slc39a-3

Overview
Nameslc39a-3 (AKN21668.1)
Smed IDSMED30012799
Length (bp)1157
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc39a-3 (SMED30012799) t-SNE clustered cells

Violin plots show distribution of expression levels for slc39a-3 (SMED30012799) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc39a-3 (SMED30012799) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc39a-3 (SMED30012799) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of slc39a-3 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 135.961 bits (341), Expect = 3.091e-36
Identity = 89/274 (32.48%), Postives = 147/274 (53.65%), Query Frame = 2
Query:  242 SIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            S QK LS+ +CFA GVFL T +LD+L D L  ++EA+    +   FPL  F++  G FL+L +E+ I L            E+R    ++    Q      G    + +     +L              +L+ ++A+HS+FEGLA+GLQ +    + L +A+ +HK +LA+++ L L Q+ +  ++      +FS  +P+GI +G  L     P      +  ++L+G+A GTF YI F EILPQE+++   +I+KV+ L  GF L++ L+F+
Sbjct:   64 SRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQ-ITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRA-----------CVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLH---QLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFI 322          
BLAST of slc39a-3 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 135.961 bits (341), Expect = 3.091e-36
Identity = 89/274 (32.48%), Postives = 147/274 (53.65%), Query Frame = 2
Query:  242 SIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            S QK LS+ +CFA GVFL T +LD+L D L  ++EA+    +   FPL  F++  G FL+L +E+ I L            E+R    ++    Q      G    + +     +L              +L+ ++A+HS+FEGLA+GLQ +    + L +A+ +HK +LA+++ L L Q+ +  ++      +FS  +P+GI +G  L     P      +  ++L+G+A GTF YI F EILPQE+++   +I+KV+ L  GF L++ L+F+
Sbjct:   64 SRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQ-ITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRA-----------CVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLH---QLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFI 322          
BLAST of slc39a-3 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 135.961 bits (341), Expect = 3.091e-36
Identity = 89/274 (32.48%), Postives = 147/274 (53.65%), Query Frame = 2
Query:  242 SIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            S QK LS+ +CFA GVFL T +LD+L D L  ++EA+    +   FPL  F++  G FL+L +E+ I L            E+R    ++    Q      G    + +     +L              +L+ ++A+HS+FEGLA+GLQ +    + L +A+ +HK +LA+++ L L Q+ +  ++      +FS  +P+GI +G  L     P      +  ++L+G+A GTF YI F EILPQE+++   +I+KV+ L  GF L++ L+F+
Sbjct:   64 SRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQ-ITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRA-----------CVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLH---QLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFI 322          
BLAST of slc39a-3 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 135.961 bits (341), Expect = 3.091e-36
Identity = 89/274 (32.48%), Postives = 147/274 (53.65%), Query Frame = 2
Query:  242 SIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            S QK LS+ +CFA GVFL T +LD+L D L  ++EA+    +   FPL  F++  G FL+L +E+ I L            E+R    ++    Q      G    + +     +L              +L+ ++A+HS+FEGLA+GLQ +    + L +A+ +HK +LA+++ L L Q+ +  ++      +FS  +P+GI +G  L     P      +  ++L+G+A GTF YI F EILPQE+++   +I+KV+ L  GF L++ L+F+
Sbjct:   64 SRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQ-ITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRA-----------CVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLH---QLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFI 322          
BLAST of slc39a-3 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 135.961 bits (341), Expect = 3.091e-36
Identity = 89/274 (32.48%), Postives = 147/274 (53.65%), Query Frame = 2
Query:  242 SIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            S QK LS+ +CFA GVFL T +LD+L D L  ++EA+    +   FPL  F++  G FL+L +E+ I L            E+R    ++    Q      G    + +     +L              +L+ ++A+HS+FEGLA+GLQ +    + L +A+ +HK +LA+++ L L Q+ +  ++      +FS  +P+GI +G  L     P      +  ++L+G+A GTF YI F EILPQE+++   +I+KV+ L  GF L++ L+F+
Sbjct:   64 SRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQ-ITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRA-----------CVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLH---QLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFI 322          
BLAST of slc39a-3 vs. Ensembl Celegans
Match: zipt-1 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:O62192])

HSP 1 Score: 100.523 bits (249), Expect = 1.151e-23
Identity = 79/288 (27.43%), Postives = 138/288 (47.92%), Query Frame = 2
Query:  203 MRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGF-ILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            M   F K E     I   LS  +C   GVFL   +LD+L D +    E+ +  +I + FP+    V  G  L+L I++ ++       + R  F    +H   +   + +R+ DG       E++E+  E   +S I    L + +   A+   FEGL+L +  +    L +F A+ +HK ++   +G+ L Q +++     +   +FS+   IG   G  I+ +          + S+ILQ +ACGTF YI  FE++P E+ N  ++I+K+  + +GF +V   I +
Sbjct:   49 MIATFLKGEWARSHI---LSFISCIGGGVFLGACLLDLLPDSI----ESFEKTKIATEFPVPLAFVAVGFLLVLTIDQVVK-----AAKDRNVFGHVGYHIH-SHNHEHQRSEDG-------ESQEEGDEAAAQSSIGVAMLVLALSVHAL---FEGLSLAVTSDASQLLQIFGALILHKCIMGFCLGVRLVQANLTTPWIALAQFLFSVQVLIGGLAGIGIMKFISGGEQSFAAIVSSILQAIACGTFLYITTFEVIPHELHNGKYRILKMFFIYMGFAIVVAFILI 313          
BLAST of slc39a-3 vs. Ensembl Celegans
Match: zipt-2.2 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q19913])

HSP 1 Score: 94.7449 bits (234), Expect = 1.454e-21
Identity = 92/309 (29.77%), Postives = 151/309 (48.87%), Query Frame = 2
Query:  176 IPYFIIRYYMRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLE----KFPESXXXXXXXXXX--------XXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATI--FSISSPIGICIGFILNYFENP--NSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVL 1054
            +P FI+R   R +        +S Q  LS   CFA GVFL T  LDI+  + +   E M+TY +   F    FV  CG F I +IEE    +    +Q            S+ +  +   TSDG+      + ++ S+     +  E+    +S +           +A++ HS+ EG ALG+Q +      LF ++ +HK V A ++GL+++  + S K+  + ATI  +S+ +P+G  +G IL   E       ++L+    L+ LA GTF Y+ F EI+  E SN  + + ++L + IGF LV+ +
Sbjct:   25 VPLFIVRVMKRSQN-------ESEQGYLSYLTCFAGGVFLATCFLDIIPHINEGYEELMETYDLNWHFAYPQFVTCCGFFFIYFIEEFTTFVFGNGQQP-----GHGHSHSLNKGNKITTTSDGRLSPGMPKERKGSVNITNLRMEEASTWVVSDEKSNILKSLTFAVAMSFHSLLEGFALGVQDSKGRIYALFFSLLLHKGVEAFSVGLQISMAN-SNKVKTVLATILIYSLMAPLGSIMGSILQNSETNIYKDCAILL----LESLAAGTFIYVTFIEIMASEKSNDFNHLKQLLWIIIGFALVTTM 316          
BLAST of slc39a-3 vs. Ensembl Celegans
Match: zipt-2.1 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q6BEU0])

HSP 1 Score: 94.3597 bits (233), Expect = 2.773e-21
Identity = 84/307 (27.36%), Postives = 143/307 (46.58%), Query Frame = 2
Query:  257 LSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEE-----------------GIRLIPNLCKQKRVR------------------FESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATI--FSISSPIGICIGFILNYFENPNSPSLLMGSTI--LQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIF 1060
            LS  +CF+ GVF+ T  LD++  V +   E ++TY ++   P+    +  G F +  IEE                  I L  ++ K+K  R                   +SR  HS + EE      SD K       N  KSL                 IA++ HS+ EG ALG+Q +      LF+++ +HKS+ A ++GL++++ + + K  ++  TI  +++ +P+G  +G +L   +N    S     TI  L+ +A GTF Y+ F EIL  E  N+ + + ++L + +GF+++  L F
Sbjct:   48 LSYLSCFSGGVFMATCFLDVMPHVQQTYGEILETYNVEFRLPMNQLFICVGFFFVYLIEEITAKVFGSGGHGHSHGPPIPLTVDIKKEKVTRVQLIENGSSSSPETLMIPIDSRTRHSLVVEETAPWVVSDEK------RNLLKSL--------------TFAIAMSFHSLLEGFALGVQDSDAAIWTLFLSLLLHKSIEAFSVGLQISRAN-TEKKGIVMCTILVYALMTPLGSVLGTLL---QNTGDKSFGKDCTIVFLEAMAAGTFIYVTFLEILAAEKENRFNSLKQLLCIGLGFMVILALQF 330          
BLAST of slc39a-3 vs. Ensembl Celegans
Match: zipt-2.1 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q6BEU0])

HSP 1 Score: 94.3597 bits (233), Expect = 2.773e-21
Identity = 84/307 (27.36%), Postives = 143/307 (46.58%), Query Frame = 2
Query:  257 LSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEE-----------------GIRLIPNLCKQKRVR------------------FESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATI--FSISSPIGICIGFILNYFENPNSPSLLMGSTI--LQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIF 1060
            LS  +CF+ GVF+ T  LD++  V +   E ++TY ++   P+    +  G F +  IEE                  I L  ++ K+K  R                   +SR  HS + EE      SD K       N  KSL                 IA++ HS+ EG ALG+Q +      LF+++ +HKS+ A ++GL++++ + + K  ++  TI  +++ +P+G  +G +L   +N    S     TI  L+ +A GTF Y+ F EIL  E  N+ + + ++L + +GF+++  L F
Sbjct:   48 LSYLSCFSGGVFMATCFLDVMPHVQQTYGEILETYNVEFRLPMNQLFICVGFFFVYLIEEITAKVFGSGGHGHSHGPPIPLTVDIKKEKVTRVQLIENGSSSSPETLMIPIDSRTRHSLVVEETAPWVVSDEK------RNLLKSL--------------TFAIAMSFHSLLEGFALGVQDSDAAIWTLFLSLLLHKSIEAFSVGLQISRAN-TEKKGIVMCTILVYALMTPLGSVLGTLL---QNTGDKSFGKDCTIVFLEAMAAGTFIYVTFLEILAAEKENRFNSLKQLLCIGLGFMVILALQF 330          
BLAST of slc39a-3 vs. Ensembl Celegans
Match: zipt-2.1 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q6BEU0])

HSP 1 Score: 88.1965 bits (217), Expect = 2.477e-19
Identity = 80/289 (27.68%), Postives = 138/289 (47.75%), Query Frame = 2
Query:  257 LSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEE-----------------GIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATI--FSISSPIGICIGFILNYFENPNSPSLLMGSTI--LQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIF 1060
            LS  +CF+ GVF+ T  LD++  V +   E ++TY ++   P+    +  G F +  IEE                  I L  ++ K+K          S + EE      SD K       N  KSL                 IA++ HS+ EG ALG+Q +      LF+++ +HKS+ A ++GL++++ + + K  ++  TI  +++ +P+G  +G +L   +N    S     TI  L+ +A GTF Y+ F EIL  E  N+ + + ++L + +GF+++  L F
Sbjct:   48 LSYLSCFSGGVFMATCFLDVMPHVQQTYGEILETYNVEFRLPMNQLFICVGFFFVYLIEEITAKVFGSGGHGHSHGPPIPLTVDIKKEKVT--------SLVVEETAPWVVSDEK------RNLLKSL--------------TFAIAMSFHSLLEGFALGVQDSDAAIWTLFLSLLLHKSIEAFSVGLQISRAN-TEKKGIVMCTILVYALMTPLGSVLGTLL---QNTGDKSFGKDCTIVFLEAMAAGTFIYVTFLEILAAEKENRFNSLKQLLCIGLGFMVILALQF 304          
BLAST of slc39a-3 vs. Ensembl Fly
Match: Zip42C.2 (gene:FBgn0033097 transcript:FBtr0306802)

HSP 1 Score: 110.538 bits (275), Expect = 2.831e-27
Identity = 91/294 (30.95%), Postives = 158/294 (53.74%), Query Frame = 2
Query:  176 IPYFIIRYYMRVKFYKR-EMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLG-TFVVIC-GIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKV-LSLSIGFILV 1045
            IPY + R+Y   K+ +R E      + VL + N F  GV + T  + +L +V++ +N A++  ++ +  P G   V++C G +L+  IEE +  +    +Q+++R           E V  +   +        + +E   E       + +    +I+A+++H +F G+A+GL+++V     +  AIS+HK VLA  IG+E+      + ++V++  +FSI +PIG+ IG  ++     N PS + G  ILQGLACGT  Y+VFFEI+      KNH  I++ LS  +GF+L+
Sbjct:   27 IPYLLDRFY---KWTQRPENNAREFKVVLCLLN-FGGGVLIATTFIHMLPEVVEVVN-ALQDCRMLAPTPFGLPEVLLCTGFYLMYCIEETMHFVVRRRQQRKLR-----------EVVTIKDAGEELRTEIVVQPEESPKEP------NWLRGLGIIVALSLHELFGGMAIGLEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIAVSESAAANQPSTVSG--ILQGLACGTLIYVVFFEIV-----AKNHAGIRILLSSMVGFVLM 291          
BLAST of slc39a-3 vs. Ensembl Fly
Match: Zip42C.1 (gene:FBgn0033096 transcript:FBtr0086139)

HSP 1 Score: 95.9005 bits (237), Expect = 8.719e-22
Identity = 84/306 (27.45%), Postives = 144/306 (47.06%), Query Frame = 2
Query:  176 IPYFIIRYYMRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQ--IKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFES----------RVFHSSI-----TEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFIL 1042
            +PY + R +   K    E +   + + L     F  GV + T  L +L +V+ ++ EA++     +K+ F L   ++  G FL+  ++E +  +    + K  R ES           + HS +      EEV+ + T          ++   S    P           +I+A+++H +FEG+A+GL+  V     +F A+S HK VLA  +G+EL        +++++   FSI +PIGI +G  ++       PSL  G  +LQG+ACGT  Y+VFFEIL +  +     +  V   ++ F L
Sbjct:   41 LPYVLNRCFHWTKASPEETRSSLVVRCLLF---FGGGVLICTTFLHMLPEVI-EVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLVRHHQGKLSRKESVASLAFERGRSIRHSVLLNPQAKEEVEVKDTEP----QPHKDHHGHSHMPVPADDGSSARGLGIILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRSSLAILYLVTFSIVTPIGIGVGLGISQQVAAGQPSLPSG--VLQGIACGTLLYVVFFEILIESHAGWRALVAAVAGFALMFGL 336          
BLAST of slc39a-3 vs. Ensembl Fly
Match: Zip89B (gene:FBgn0038412 transcript:FBtr0083266)

HSP 1 Score: 96.2857 bits (238), Expect = 1.812e-21
Identity = 52/128 (40.62%), Postives = 81/128 (63.28%), Query Frame = 2
Query:  665 FEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKV-LSLSIGFILV 1045
            FEG+A+GL+ +      +F A+S HK VLA  +G+EL        ++V++   F++ SP+GI IG ++N+ E  + PSL+  S ILQG ACGT  Y+VFFEIL     +KN   ++  L+L +GF+++
Sbjct:  283 FEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGILINHGEETSGPSLV--SAILQGFACGTLIYVVFFEIL-----SKNRSGLRAYLALFVGFLVM 403          
BLAST of slc39a-3 vs. Ensembl Fly
Match: Zip88E (gene:FBgn0038312 transcript:FBtr0290018)

HSP 1 Score: 58.151 bits (139), Expect = 5.078e-9
Identity = 34/106 (32.08%), Postives = 58/106 (54.72%), Query Frame = 2
Query:  668 EGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLEL-AQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQE 982
            EGLA+G+Q +    L L  A++ HK V+   +GLE  +    S++   +  ++F++ + IGI +G ++       S   L    I+Q LA GT FY+   E++P+E
Sbjct:  225 EGLAIGVQNSSTKVLFLLGAVACHKFVMGFCLGLEFRSNPQTSFRAQFVGISVFALGAVIGIGLGMLIVDVPAAWSSKTL---PIVQALAGGTLFYVTVCEVIPRE 327          
BLAST of slc39a-3 vs. Ensembl Zebrafish
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:321324])

HSP 1 Score: 125.946 bits (315), Expect = 5.987e-33
Identity = 86/291 (29.55%), Postives = 155/291 (53.26%), Query Frame = 2
Query:  206 RVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTS----DGKTYNTFSE-NKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            R+K++      +  + VLS  +CFA GVFL+  +LDI+ D L D++  ++   +   FPL  F++ CG F +L +E   +++ +  +  R    + +   +          S    +G  ++   + +   S   F           +L +++++HS+FEGLA+GLQ      L + +AI +HKS++  ++ ++L Q+ +     V++ T+F+I SP+GI IG ++   E       L+   +L+GLA GTF YI F EILP E+++    ++KVL L  GF +++ L F+
Sbjct:   28 RMKWFHVTGGTELHKAVLSFVSCFAGGVFLSACLLDIIPDYLSDIHGELQKRDLDDGFPLPEFIMACGFFTVLILE---KMVLSCTEGHRNEETAPLLAPAAPNGHAHGHPSVNDLEGSGHHVHVDFHAHSSFRSF-----------MLFLSLSLHSVFEGLAIGLQTTNAKVLEICIAILVHKSIIVFSLSVKLVQSAVKPLWVVLYVTVFAIMSPLGIGIGIVV--IETERQAGGLI-QAVLEGLAAGTFIYITFLEILPHELNSSERPLLKVLFLLCGFSIMAALCFL 301          
BLAST of slc39a-3 vs. Ensembl Zebrafish
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:321324])

HSP 1 Score: 125.946 bits (315), Expect = 5.987e-33
Identity = 86/291 (29.55%), Postives = 155/291 (53.26%), Query Frame = 2
Query:  206 RVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTS----DGKTYNTFSE-NKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            R+K++      +  + VLS  +CFA GVFL+  +LDI+ D L D++  ++   +   FPL  F++ CG F +L +E   +++ +  +  R    + +   +          S    +G  ++   + +   S   F           +L +++++HS+FEGLA+GLQ      L + +AI +HKS++  ++ ++L Q+ +     V++ T+F+I SP+GI IG ++   E       L+   +L+GLA GTF YI F EILP E+++    ++KVL L  GF +++ L F+
Sbjct:   28 RMKWFHVTGGTELHKAVLSFVSCFAGGVFLSACLLDIIPDYLSDIHGELQKRDLDDGFPLPEFIMACGFFTVLILE---KMVLSCTEGHRNEETAPLLAPAAPNGHAHGHPSVNDLEGSGHHVHVDFHAHSSFRSF-----------MLFLSLSLHSVFEGLAIGLQTTNAKVLEICIAILVHKSIIVFSLSVKLVQSAVKPLWVVLYVTVFAIMSPLGIGIGIVV--IETERQAGGLI-QAVLEGLAAGTFIYITFLEILPHELNSSERPLLKVLFLLCGFSIMAALCFL 301          
BLAST of slc39a-3 vs. Ensembl Zebrafish
Match: slc39a3 (solute carrier family 39 member 3 [Source:NCBI gene;Acc:792986])

HSP 1 Score: 59.6918 bits (143), Expect = 1.284e-9
Identity = 63/269 (23.42%), Postives = 115/269 (42.75%), Query Frame = 2
Query:  251 KVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLI 1057
            + LS+ +C ++GVFL   +LD+L   L DM +      I   FPL  F++  G+ L+L +E           Q  + F  +V  SS+ ++   ERT   + Y   S   E                 +L++ + + S+ EG+       V   L    A  + + +LA  + L+LA   +   ++     +F  + P+ +    +     +    + ++   + +GL CG F  I    +L  E S+   ++ KV  L  GF LV+ ++
Sbjct:   50 RALSLASCLSSGVFLGFSLLDLLPKYLTDMRDTFSRLDITLRFPLSEFLLAMGVLLVLLVE-----------QMLLAFREQVCVSSVEKQTLIERT---RLYVEDSRTHEALRVC------------LLLLCVCVRSLLEGVC-----AVPPPLWSCGAALLREGLLAFGLALQLAPAGLRRAVATGGLVLFCSARPVAMGTAMLRGTPGDQAYTADVVRCAV-EGLTCGIFICISISGLLFPESSSPKQRMHKVAFLLTGFALVTAVL 286          
BLAST of slc39a-3 vs. Ensembl Xenopus
Match: slc39a3 (solute carrier family 39 member 3 [Source:NCBI gene;Acc:100124712])

HSP 1 Score: 121.324 bits (303), Expect = 5.739e-31
Identity = 89/277 (32.13%), Postives = 153/277 (55.23%), Query Frame = 2
Query:  248 QKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFH--SSITEEVQFERT--SDGKTYNTFS---ENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLI 1057
            +K+LS+ N FA GVFL T    +L  V +   + +K   I + +PL   +++ G FL +++E+ +       K+K    +   F+  S I  + +FE    S    +N +     +   SL     S    I L  L+ A++ HS+FEGLALGLQ +    L LF+ + IH++++A+ +G+ +A+ +   K ++  A + S   PIGI +G  +   +N  S    + S +LQG+A GTF ++ FFEIL +E+  KN +++KVL L +G+ +++VL+
Sbjct:   40 RKILSLSNSFAGGVFLATCFNALLPAVREKFFDLLKIGNISTDYPLAETIMMVGFFLTVFVEQTVM---TFRKEKPSFIDMETFNAGSDIGSDSEFESPFISANHGHNLYEGGHSHHSHSLNIKELSSSSPIRLFSLVFALSAHSVFEGLALGLQEDGNKLLSLFIGVVIHETLVAVALGVSMAKVNTHLKDAIKMAVLVSTMIPIGIVVGMAIQSAQNMASS---IASALLQGIAGGTFIFVTFFEILVKELEEKNDRLLKVLFLVLGYTVLAVLV 310          
BLAST of slc39a-3 vs. Ensembl Xenopus
Match: alkbh6 (alkB homolog 6 [Source:Xenbase;Acc:XB-GENE-5891943])

HSP 1 Score: 109.383 bits (272), Expect = 1.423e-26
Identity = 90/289 (31.14%), Postives = 158/289 (54.67%), Query Frame = 2
Query:  206 RVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENK-EKSLEKFPESXXXXXX--XXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            RVK ++  ++ ++ Q+ +S  +C A GVFL   +LDI+ D L DM E M   QIK+ FPL  F++  G  ++L +E   R++ + C +      + +         + E+       ++   N  E     F        S    IL++++++HSIFEG+A+GLQ    + L + +AI IHKS++A+++ L L Q+ +  +  V+   +F++ SP+GI IG  + + +   +    M   +L+GLA GTF YI F EILP E+++   ++ KV+ + +GF  ++ L F+
Sbjct:   28 RVKCFREGLEREAHQRWISFISCLAGGVFLAACLLDIIPDFLNDMKEEMINQQIKTDFPLPEFILGTGFLIVLIVE---RIVLD-CSETMSEETTPLLSGGSNSPARQEQPHGHSHSHSGHHNDVEHRRHHFHVDFHAHSSFRSFILLLSLSLHSIFEGIAIGLQNVQSEVLQIAIAILIHKSIIAVSLSLLLLQSSVQTRWFVLSIVMFALMSPLGIGIGIGVMHNQTDGN---RMVQCVLEGLAAGTFVYITFLEILPHELNSNKWRLPKVIFILLGFSGMAALRFL 309          
BLAST of slc39a-3 vs. Ensembl Xenopus
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:734036])

HSP 1 Score: 96.2857 bits (238), Expect = 6.001e-22
Identity = 73/272 (26.84%), Postives = 133/272 (48.90%), Query Frame = 2
Query:  248 QKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            ++ LS+ +CF+ GVFL+T +LD++   L  +  A+K   I   FPL  F++  G FL+L +E+    +    K +    E      ++        +  G  +     N   ++               L++A+A+HS  EG+ALG Q      +   +A+ +HKS++A ++ L+L Q  +  +  +     +S+  P+G+ +G     +     P   +  ++L+GLA G F YI F EILP E+S    +I +V+ L  GF  ++ ++F+
Sbjct:   57 RRSLSLISCFSGGVFLSTCLLDLMPSYLSSIAGALKGLNITLQFPLQEFILAMGFFLVLVMEQ----VAMGYKDQAGGSEET---GALLGSASLLHSGVGAPHVHVDVNAHSAVRMM-----------ALVLALALHSALEGVALGYQGARGRVMKTCLALLVHKSLIAFSLTLKLGQGRLHVRAMLACLLFYSLMCPLGMGLGMA---WAGSTDPVQQLTRSVLEGLATGAFMYITFLEILPHELSAGYPQIDRVIVLLCGFSAIAAVLFI 307          
BLAST of slc39a-3 vs. Ensembl Xenopus
Match: camk2n2 (calcium/calmodulin-dependent protein kinase II inhibitor 2 [Source:Xenbase;Acc:XB-GENE-960926])

HSP 1 Score: 83.5741 bits (205), Expect = 1.966e-17
Identity = 79/297 (26.60%), Postives = 144/297 (48.48%), Query Frame = 2
Query:  215 FYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXX-----------------XXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVL 1054
            F K  +K  + Q V+ + + FAAG FL   +L ++ + L  +   +        +P+G  ++  G F +L+IE   R++   C           +HS   +  Q + +    T N+   N  +  E  PE   +   +                     +++++HS+FEGLA+GLQ N    L + +A+ IHK V+  ++ L+L Q+       +++    S+ SPIGI IG I+       +  + +   +L+G+A GTF Y+ F EILPQE++     ++K+L +++GF  ++V+
Sbjct:   32 FLKSSVK-GTYQLVICLISSFAAGTFLGACLLHVVAEALSSIATELSYI----AYPMGELILSLGFFFVLFIE---RIVLQFC-----------YHS---QPQQLDGSPVPATQNSPEANSTEKQEH-PEEINNAAEVSHNHIHVNLHSYSSFRSLILFLSLSVHSVFEGLAIGLQSNYSSALQIAIAVLIHKGVIVFSLSLKLTQSKTRPLWLLVYVITLSLMSPIGITIGIIVTL---KKTTIITLVQAVLEGIASGTFVYVTFLEILPQELNTAEKPLLKLLFIALGFTAMAVI 302          
BLAST of slc39a-3 vs. Ensembl Mouse
Match: Slc39a1 (solute carrier family 39 (zinc transporter), member 1 [Source:MGI Symbol;Acc:MGI:1353474])

HSP 1 Score: 134.806 bits (338), Expect = 5.671e-36
Identity = 90/274 (32.85%), Postives = 146/274 (53.28%), Query Frame = 2
Query:  242 SIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            S QK LS+ +CFA GVFL T +LD+L D L  ++EA++   +   FPL  F++  G FL+L +E+ I L            E+R    ++    Q      G      +     +L              +L+ ++A+HS+FEGLA+GLQ +    + L +A+ +HK +LA+++ L L Q+ +  ++      +FS  +P+GI +G  L     P      +  ++L+G+A GTF YI F EILPQE++    +I+KV+ L  GF L++ L+FV
Sbjct:   64 SGQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALEALHVTLQFPLQEFILAMGFFLVLVMEQ-ITLAYKEQTSPPHPEETRALLGTVNGGPQHWHDGPGIPQAGGTPAAPSALRA-----------CVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRVQVVAGCGILFSCMTPLGIGLGAALAESAGPLH---QLAQSVLEGMAAGTFLYITFLEILPQELATSEQRILKVILLLAGFALLTGLLFV 322          
BLAST of slc39a-3 vs. Ensembl Mouse
Match: Slc39a3 (solute carrier family 39 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:2147269])

HSP 1 Score: 112.079 bits (279), Expect = 1.388e-27
Identity = 79/310 (25.48%), Postives = 160/310 (51.61%), Query Frame = 2
Query:  182 YFIIRYYMRVKFYKREM-KLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXX---------------XXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            + ++   + VK  + ++ K    +KVLS+CN F  GVFL T    +L  V   + + +    I + +PL   +++ G FL +++E+   L+    +++    +   F++        +  SD +  + F     +S   +PE         + +                A++ HS+FEGLALGLQ   +  + LF+ ++IH++++A+ +G+ +A++ +  + +   A   S   P+GI +G  +   E+  S +  + S +LQGLA GTF ++ F EIL +E+  ++ +++KVL L +G+ +++ ++F+
Sbjct:   18 FMLLGSLLPVKVIEADLEKAHRSKKVLSLCNTFGGGVFLATCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQ---LVLTFRRERPPFIDLETFNAGS------DAGSDSEYESPFVGVGNRSHSLYPEPTAHTHGAGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAIHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLGLGI---ESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLAGMVFL 315          
BLAST of slc39a-3 vs. Ensembl Mouse
Match: Slc39a3 (solute carrier family 39 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:2147269])

HSP 1 Score: 111.694 bits (278), Expect = 2.453e-27
Identity = 79/310 (25.48%), Postives = 160/310 (51.61%), Query Frame = 2
Query:  182 YFIIRYYMRVKFYKREM-KLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXX---------------XXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            + ++   + VK  + ++ K    +KVLS+CN F  GVFL T    +L  V   + + +    I + +PL   +++ G FL +++E+   L+    +++    +   F++        +  SD +  + F     +S   +PE         + +                A++ HS+FEGLALGLQ   +  + LF+ ++IH++++A+ +G+ +A++ +  + +   A   S   P+GI +G  +   E+  S +  + S +LQGLA GTF ++ F EIL +E+  ++ +++KVL L +G+ +++ ++F+
Sbjct:   49 FMLLGSLLPVKVIEADLEKAHRSKKVLSLCNTFGGGVFLATCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQ---LVLTFRRERPPFIDLETFNAGS------DAGSDSEYESPFVGVGNRSHSLYPEPTAHTHGAGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAIHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLGLGI---ESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLAGMVFL 346          
BLAST of slc39a-3 vs. Ensembl Mouse
Match: Slc39a3 (solute carrier family 39 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:2147269])

HSP 1 Score: 111.694 bits (278), Expect = 2.453e-27
Identity = 79/310 (25.48%), Postives = 160/310 (51.61%), Query Frame = 2
Query:  182 YFIIRYYMRVKFYKREM-KLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXX---------------XXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            + ++   + VK  + ++ K    +KVLS+CN F  GVFL T    +L  V   + + +    I + +PL   +++ G FL +++E+   L+    +++    +   F++        +  SD +  + F     +S   +PE         + +                A++ HS+FEGLALGLQ   +  + LF+ ++IH++++A+ +G+ +A++ +  + +   A   S   P+GI +G  +   E+  S +  + S +LQGLA GTF ++ F EIL +E+  ++ +++KVL L +G+ +++ ++F+
Sbjct:   49 FMLLGSLLPVKVIEADLEKAHRSKKVLSLCNTFGGGVFLATCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQ---LVLTFRRERPPFIDLETFNAGS------DAGSDSEYESPFVGVGNRSHSLYPEPTAHTHGAGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAIHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLGLGI---ESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLAGMVFL 346          
BLAST of slc39a-3 vs. Ensembl Mouse
Match: Slc39a2 (solute carrier family 39 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:2684326])

HSP 1 Score: 90.8929 bits (224), Expect = 3.619e-20
Identity = 72/299 (24.08%), Postives = 139/299 (46.49%), Query Frame = 2
Query:  209 VKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDM-NEAMKTYQIKST----------------FPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVL 1054
            VK+++ +       +VLS+  C +AGVFL  G++ +  + L+ + +E  K  +  ST                +P G  V+  G F +  +E    L    C              S  +E ++  T      + F  +K  ++   P      +   +L+++++ HS+FEGLA+GLQ  V  T+ L +A+  HK ++  ++GL L +     + +       ++ SP+G+ +G  +    +  +  L     +L+G+A GTF Y+ F EILP+E++     + K   ++ GF  ++++
Sbjct:   29 VKWFQMDAATGHHHRVLSLLGCTSAGVFLGAGLMHMTAEALEGIESEIQKFVEQNSTGSKGNSSRDAASSYVEYPYGELVISLGFFFVFLLES---LALQCCHGAA--------GGSTVQEEEWGGT------HAFGFHKHPAV---PSPSRGPLRALVLLLSLSFHSVFEGLAVGLQATVAATIQLCVAVLAHKGLVVFSVGLRLGKIGTGPRWATFCILSLALMSPVGLALGLTVAGGASGQTQGLAQ--AVLEGIAAGTFLYVTFLEILPRELACPEAPLAKYSCVAAGFAFMALI 305          
BLAST of slc39a-3 vs. UniProt/SwissProt
Match: sp|Q3SYU3|S39A1_BOVIN (Zinc transporter ZIP1 OS=Bos taurus OX=9913 GN=SLC39A1 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 7.264e-36
Identity = 90/274 (32.85%), Postives = 147/274 (53.65%), Query Frame = 2
Query:  242 SIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            S QK LS+ +CFA GVFL T +LD+L D L  ++EA+    +   FPL  F++  G FL+L +E+ I L          R E+R    ++    Q      G      + +   +L              +L+ ++A+HS+FEGLA+GLQ +    + L +A+ +HK +LA+++ L L Q+ +  ++      +FS  +P+GI +G  L     P      +  ++L+G+A GTF YI F EILPQE++    +I+KV+ L  GF L++ L+F+
Sbjct:   64 SRQKALSLVSCFAGGVFLATCLLDLLPDYLGAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQ-ITLAYKEQSGPPPREETRALLGTVNGGPQHWHDGLGVPQAGGASSAPSALRA-----------CVLVFSLALHSVFEGLAVGLQRDQARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGTALAESAGPLHQ---LAQSVLEGMAAGTFLYITFLEILPQELATSEQRILKVILLLAGFALLTGLLFI 322          
BLAST of slc39a-3 vs. UniProt/SwissProt
Match: sp|Q9NY26|S39A1_HUMAN (Zinc transporter ZIP1 OS=Homo sapiens OX=9606 GN=SLC39A1 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.484e-35
Identity = 89/274 (32.48%), Postives = 147/274 (53.65%), Query Frame = 2
Query:  242 SIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            S QK LS+ +CFA GVFL T +LD+L D L  ++EA+    +   FPL  F++  G FL+L +E+ I L            E+R    ++    Q      G    + +     +L              +L+ ++A+HS+FEGLA+GLQ +    + L +A+ +HK +LA+++ L L Q+ +  ++      +FS  +P+GI +G  L     P      +  ++L+G+A GTF YI F EILPQE+++   +I+KV+ L  GF L++ L+F+
Sbjct:   64 SRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQ-ITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRA-----------CVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLH---QLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFI 322          
BLAST of slc39a-3 vs. UniProt/SwissProt
Match: sp|Q9QZ03|S39A1_MOUSE (Zinc transporter ZIP1 OS=Mus musculus OX=10090 GN=Slc39a1 PE=2 SV=3)

HSP 1 Score: 134.806 bits (338), Expect = 3.967e-35
Identity = 90/274 (32.85%), Postives = 146/274 (53.28%), Query Frame = 2
Query:  242 SIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            S QK LS+ +CFA GVFL T +LD+L D L  ++EA++   +   FPL  F++  G FL+L +E+ I L            E+R    ++    Q      G      +     +L              +L+ ++A+HS+FEGLA+GLQ +    + L +A+ +HK +LA+++ L L Q+ +  ++      +FS  +P+GI +G  L     P      +  ++L+G+A GTF YI F EILPQE++    +I+KV+ L  GF L++ L+FV
Sbjct:   64 SGQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALEALHVTLQFPLQEFILAMGFFLVLVMEQ-ITLAYKEQTSPPHPEETRALLGTVNGGPQHWHDGPGIPQAGGTPAAPSALRA-----------CVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRVQVVAGCGILFSCMTPLGIGLGAALAESAGPLH---QLAQSVLEGMAAGTFLYITFLEILPQELATSEQRILKVILLLAGFALLTGLLFV 322          
BLAST of slc39a-3 vs. UniProt/SwissProt
Match: sp|P59889|S39A1_DANRE (Zinc transporter ZIP1 OS=Danio rerio OX=7955 GN=slc39a1 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 4.520e-32
Identity = 86/291 (29.55%), Postives = 155/291 (53.26%), Query Frame = 2
Query:  206 RVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTS----DGKTYNTFSE-NKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            R+K++      +  + VLS  +CFA GVFL+  +LDI+ D L D++  ++   +   FPL  F++ CG F +L +E   +++ +  +  R    + +   +          S    +G  ++   + +   S   F           +L +++++HS+FEGLA+GLQ      L + +AI +HKS++  ++ ++L Q+ +     V++ T+F+I SP+GI IG ++   E       L+   +L+GLA GTF YI F EILP E+++    ++KVL L  GF +++ L F+
Sbjct:   28 RMKWFHVTGGTELHKAVLSFVSCFAGGVFLSACLLDIIPDYLSDIHGELQKRDLDDGFPLPEFIMACGFFTVLILE---KMVLSCTEGHRNEETAPLLAPAAPNGHAHGHPSVNDLEGSGHHVHVDFHAHSSFRSF-----------MLFLSLSLHSVFEGLAIGLQTTNAKVLEICIAILVHKSIIVFSLSVKLVQSAVKPLWVVLYVTVFAIMSPLGIGIGIVV--IETERQAGGLI-QAVLEGLAAGTFIYITFLEILPHELNSSERPLLKVLFLLCGFSIMAALCFL 301          
BLAST of slc39a-3 vs. UniProt/SwissProt
Match: sp|Q6QQT1|S39A1_TAKRU (Zinc transporter ZIP1 OS=Takifugu rubripes OX=31033 GN=slc39a1 PE=2 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 5.846e-32
Identity = 92/288 (31.94%), Postives = 156/288 (54.17%), Query Frame = 2
Query:  206 RVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXX--XXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            RVK+++     ++ + VLS+ +CFA GVFL+   LDI+ D L D+N  +   Q++++FPL  F++  G F +L +E   R++ N CK+ R   E R         +  ER S     +    + E S                 +L +++++HSIFEGLA+GLQ      + + +AI +HKS++  ++ ++L Q+ I       +  +F++ SP+GI IG  +   +    P +     IL+G A GTF YI F EILP E+++   +++KVL L +GF +++ L F+
Sbjct:   28 RVKWFRDTDGTETHRTVLSLISCFAGGVFLSACFLDIIPDYLSDINTELHARQLETSFPLPEFIMAAGFFTVLILE---RIVLN-CKEMRATHEERT-------TLIPERKSGHGHGHGDGPDPESSGHHVHVDFQAHSPFRSFMLFLSLSLHSIFEGLAIGLQTTDPKVVEICIAILVHKSIIVFSLAVKLVQSAIPPLWVAAYIGVFALMSPVGIAIGISVMEAQLAAGPLI---QAILEGFAAGTFVYITFLEILPHELNSPGKQLLKVLFLLLGFSIMAALSFL 301          
BLAST of slc39a-3 vs. TrEMBL
Match: A0A0H3YKH6 (Slc39a-3 OS=Schmidtea mediterranea OX=79327 GN=slc39a-3 PE=2 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 333/333 (100.00%), Postives = 333/333 (100.00%), Query Frame = 2
Query:   71 MDLSNSTSKVFFNYLTNLKIGXXXXXXXXXXXXXXIPYFIIRYYMRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 1069
            MDLSNSTSKVFFNYLTNLKIGLVFAFLFLVLTVVLIPYFIIRYYMRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESKIDEISLKILIIAIAIHSIFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH
Sbjct:    1 MDLSNSTSKVFFNYLTNLKIGLVFAFLFLVLTVVLIPYFIIRYYMRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESKIDEISLKILIIAIAIHSIFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 333          
BLAST of slc39a-3 vs. TrEMBL
Match: A0A0H3YKI3 (Slc39a-13 OS=Schmidtea mediterranea OX=79327 GN=slc39a-13 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.209e-47
Identity = 128/367 (34.88%), Postives = 194/367 (52.86%), Query Frame = 2
Query:  101 FFNYLTNLKIGXXXXXXXXXXXXXXIPYFIIRYYMRVKFYKREMKLDSIQKV-------------LSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVR-------------FESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLE------------------KFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 1069
            F N +  +K+G+  A L  V  V LIP+ +IR+        ++  ++S+ K              LS  NCFA GVFL+TG +DI  ++L+ + EA    ++ S FPLG F+ + G F+IL IEE +  I N     +V               ES  + SS   E  F+   + +  N   +      E                           +S+ IL+IAI+IHSIFEGLALGLQ        LF+A+ +HK ++A TI L+L+++ +  KM+ + + IFS ++P G+ +GF +NY E   + S  M + +LQG+ACGTFFYIVFFEILP+E   K  KI+K++++ +GF LVS+ +  +H
Sbjct:   20 FMNPVNQVKLGMAAALLVSVFIVTLIPFIVIRHL------SKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELHDHSIDHAHHDHHDHDLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 380          
BLAST of slc39a-3 vs. TrEMBL
Match: A0A433TTJ2 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_007340 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.827e-41
Identity = 104/295 (35.25%), Postives = 172/295 (58.31%), Query Frame = 2
Query:  233 KLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIE-------EGIRLIP-NLCKQKRVRFESRVFHSSITEEVQFERTSDG-------KTYNTFSENKEKSLEKFPESXXXXXX---XXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            +L + ++V+S  +CF+AGVFL T MLD+L  V  ++   + +  + + FP+  F++ICG+F+IL +E       E     P +     R     +  H  +T+ +Q E +  G       +    F E+ E+S    P S     S     +L+ A+A+HS+FEGL++GLQ  + D L +F A+ +HKS+L+ ++G+ L Q+ IS K+++    +FSI+SP+GI IG  +    N  S  L+ G  +LQG+A GTF YI+FFEILP+E ++   +++KVL L IG+  V+ ++F+
Sbjct:   53 RLAAYKRVVSFLSCFSAGVFLATCMLDLLPSVRHNLIRVLFSLSVITGFPVAEFIMICGLFVILIVEQIVLTFKESQACGPGDESANVRRPLLPKAEHDELTQSIQSENSLGGLSDEPHVQHSRDFEESAERSRPGSPASPQKTHSPLRALLLVCALALHSVFEGLSVGLQQGISDVLGIFAALVLHKSILSFSLGMNLIQSRISRKLAIKSVFVFSIASPLGIAIGIGITDLWNSVSSGLMHG--VLQGVASGTFLYIIFFEILPKEFNDGEDRLLKVLFLIIGYSAVTAILFL 345          
BLAST of slc39a-3 vs. TrEMBL
Match: A0A0H3YJF6 (Slc39a-11 OS=Schmidtea mediterranea OX=79327 GN=slc39a-11 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 8.330e-36
Identity = 106/325 (32.62%), Postives = 169/325 (52.00%), Query Frame = 2
Query:  221 KREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGI-------------------RLIPNLCKQKRVRF----------------------ESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKI--IKVLSLSIGFILVSVLIFVL 1066
            +R    D +Q  ++  +CFAAGVFL+TG LDI  DV+K ++ A K   +   FPL +F  + G FLIL IE+ I                   R+ P   ++ +  F                      +SR   S + +   F  T+D    + F+ N+ +S E       ++  +  L+ A++ H++FEGLA+GL   +   L LF+A+S+HK ++A ++GL LA  ++   + +  A IFS +SPIGI +G ++   E  +    L+G  IL+G+ACGTF Y+VFFEILP E+ +  HK    K+  + +GFI V + I ++
Sbjct:   65 QRNSFRDKVQLWVARLSCFAAGVFLSTGFLDIFPDVIKSIDTAGKKLNLNLWFPLASFFTLIGFFLILSIEQLILIYKNHLAMIGSGSIKNIKRISPIFEEESQEAFLTEISDVNVNASFDKLAGQGISKSRSTDSDLMDHKHFSETTD----DDFNNNELESDEIGNILHHNKSRIFALMFAMSFHAVFEGLAIGLGTTIAGILQLFIALSMHKLIIAASLGLNLATAELKLWIKISVAMIFSCASPIGIGLGALIMSQEKGHDVLFLVGG-ILEGIACGTFLYVVFFEILPHELGHSAHKDRGAKLACVLMGFIFVCIYILLV 384          
BLAST of slc39a-3 vs. TrEMBL
Match: K1QDS4 (Zinc transporter ZIP1 OS=Crassostrea gigas OX=29159 GN=CGI_10025188 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 9.569e-36
Identity = 108/330 (32.73%), Postives = 174/330 (52.73%), Query Frame = 2
Query:  176 IPYFIIRYYMRVKFYKREM-KLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGI-----RLIPNLCKQKR--VRFESRVF-HSSITEEVQFERTSDGKTYNTFSENKEKSLE-----------------------KFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 1069
            +P  I+ Y  R      ++ K  + +  +SV NCFAAGVFL T +LD+L  V + +  A+      +TFP+  FV+  G+FLIL IE+ +       I N    KR  +  ES +    S+TE V+ E +  G +   F   ++ S                         +FP       SL +L+        FEGLA+GLQ      + +F A+++HKS+L+ ++G+ LAQ+ ++ K +V    +FSIS+P+G+ IG  +    +  + +L+ G  ILQG+ACGTF YI FFE+LP E +N + +++KV+ L +GF  V+ +++  H
Sbjct:    8 LPLKIVNYVRRRSGTNVDLHKQIAYRTTISVLNCFAAGVFLATVVLDLLPGVRESLTTALTALNAATTFPIAEFVMSFGLFLILGIEQVVLTYKESHIQNQDSVKRPLLANESTLSRQQSLTESVRSEHSITGISDEPFQSTRKNSRAFDNSATLSDDEAQEESHGHTHDIEFPHDHSLLRSLLLLLALALHSL-FEGLAVGLQDKTDQVIQIFAALALHKSILSFSLGMNLAQSKMTLKGAVKSVLLFSISAPVGVGIGIGIIRLWDSKASNLVQG--ILQGIACGTFLYITFFEVLPHEFNNCDSRLLKVIFLLLGFAAVTAIVYFGH 334          
BLAST of slc39a-3 vs. Ensembl Cavefish
Match: slc39a1 (zinc transporter ZIP1-like [Source:NCBI gene;Acc:103033216])

HSP 1 Score: 130.183 bits (326), Expect = 1.130e-34
Identity = 97/322 (30.12%), Postives = 172/322 (53.42%), Query Frame = 2
Query:  107 NYLTNLKIGXXXXXXXXXXXXXXIPYFIIRYYMRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSD--GKTYNTFSE-NKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
             YL  +K+G +   L L L    IP        R+++++     ++ QKVLS  +CFA GVFL   +LDI+ D L D+++ ++   +   FP+  F++ CG F +L +E   R++ + C   R    S +              +D  G  ++   +     S   F           +L +++++HS+FEGLA+GLQ      L + +AI +HKS++  ++ ++L Q+ +      I+ T+F++ SPIGI +G  ++     +S +L+ G  IL+G+A GTF YI F EILP E+++   +++KVL + +GF +++ L F+
Sbjct:    2 EYLLQVKVGALVGLLLLTLLFGFIP-------ARMRWFRETSGTETHQKVLSFISCFAGGVFLAACLLDIIPDYLSDISDQLQG--LDGGFPVAEFIMACGFFTVLILE---RIVLS-CTGSRSEETSPLLGHGHGHAHGHRSVNDMEGSAHHVHVDLQAHSSFRSF-----------MLFLSLSLHSVFEGLAIGLQTTDAKVLEICIAILVHKSIIVFSLSVKLVQSAVRPAWVGIYITVFALMSPIGIGVGIGVSE-AKLHSGALVQG--ILEGMAAGTFIYITFLEILPHELNSPERQLLKVLFILVGFSVMAGLCFL 296          
BLAST of slc39a-3 vs. Ensembl Cavefish
Match: SLC39A3 (solute carrier family 39 member 3 [Source:NCBI gene;Acc:103038117])

HSP 1 Score: 100.138 bits (248), Expect = 1.697e-23
Identity = 78/285 (27.37%), Postives = 146/285 (51.23%), Query Frame = 2
Query:  248 QKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKF-----------PE--SXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
            ++ ++  N F  GVFL T    +L  V   + E +K  Q  + +PL   +++ G FL +++E+ +       K++    +   F++  +E       SD +    F      S               P   ++   + L  L++A++ HS+FEGLALGLQ +      LF+ ++IH+++ A+ +G+  A+  +  + +   A   S+  P+GI +G  +   +N     +   S +LQGLA GTF +I FFEIL +E+ +K+ +++KVL L +G+ +++ L+F+
Sbjct:   40 RRAVAFSNSFGGGVFLATCFNALLPAVRDKVGEVLKMLQATTDYPLAETMMMLGFFLTVFVEQAVL---TFRKERPSFIDLETFNAGGSEA-----GSDSEYDTPFIAPPRSSAAHQNHHSHHHGHFNPAELTRAGPLRLASLVLALSAHSVFEGLALGLQEDGAKLGSLFIGVAIHETLAAVALGVSTAKAGLMLRDASKLAVTVSLMIPLGIGLGMGIETAQNLAGSIV---SVVLQGLAAGTFLFITFFEILSRELEDKHDRLLKVLFLVLGYGVLAGLVFI 313          
BLAST of slc39a-3 vs. Ensembl Cavefish
Match: SLC39A1 (zinc transporter ZIP1 [Source:NCBI gene;Acc:103025837])

HSP 1 Score: 88.5817 bits (218), Expect = 2.593e-19
Identity = 75/296 (25.34%), Postives = 142/296 (47.97%), Query Frame = 2
Query:  185 FIIRYYMRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPE-SXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 1069
            +++R   R   Y      +S  + L +  C AAGVFL + +L+++   +  M E      +   FP+  F++  G  L++ IE+ +  +           E+ +  S++    +  + S    Y+   + K +      + S +  I + +L+ ++++ S+FEGLA+GLQ      L L +++   K ++AL++ ++L Q  +          +FS + P+G  +G  L   +   +P   +  + LQGLA G+F YI   E+L   +S+   +I KV  L  GF  V+VL+  L+
Sbjct:   37 WVLRGTGRCGLYS-----ESRYRALDLLGCCAAGVFLASSLLNMVPSYMIGMTETFSNLGVTLRFPVPEFILAMGFLLVVVIEQVVLALKEQSGIYMTEKEALLVGSNVQPHDRHPQCS--HQYSRTVQFKGRGFGGDADVSSLSTIRIFVLVFSLSLCSVFEGLAVGLQEASGQGLNLSLSLLFRKGLIALSLVIKLTQDQLRRVAVTTCLLLFSATCPLGAVLGISLR--QTHTTPQYQLARSTLQGLAAGSFLYITVMEVLTYALSSSGQRISKVTLLLTGFTAVTVLLLCLN 323          
BLAST of slc39a-3 vs. Ensembl Sea Lamprey
Match: SLC39A3 (solute carrier family 39 member 3 [Source:HGNC Symbol;Acc:HGNC:17128])

HSP 1 Score: 80.4925 bits (197), Expect = 3.441e-17
Identity = 43/135 (31.85%), Postives = 79/135 (58.52%), Query Frame = 2
Query:  665 FEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFEN-PNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSN-KNHKIIKVLSLSIGFILVSVLIFV 1063
            FEG+ALGLQ      + L +A+ +H+++ A  +G+ +A+  ++   +   A  F  + P+G+ IG  +   EN     +    S +LQGLA GTF ++ F E+L +EM++ +  +++KV  L++G+ L + L F+
Sbjct:  191 FEGVALGLQETAAKAVGLAVAVGVHETLAAAALGVSMARAGLAPCRAARLAAAFCTAIPVGVAIGAAV---ENGAAGLAGDAASLVLQGLAAGTFLFVAFLEVLAKEMAHGQRDRMLKVALLAVGYALPAGLAFM 322          
BLAST of slc39a-3 vs. Ensembl Nematostella
Match: EDO34311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPR1])

HSP 1 Score: 127.872 bits (320), Expect = 6.864e-34
Identity = 95/285 (33.33%), Postives = 147/285 (51.58%), Query Frame = 2
Query:  248 QKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFP--------------ESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIF 1060
            Q+ LS+CNCFAAGVF  T  LD+L  + +   +A     I S FP+  F    G F++L +E+    + + C +K   F     HS +        T     Y     NKE+S + F                     +   IL++A+++HSIFEGLALGL V V   + +  A+ IHKS++A ++G+ + + D+  ++ V  + +FS   P+GI IG  +   +     S  + S ILQG+A GTF Y+ FFEIL  E+     K++K+L + IGF +V  L++
Sbjct:   36 QQALSLCNCFAAGVFFATSFLDLLPMIREKFKQAFAEANITSPFPIPEFTTCFGFFVVLIVEQ----VVHSCHKKARFFHG---HSHVETTAPLLGTPPQNGYG----NKERSEDSFTPLNERAHQINSQELAEVDSTLRTYILVVALSLHSIFEGLALGLLVEVDRLVQIAAAVVIHKSIIAFSMGVSMVKHDMPLRVIVNASFLFSAMGPLGIGIG--IAVLKESTHFSSNLSSAILQGIANGTFIYVTFFEILQNELKGHGKKLLKLLFMVIGFSVVCGLLY 307          
BLAST of slc39a-3 vs. Ensembl Medaka
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:101170659])

HSP 1 Score: 129.413 bits (324), Expect = 2.869e-34
Identity = 95/320 (29.69%), Postives = 171/320 (53.44%), Query Frame = 2
Query:  107 NYLTNLKIGXXXXXXXXXXXXXXIPYFIIRYYMRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPE-SXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFV 1063
             YL  +KIG +   L L L    IP        +VK++++    ++ + VLS+ +CFA GVFL   +LDI+ D L D++ A+   +++++FPL  F++  G F +L +E+ +       +++R   E R         +   R   G    T  + ++ +     +          +L +++++HS+FEGLA+GLQ      L + +AI +HKS++  ++ ++L Q+ +       +  +F++ SP+GI IG  ++  E   +   L+   IL+GLA GTF YI F EILP E+++   +I+KVL + +GF  ++ L F+
Sbjct:    2 EYLLQVKIGALIGLLLLTLLFGFIP-------AKVKWFRQTNGSETHRTVLSLISCFAGGVFLAACLLDIIPDYLSDISAALDVQKLETSFPLPEFIIAAGFFTVLILEKTVMHF----RERRGAGEER------APLLSGNRNGHGHGAVTTPDLEDSAHHVHVDFQAHSPFRSFMLFLSLSLHSVFEGLAIGLQSTDSKVLEICIAILVHKSIIVFSLSVKLVQSAVQPAWVAAYIFVFAMMSPLGIAIG--ISVVEAALTSGALI-QAILEGLAAGTFIYITFMEILPHELNSAGKQILKVLFILLGFTTMAALTFL 301          
BLAST of slc39a-3 vs. Ensembl Medaka
Match: SLC39A3 (solute carrier family 39 member 3 [Source:NCBI gene;Acc:101157119])

HSP 1 Score: 104.76 bits (260), Expect = 4.710e-25
Identity = 75/284 (26.41%), Postives = 149/284 (52.46%), Query Frame = 2
Query:  233 KLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITE-----EVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXX---XXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIF 1060
            K +  ++ LS+CN F  GVFL T    +L  V + +    +  +I   +PL   +++ G FL +++E+ +       ++K    +   F++  +E     E      S  ++    +         F  S++       L  L++A++ HS+FEGLALGLQ +      LF+ +++H+++ A+ +G+ +A++ +  + ++      S+  P+G+ +G  +   E+  +    + S +LQGLA GTF ++ FFEIL +E+ +   +++KVL L +G+  ++VL+F
Sbjct:   35 KANRYRRALSLCNSFGGGVFLATCFNALLPAVREKVAALFEQLKISGDYPLAETMMMVGFFLTVFVEQAVL---TFRREKPSFIDLETFNAGGSEAGSDSEYDTPFISSARSSADVARRHGHHHGHFSPSELAGAGPLRLAGLVLALSAHSVFEGLALGLQEDGAKLGSLFLGVAVHETLAAVALGVSVAKSSLGMQDAIKLGVTVSLMIPLGMVVGMGI---ESAQTLGGDVASVLLQGLAAGTFLFVTFFEILSRELEDTRDRLLKVLFLILGYAALAVLVF 312          
BLAST of slc39a-3 vs. Planmine SMEST
Match: SMESG000027903.1 (SMESG000027903.1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 333/333 (100.00%), Postives = 333/333 (100.00%), Query Frame = 2
Query:   71 MDLSNSTSKVFFNYLTNLKIGXXXXXXXXXXXXXXIPYFIIRYYMRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 1069
            MDLSNSTSKVFFNYLTNLKIGLVFAFLFLVLTVVLIPYFIIRYYMRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESKIDEISLKILIIAIAIHSIFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH
Sbjct:    1 MDLSNSTSKVFFNYLTