Identity = 159/580 (27.41%), Postives = 264/580 (45.52%), Query Frame = 3
Query: 1527 QDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLN------------DLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL-------RQITF-DRTEKWHMRTIHAIQKKPKRV---IVSISG-AVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIE---------GDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQ---YRNSINKG-DXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYL 3155
            +DL + +E   + L   ++ + DF+ LFG++ SVI +++    +L        +  ++G  FL   S  EEVYK YC N+D  + L+    K   +   V + L RL             +LG F       L+KP+QR ++YPL L  ++  T   H D   L  A      +   INE KR ++L        + TF D+  K  M   H+I KK  RV   +  ++G A Q +D  + E   KF+  ++ I  FI  + +   +L+E  ++       F  I           +  A  R  +D  +K+     +T   ++LV+NPL +LL +F+GP  LI+KR  K +DY   K+R +  +  RVQ ++L   RN Y A+N  L  ELP  +  +  +F  C+  + Q     +++ +  LK L++         G+ ++  +E+ NC      +L  LQ    SF P+      S  K  +  +     +            QT+     L  ++ PENL + +++F   +   I I  G LVG++K+ +P G    WL++    + GFV  S+L
Sbjct:  860 KDLNMCVEEIIEPLQEKQVKNMDFNGLFGNITSVIELSQRLYDELQ-------ETDSIGKTFLDFRSQMEEVYKLYCQNHDDAISLLESYEKDEGIQRHVLECLERLRAIYRNWGKANYINLGSF-------LIKPVQRVMRYPLLLTELLGATPESHHDRLQLTKAVQVVKEINVNINEYKRRKDLVMKYRKGDEDTFIDKISKLSM---HSIIKKSNRVSSHLKQLTGMAPQFKDEVFDEAEKKFRLQERLIKTFIRDISLYLQHLRESASVKVLAAISFCDIYNERSLMDPECFQRA-HRCISD--RKFTQFKERT---EALVINPLTQLLAMFAGPYKLIQKRFDKLLDYDNCKERAERLKDRRVQ-EELRAARNNYEALNAQLLDELPKFLQTAEEMFLGCVTAFAQAQKDFMRTTMEELKPLLQQFSNKGATSGNLIAQFQEEYNC------VLRLLQS--FSFCPENLPLTTSTKKPVEKKTLDKQTSKKQLQGPPNCSLQTDEHRTALLVRYGPENLFQAERNFNAAQDLDISIQEGDLVGVIKQQDPMGSQNRWLIDNGVTK-GFVYSSFL 1406          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Medaka
Match: arhgef38 (Rho guanine nucleotide exchange factor 38 [Source:NCBI gene;Acc:101171227])

HSP 1 Score: 94.7449 bits (234), Expect = 2.808e-19
Identity = 112/418 (26.79%), Postives = 197/418 (47.13%), Query Frame = 3
Query: 1428 DYESIKLGSILEKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDG-LDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTD-FVSDGLNRLNDLGVFASTLDM--MLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTE-------KWHMRTIHAIQKKPKR------VIVSISGAVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHEL 2630
            D E ++L     +KM +R+ +I+E+++TEK ++ DL++ ++   + L   ++ D D   LF ++++V  V+ E L +L   M D   + + +G VF+Q+ ++ E+VYK YC ++D     +    K   +   F++  L     L   A+ LDM  +L+KP+QR +KYPL L  + + T  DHPD   L  A +   ++   INE +R +++  + + R E       K     IH+I+KK  R      ++  +   V++E  + +E +  F+ L K +   ++ V     + + I+                   S L    +  +  E    K    +A     ++ +V+ PL+ L  +F+ P  LI+KR  K +DY      C   E      D  D  R  Y A+NN L  EL
Sbjct:   87 DPEEVRL-----RKMNRRANVIKELVQTEKDYLTDLELCIKEVVQPLRKMQVLDVDR--LFTNMETVCEVSAELLQRLHDAMADPDPEAVVIGEVFIQAKAALEDVYKIYCYHHDDANMSLKAYEKDEQIKQHFIACVLA----LKGKANLLDMGSLLIKPVQRIMKYPLLLGELWQATPEDHPDHQPLQEAFTTAKIINININEFRRRKDI-VMKYKRLEDEGTLRGKLTKLNIHSIRKKGDRFAGYLKILTGVEPQVRDEVFDREEKL--FRSLGKAVRQLVKNVHCYMQHTQVIIQ------------------SSLELAKLPHRNSEVMIEK----LALNKDRMEKVVLVPLSALQGMFTAPQKLIQKRYDKLLDY------CSGSE------DPADPARRDYEALNNLLVEEL 456          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Medaka
Match: arhgef37 (Rho guanine nucleotide exchange factor 37 [Source:NCBI gene;Acc:101168631])

HSP 1 Score: 72.4034 bits (176), Expect = 2.277e-12
Identity = 80/278 (28.78%), Postives = 120/278 (43.17%), Query Frame = 3
Query: 1710 FLQSVSSFEEVYKEYCVNYDRKLDLINK-KSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMR------TIHAIQKKPKRVIVSISGAVQNEDTEYQEIV-IKFKELKKCISFFIETVFILRDNLKEIL-NLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDY 2516
            FL   S  E  YKEY  NY     L N  K K +   + V+  + + +   V AS+L   LV P+QR  +YPL L+TI ++T P HP    L   +     L  +INE KRF E+    + +TE   +R        H+I KK  R     S  +++E     ++V  +F  L+   +     +  L +N++  L NL       F       F   +     A    E     + + +      + +L+  PL  L +L  GP  LIKKR  K +DY
Sbjct:  207 FLALSSDIEAAYKEYLANYSHVTVLENAYKQKEALWKEIVT--VVKASAPEVNASSLSFFLVMPVQRIARYPLLLQTIQKHTDPSHPACALLDKTAHTSVALNCRINEYKRFREVAD-KYKKTENLTIRDKIVRLNTHSIAKKTAR----FSQHIKHETGMAPKVVDEEFDALEGFFAVLDHGILQLLENVETYLFNL-----QGFLECRTEEFDFDMEGEKSAVSYKEITTALRQWVLPTFEKRMRTLIHKPLCALRDLLVGPRNLIKKRFHKLLDY 472          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Medaka
Match: arhgef37 (Rho guanine nucleotide exchange factor 37 [Source:NCBI gene;Acc:101168631])

HSP 1 Score: 72.4034 bits (176), Expect = 2.277e-12
Identity = 80/278 (28.78%), Postives = 120/278 (43.17%), Query Frame = 3
Query: 1710 FLQSVSSFEEVYKEYCVNYDRKLDLINK-KSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMR------TIHAIQKKPKRVIVSISGAVQNEDTEYQEIV-IKFKELKKCISFFIETVFILRDNLKEIL-NLYSAITDDFTSIIKSNFGSQLHFYLVACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQSKYIDY 2516
            FL   S  E  YKEY  NY     L N  K K +   + V+  + + +   V AS+L   LV P+QR  +YPL L+TI ++T P HP    L   +     L  +INE KRF E+    + +TE   +R        H+I KK  R     S  +++E     ++V  +F  L+   +     +  L +N++  L NL       F       F   +     A    E     + + +      + +L+  PL  L +L  GP  LIKKR  K +DY
Sbjct:  207 FLALSSDIEAAYKEYLANYSHVTVLENAYKQKEALWKEIVT--VVKASAPEVNASSLSFFLVMPVQRIARYPLLLQTIQKHTDPSHPACALLDKTAHTSVALNCRINEYKRFREVAD-KYKKTENLTIRDKIVRLNTHSIAKKTAR----FSQHIKHETGMAPKVVDEEFDALEGFFAVLDHGILQLLENVETYLFNL-----QGFLECRTEEFDFDMEGEKSAVSYKEITTALRQWVLPTFEKRMRTLIHKPLCALRDLLVGPRNLIKKRFHKLLDY 472          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Planmine SMEST
Match: SMESG000056121.1 (SMESG000056121.1)

HSP 1 Score: 1392.1 bits (3602), Expect = 0.000e+0
Identity = 751/756 (99.34%), Postives = 753/756 (99.60%), Query Frame = 3
Query:  102 MIFYKALFDYESTEIQDLHFKTNDIIEFLSKSSPDWYQGRNIMSGDSGLFPTNFVEIIIIPQDINEESIYIIKENNDTFEKGTFLVENHVSDNFLSCYLMTDENKSLLNVPLSTLIKLKISSEFQGYTKCIATCDHNEPADNEIAFLTGDTIWMERKINKDFGEGILHGMKGVFSLKNVYSEKISSENIDRKNIWITLFDYSGTHVNDLSIRKGDKLKFLDRIDNNWNLMQNENGKVGMTPVTYVKNISINSPMRLXXXXXXXXXXXXXXXXXXADNQSDFKIIPNTVLQELRNRIVXXXXXXXXXXXXXXXHNKYSTLISNLEALPTGTLVPSENCYETNSTLRPTDISDIPDENEIPEIVLEQFNKREKRIGNDIEVINDNIKSIENKLTHENSQDDIQTMTCNLAFXXXXXXXXXXXXXAIKDQRKNFLSGNTQDVDENDYESIKLGSILEKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMRTIHAIQKKPKRVIVSISGAVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGE 2369
            MIFYKALFDYES+EIQDLHFKTNDIIEFLSKSSPDWYQGRNIMSGDSGLFPTNFVEIIIIPQDINEESIYIIKENNDTFEKGTFLVENHVSDNFLSCYLMTDENKSLLNVPLSTLIKLKISSE QGYTKCIATCDHNEPADNEIAFLTGDTIWMERKINKDFGEGILHGMKGVFSLKNVYSEKISSENIDRKNIWITLFDYSGTHVNDLSIRKGDKLKFLDRIDNNWNLMQNENGKVGMTPVTYVKNISINSPMRLSISDTETNDNSDTNETPEADNQSDFKIIPNTVLQELRNRIVNSNENEYENLSYCNSHNKYSTLISNLEALPTGTLVPSENCYETNSTLRPTDISDIPDENEIPEIVLEQFNKREKRIGNDIEVINDNIKSIENKLTHENSQDDIQTMTCNLAFLKEERKTKLKELEAIKDQRKNFLSGNTQDVDENDYESIKLGSILEKKMQKRSKIIEEILETEKKFIQDLKITLEAFDKNLIP KIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMRTIHAIQKKPKRVIVSISGAVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKR +
Sbjct:    1 MIFYKALFDYESSEIQDLHFKTNDIIEFLSKSSPDWYQGRNIMSGDSGLFPTNFVEIIIIPQDINEESIYIIKENNDTFEKGTFLVENHVSDNFLSCYLMTDENKSLLNVPLSTLIKLKISSESQGYTKCIATCDHNEPADNEIAFLTGDTIWMERKINKDFGEGILHGMKGVFSLKNVYSEKISSENIDRKNIWITLFDYSGTHVNDLSIRKGDKLKFLDRIDNNWNLMQNENGKVGMTPVTYVKNISINSPMRLSISDTETNDNSDTNETPEADNQSDFKIIPNTVLQELRNRIVNSNENEYENLSYCNSHNKYSTLISNLEALPTGTLVPSENCYETNSTLRPTDISDIPDENEIPEIVLEQFNKREKRIGNDIEVINDNIKSIENKLTHENSQDDIQTMTCNLAFLKEERKTKLKELEAIKDQRKNFLSGNTQDVDENDYESIKLGSILEKKMQKRSKIIEEILETEKKFIQDLKITLEAFDKNLIPAKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMRTIHAIQKKPKRVIVSISGAVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRAK 756          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Planmine SMEST
Match: SMESG000056121.1 (SMESG000056121.1)

HSP 1 Score: 1391.71 bits (3601), Expect = 0.000e+0
Identity = 751/756 (99.34%), Postives = 753/756 (99.60%), Query Frame = 3
Query:  102 MIFYKALFDYESTEIQDLHFKTNDIIEFLSKSSPDWYQGRNIMSGDSGLFPTNFVEIIIIPQDINEESIYIIKENNDTFEKGTFLVENHVSDNFLSCYLMTDENKSLLNVPLSTLIKLKISSEFQGYTKCIATCDHNEPADNEIAFLTGDTIWMERKINKDFGEGILHGMKGVFSLKNVYSEKISSENIDRKNIWITLFDYSGTHVNDLSIRKGDKLKFLDRIDNNWNLMQNENGKVGMTPVTYVKNISINSPMRLXXXXXXXXXXXXXXXXXXADNQSDFKIIPNTVLQELRNRIVXXXXXXXXXXXXXXXHNKYSTLISNLEALPTGTLVPSENCYETNSTLRPTDISDIPDENEIPEIVLEQFNKREKRIGNDIEVINDNIKSIENKLTHENSQDDIQTMTCNLAFXXXXXXXXXXXXXAIKDQRKNFLSGNTQDVDENDYESIKLGSILEKKMQKRSXXXXXXXXXXXXXXQDLKITLEAFDKNLIPTKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMRTIHAIQKKPKRVIVSISGAVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRGE 2369
            MIFYKALFDYES+EIQDLHFKTNDIIEFLSKSSPDWYQGRNIMSGDSGLFPTNFVEIIIIPQDINEESIYIIKENNDTFEKGTFLVENHVSDNFLSCYLMTDENKSLLNVPLSTLIKLKISSE QGYTKCIATCDHNEPADNEIAFLTGDTIWMERKINKDFGEGILHGMKGVFSLKNVYSEKISSENIDRKNIWITLFDYSGTHVNDLSIRKGDKLKFLDRIDNNWNLMQNENGKVGMTPVTYVKNISINSPMRLSISDTETNDNSDTNETPEADNQSDFKIIPNTVLQELRNRIVNSNENEYENLSYCNSHNKYSTLISNLEALPTGTLVPSENCYETNSTLRPTDISDIPDENEIPEIVLEQFNKREKRIGNDIEVINDNIKSIENKLTHENSQDDIQTMTCNLAFLKEERKTKLKELEAIKDQRKNFLSGNTQDVDENDYESIKLGSILEKKMQKRSKIIEEILETEKKFIQDLKITLEAFDKNLIP KIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMRTIHAIQKKPKRVIVSISGAVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKR +
Sbjct:    1 MIFYKALFDYESSEIQDLHFKTNDIIEFLSKSSPDWYQGRNIMSGDSGLFPTNFVEIIIIPQDINEESIYIIKENNDTFEKGTFLVENHVSDNFLSCYLMTDENKSLLNVPLSTLIKLKISSESQGYTKCIATCDHNEPADNEIAFLTGDTIWMERKINKDFGEGILHGMKGVFSLKNVYSEKISSENIDRKNIWITLFDYSGTHVNDLSIRKGDKLKFLDRIDNNWNLMQNENGKVGMTPVTYVKNISINSPMRLSISDTETNDNSDTNETPEADNQSDFKIIPNTVLQELRNRIVNSNENEYENLSYCNSHNKYSTLISNLEALPTGTLVPSENCYETNSTLRPTDISDIPDENEIPEIVLEQFNKREKRIGNDIEVINDNIKSIENKLTHENSQDDIQTMTCNLAFLKEERKTKLKELEAIKDQRKNFLSGNTQDVDENDYESIKLGSILEKKMQKRSKIIEEILETEKKFIQDLKITLEAFDKNLIPAKIPDQDFHLLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEELRQITFDRTEKWHMRTIHAIQKKPKRVIVSISGAVQNEDTEYQEIVIKFKELKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLVACKRAK 756          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Planmine SMEST
Match: SMESG000056110.1 (SMESG000056110.1)

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 342/344 (99.42%), Postives = 344/344 (100.00%), Query Frame = 3
Query: 2523 MKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDXXXXXXXXXXXXXXXXXXVYNQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLTLSPFAANKVDLIGSKVISGNATYLNNRHSITADSSFDLMQFSPNNHDDTLRQISMVEISPVKTRPRAFSTANIIRIALFPHQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLSK 3554
            MKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDFSSCFLNCNNSNANLRNC+Y+QTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLTLSPFAANKVDLIGSKVISGNATYLNNRHSITADSSFDLMQFSPNNHDDTLRQISMVEISPVKTRPRAFSTANIIRIALFPHQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLSK
Sbjct:    1 MKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKSSVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNEILAFLQRDLLSFNPQYRNSINKGDFSSCFLNCNNSNANLRNCIYHQTETDVIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTSWLVEVCPKRTGFVPRSYLTLSPFAANKVDLIGSKVISGNATYLNNRHSITADSSFDLMQFSPNNHDDTLRQISMVEISPVKTRPRAFSTANIIRIALFPHQSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLSK 344          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Planmine SMEST
Match: SMESG000065955.1 (SMESG000065955.1)

HSP 1 Score: 52.7582 bits (125), Expect = 6.957e-8
Identity = 20/63 (31.75%), Postives = 38/63 (60.32%), Query Frame = 3
Query:  120 LFDYESTEIQDLHFKTNDIIEFLSKSSPDWYQGRNIMSGDSGLFPTNFVEIIIIPQDINEESI 308
            +++Y +  + +L F  N I+  + K+ P+W+ GRN++S   GLFP N+V  +      +EE++
Sbjct:   47 MYNYSAQNVDELSFDKNAILVLIDKNEPEWWMGRNLLSSQEGLFPVNYVRRLQAGNASDEEAM 109          
BLAST of Rho guanine nucleotide exchange factor 38 vs. Planmine SMEST
Match: SMESG000017234.1 (SMESG000017234.1)

HSP 1 Score: 53.9138 bits (128), Expect = 9.484e-7
Identity = 48/167 (28.74%), Postives = 81/167 (48.50%), Query Frame = 3
Query: 1587 DQDFHLLFGDLKSVIAVAEEFLSKLS-ANMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINK-KSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENT-LPDHPDIN----DLIAASSEFDVLAQKINEKK--RFEELRQI 2060
            D++  L+F + +++      FL KL   N  +      +   FL+ +  FE +Y EYC NY + +  +++ ++ AS+    +     +L         L   L+KP+QR LKY L LK +I+   L  H   N     L+ A      +A +INEK+  R E+LR++
Sbjct:  161 DKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLG----HQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMEREEQLRRL 323          
The following BLAST results are available for this feature:
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNMBP1.626e-3726.94dynamin binding protein [Source:HGNC Symbol;Acc:HG... [more]
DNMBP3.721e-3726.51dynamin binding protein [Source:HGNC Symbol;Acc:HG... [more]
DNMBP9.891e-3726.51dynamin binding protein [Source:HGNC Symbol;Acc:HG... [more]
ARHGEF383.831e-3225.23Rho guanine nucleotide exchange factor 38 [Source:... [more]
ARHGEF372.635e-2525.09Rho guanine nucleotide exchange factor 37 [Source:... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y37A1B.171.634e-1025.46pep chromosome:WBcel235:IV:13964367:13979847:-1 ge... [more]
Y37A1B.171.683e-1025.46pep chromosome:WBcel235:IV:13964359:13979696:-1 ge... [more]
Y37A1B.171.683e-1025.46pep chromosome:WBcel235:IV:13964367:13978981:-1 ge... [more]
uig-15.452e-928.13UNC-112-Interacting Guanine nucleotide exchange fa... [more]
uig-15.615e-928.13UNC-112-Interacting Guanine nucleotide exchange fa... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sif1.222e-925.67gene:FBgn0085447 transcript:FBtr0330126[more]
sif1.227e-925.67gene:FBgn0085447 transcript:FBtr0330123[more]
sif1.401e-925.67gene:FBgn0085447 transcript:FBtr0112709[more]
sif1.411e-925.67gene:FBgn0085447 transcript:FBtr0112712[more]
sif1.414e-925.67gene:FBgn0085447 transcript:FBtr0112710[more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnmbp2.293e-3625.35dynamin binding protein [Source:NCBI gene;Acc:1000... [more]
dnmbp3.072e-3625.22dynamin binding protein [Source:NCBI gene;Acc:1000... [more]
dnmbp4.206e-3625.53dynamin binding protein [Source:NCBI gene;Acc:1000... [more]
arhgef386.842e-3224.66Rho guanine nucleotide exchange factor (GEF) 38 [S... [more]
arhgef371.906e-1925.51Rho guanine nucleotide exchange factor (GEF) 37 [S... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tlx35.234e-4024.26T cell leukemia homeobox 3 [Source:Xenbase;Acc:XB-... [more]
tlx35.902e-3825.45T cell leukemia homeobox 3 [Source:Xenbase;Acc:XB-... [more]
tlx33.141e-3725.19T cell leukemia homeobox 3 [Source:Xenbase;Acc:XB-... [more]
tlx33.572e-3725.33T cell leukemia homeobox 3 [Source:Xenbase;Acc:XB-... [more]
tlx35.103e-3324.12T cell leukemia homeobox 3 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnmbp9.124e-3926.29dynamin binding protein [Source:MGI Symbol;Acc:MGI... [more]
Dnmbp1.822e-3826.45dynamin binding protein [Source:MGI Symbol;Acc:MGI... [more]
Dnmbp1.822e-3826.45dynamin binding protein [Source:MGI Symbol;Acc:MGI... [more]
Dnmbp9.501e-3826.29dynamin binding protein [Source:MGI Symbol;Acc:MGI... [more]
Dnmbp1.435e-3726.99dynamin binding protein [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|M0R4F8|DNMBP_RAT6.768e-3927.41Dynamin-binding protein OS=Rattus norvegicus OX=10... [more]
sp|E2RP94|DNMBP_CANLF3.346e-3827.15Dynamin-binding protein OS=Canis lupus familiaris ... [more]
sp|Q6TXD4|DNMBP_MOUSE1.296e-3726.45Dynamin-binding protein OS=Mus musculus OX=10090 G... [more]
sp|Q6XZF7|DNMBP_HUMAN1.787e-3626.51Dynamin-binding protein OS=Homo sapiens OX=9606 GN... [more]
sp|E7F1U2|DNMBP_DANRE3.175e-3525.53Dynamin-binding protein OS=Danio rerio OX=7955 GN=... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HMN34.321e-5026.60dynamin-binding protein OS=Lingula unguis OX=7574 ... [more]
K7JLL03.660e-4426.99Uncharacterized protein OS=Nasonia vitripennis OX=... [more]
A0A232EUH75.888e-4427.13Uncharacterized protein OS=Trichomalopsis sarcopha... [more]
A0A4W6C5531.642e-4127.13Dynamin binding protein OS=Lates calcarifer OX=818... [more]
A0A195DVB31.647e-3825.04Dynamin-binding protein OS=Trachymyrmex cornetzi O... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnmbp1.426e-3326.58dynamin binding protein [Source:NCBI gene;Acc:1000... [more]
arhgef384.138e-3324.90Rho guanine nucleotide exchange factor (GEF) 38 [S... [more]
arhgef371.146e-1925.80Rho guanine nucleotide exchange factor 37 [Source:... [more]
arhgef31.642e-1029.67Rho guanine nucleotide exchange factor 3 [Source:N... [more]
arhgef32.253e-1029.67Rho guanine nucleotide exchange factor 3 [Source:N... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnmbp1.682e-3625.22dynamin binding protein [Source:NCBI gene;Acc:1000... [more]
ENSPMAT00000008024.18.172e-1231.52pep scaffold:Pmarinus_7.0:GL476484:132482:154761:-... [more]
ENSPMAT00000008020.19.366e-1231.52pep scaffold:Pmarinus_7.0:GL476484:132482:154779:-... [more]
ENSPMAT00000009021.11.841e-925.51pep scaffold:Pmarinus_7.0:GL482604:596:7954:-1 gen... [more]
ARHGEF372.643e-925.99Rho guanine nucleotide exchange factor 37 [Source:... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LSB12.454e-742.59Negative regulator of actin nucleation-promoting f... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO449801.815e-2425.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274643.761e-1029.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452011.215e-929.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380762.821e-737.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298644.689e-742.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnmbp2.311e-3927.64dynamin binding protein [Source:NCBI gene;Acc:1011... [more]
dnmbp2.789e-3827.41dynamin binding protein [Source:NCBI gene;Acc:1011... [more]
arhgef382.808e-1926.79Rho guanine nucleotide exchange factor 38 [Source:... [more]
arhgef372.277e-1228.78Rho guanine nucleotide exchange factor 37 [Source:... [more]
arhgef372.277e-1228.78Rho guanine nucleotide exchange factor 37 [Source:... [more]
back to top
BLAST of Rho guanine nucleotide exchange factor 38 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056121.10.000e+099.34SMESG000056121.1[more]
SMESG000056121.10.000e+099.34SMESG000056121.1[more]
SMESG000056110.10.000e+099.42SMESG000056110.1[more]
SMESG000065955.16.957e-831.75SMESG000065955.1[more]
SMESG000017234.19.484e-728.74SMESG000017234.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012806 ID=SMED30012806|Name=Rho guanine nucleotide exchange factor 38|organism=Schmidtea mediterranea sexual|type=transcript|length=3653bp
TATATTTAAAATTTTAATTCAACTTTAATTAGTTTATATGAAATTTTTAT
TTAATTTTGTGACTAAATAAAACATTTTTAAAGCAATTTTTTAATTTAAA
AATGATATTTTACAAAGCTTTGTTTGATTATGAATCTACTGAAATTCAAG
ATCTACATTTTAAAACTAATGATATAATCGAATTTTTATCTAAATCTTCA
CCCGATTGGTATCAAGGAAGAAATATTATGAGTGGAGATAGTGGATTGTT
TCCAACTAATTTTGTGGAAATTATAATTATTCCTCAAGATATTAATGAAG
AAAGTATTTACATTATAAAAGAAAATAATGACACTTTTGAAAAAGGTACT
TTTTTAGTTGAAAATCATGTCAGCGATAACTTTCTTTCATGCTATTTAAT
GACTGATGAAAATAAAAGTCTATTAAATGTTCCATTATCAACTTTAATTA
AGCTCAAAATTTCATCGGAATTTCAAGGTTATACAAAATGTATTGCTACT
TGTGATCATAACGAACCGGCTGATAATGAAATAGCGTTTCTTACTGGCGA
TACAATTTGGATGGAGCGAAAAATCAATAAAGATTTTGGTGAAGGAATAT
TGCACGGAATGAAAGGCGTATTTTCACTCAAAAATGTTTACAGTGAAAAA
ATCAGTTCAGAAAATATCGATCGGAAAAATATTTGGATAACTCTCTTCGA
TTATTCGGGAACTCATGTTAATGATTTGTCGATTAGAAAAGGAGATAAAT
TGAAATTTCTCGATCGAATCGACAACAATTGGAATTTAATGCAAAATGAA
AATGGAAAAGTTGGCATGACACCGGTGACATATGTTAAAAATATCTCGAT
AAACTCACCAATGCGTCTGTCGATTTCCGACACTGAAACCAATGACAATT
CCGACACTAATGAAACGCCGGAAGCCGATAATCAATCGGATTTTAAAATT
ATTCCCAATACAGTGCTGCAGGAGCTGAGGAATCGCATTGTCAATTCTAA
TGAGAATGAATACGAAAATCTTTCTTATTGCAATTCACATAATAAATATT
CAACATTAATTAGCAATTTGGAGGCTTTACCCACAGGGACTCTCGTGCCA
TCTGAGAATTGCTATGAAACTAACTCAACGTTAAGGCCGACCGATATCAG
CGATATTCCAGATGAAAACGAAATTCCAGAAATAGTTCTTGAGCAGTTTA
ATAAAAGAGAAAAGCGTATTGGAAATGATATTGAGGTTATAAATGATAAT
ATCAAAAGCATTGAAAATAAATTAACTCATGAAAACAGCCAGGATGACAT
TCAGACTATGACATGTAATTTAGCATTTCTTAAAGAAGAACGCAAAACGA
AATTAAAGGAATTAGAAGCCATTAAAGATCAAAGAAAAAATTTCTTGTCT
GGAAATACACAAGATGTTGATGAGAATGATTACGAATCAATAAAATTAGG
CAGCATATTGGAAAAGAAAATGCAAAAACGTTCTAAAATAATTGAAGAAA
TATTAGAGACGGAAAAAAAATTTATTCAAGACTTAAAAATCACATTAGAG
GCTTTTGACAAAAATTTAATTCCAACTAAAATACCAGATCAAGATTTTCA
TTTGCTTTTTGGTGACCTTAAATCTGTGATAGCAGTGGCCGAGGAATTCC
TATCGAAACTTTCTGCAAACATGGAAGATGGTCTAGACAAAATAGCAGTG
GGTTCAGTGTTTCTTCAATCTGTCAGTTCTTTCGAAGAAGTATATAAAGA
ATATTGCGTTAATTATGATAGAAAATTGGATTTGATCAATAAAAAAAGCA
AAGCTTCCAATGTTACCGATTTTGTCAGTGACGGTTTAAATAGGTTGAAT
GATCTGGGGGTGTTTGCTAGTACTTTGGATATGATGCTTGTTAAACCGTT
ACAAAGATTTCTAAAATATCCATTGTTTTTAAAGACAATAATCGAGAATA
CACTACCCGACCACCCCGATATAAATGATCTGATAGCAGCGTCATCAGAA
TTTGATGTATTGGCTCAAAAGATAAACGAGAAAAAAAGATTCGAAGAATT
AAGACAGATAACATTTGACAGAACGGAAAAATGGCACATGAGAACTATTC
ATGCAATTCAGAAGAAACCAAAGCGAGTTATTGTTTCCATATCCGGTGCA
GTTCAAAATGAAGACACCGAATATCAAGAGATAGTTATTAAGTTTAAAGA
ACTAAAAAAATGTATTTCTTTTTTCATTGAGACAGTATTTATCCTTCGAG
ACAATTTAAAAGAGATCCTTAATCTGTATTCGGCTATAACCGACGACTTC
ACATCTATTATCAAATCCAATTTCGGGTCTCAGTTGCATTTCTATCTGGT
GGCTTGTAAACGGGGCGAAACTGATTATTTTAAAAAATATTATACAGTTG
CAAATAAAACATGCATTTTAGATAGTCTAGTAGTAAATCCACTAAATAAA
TTATTGGAACTTTTTTCGGGTCCAGCATTATTAATCAAAAAACGTCAATC
AAAGTATATTGATTATCTGGCCATGAAACAGCGGTGCGATGATAAAGAAA
CTTCAAGAGTTCAGATCGATAAGCTGGATCAATTGAGAAATCAATATCTG
GCGATCAACAATACACTTAAGCACGAATTACCTATTTTAATATCAAAATC
ATCTGTAATTTTTAATGAATGCATTGGCAATTATTTACAATTATCCACAT
CGACTTTACAAAGCAACATCCTAAGTTTGAAAAACTTAATTGAGGGTGAC
CAACTTTCGACAGAAGAAGAGCAAAGAAACTGTAGAAACCATCAAAATGA
AATTCTCGCATTTTTACAAAGAGATCTTCTCAGTTTTAACCCTCAGTATC
GAAATAGCATTAATAAAGGAGATTTTTCTTCTTGCTTCCTGAATTGTAAC
AATTCGAATGCAAATTTGCGAAATTGTGTTTATAATCAGACAGAAACAGA
CGTTATTAAGTTAAGGGAAAAGTTTGAGCCTGAAAATTTAGCCCGTGTGA
AAAAGGATTTTGTACCAACTAAACCACACCAAATACATATTTGCGCTGGA
ACGCTTGTTGGTATTCTTAAAAGGTGTAACCCGCAAGGGCATAGTACGAG
TTGGCTAGTTGAGGTTTGTCCAAAACGTACTGGGTTTGTTCCTCGTTCTT
ATTTGACATTATCTCCATTTGCTGCAAATAAAGTTGACCTTATTGGTTCG
AAAGTAATAAGTGGAAATGCTACATATTTGAATAATCGTCATTCCATAAC
AGCTGATTCATCATTTGACTTGATGCAATTTTCGCCAAATAACCATGACG
ATACTTTAAGACAAATATCAATGGTTGAGATTTCTCCAGTGAAAACTAGG
CCACGTGCATTTTCTACGGCGAATATAATCCGTATAGCATTATTTCCTCA
TCAGTCTCGCGGAGAATCTGAAATCTCAATGCAAAAAAATGATCAATTGG
AGATTTTAGAAAGTCCCGATAAAAGCAACAGTCGAAATTGGAGTTTAGCG
AAAAACCTTCGAACAGGTGCCCAAGGCTATGTTCCTACTAATTATTTGTC
AAAATGAGATCCATATTCAGCTATTTTATCCGAAATTTTATAATCGATTA
ATTGGTGAAATGTATATTTAATTTTTTAACGAGATAATATTTTTTACAAG
CTG
back to top

protein sequence of SMED30012806-orf-1

>SMED30012806-orf-1 ID=SMED30012806-orf-1|Name=SMED30012806-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1152bp
MIFYKALFDYESTEIQDLHFKTNDIIEFLSKSSPDWYQGRNIMSGDSGLF
PTNFVEIIIIPQDINEESIYIIKENNDTFEKGTFLVENHVSDNFLSCYLM
TDENKSLLNVPLSTLIKLKISSEFQGYTKCIATCDHNEPADNEIAFLTGD
TIWMERKINKDFGEGILHGMKGVFSLKNVYSEKISSENIDRKNIWITLFD
YSGTHVNDLSIRKGDKLKFLDRIDNNWNLMQNENGKVGMTPVTYVKNISI
NSPMRLSISDTETNDNSDTNETPEADNQSDFKIIPNTVLQELRNRIVNSN
ENEYENLSYCNSHNKYSTLISNLEALPTGTLVPSENCYETNSTLRPTDIS
DIPDENEIPEIVLEQFNKREKRIGNDIEVINDNIKSIENKLTHENSQDDI
QTMTCNLAFLKEERKTKLKELEAIKDQRKNFLSGNTQDVDENDYESIKLG
SILEKKMQKRSKIIEEILETEKKFIQDLKITLEAFDKNLIPTKIPDQDFH
LLFGDLKSVIAVAEEFLSKLSANMEDGLDKIAVGSVFLQSVSSFEEVYKE
YCVNYDRKLDLINKKSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPL
QRFLKYPLFLKTIIENTLPDHPDINDLIAASSEFDVLAQKINEKKRFEEL
RQITFDRTEKWHMRTIHAIQKKPKRVIVSISGAVQNEDTEYQEIVIKFKE
LKKCISFFIETVFILRDNLKEILNLYSAITDDFTSIIKSNFGSQLHFYLV
ACKRGETDYFKKYYTVANKTCILDSLVVNPLNKLLELFSGPALLIKKRQS
KYIDYLAMKQRCDDKETSRVQIDKLDQLRNQYLAINNTLKHELPILISKS
SVIFNECIGNYLQLSTSTLQSNILSLKNLIEGDQLSTEEEQRNCRNHQNE
ILAFLQRDLLSFNPQYRNSINKGDFSSCFLNCNNSNANLRNCVYNQTETD
VIKLREKFEPENLARVKKDFVPTKPHQIHICAGTLVGILKRCNPQGHSTS
WLVEVCPKRTGFVPRSYLTLSPFAANKVDLIGSKVISGNATYLNNRHSIT
ADSSFDLMQFSPNNHDDTLRQISMVEISPVKTRPRAFSTANIIRIALFPH
QSRGESEISMQKNDQLEILESPDKSNSRNWSLAKNLRTGAQGYVPTNYLS
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001452SH3_domain
IPR000219DH-domain
IPR011511SH3_2
IPR027267AH/BAR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0005085guanyl-nucleotide exchange factor activity
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0007264small GTPase mediated signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm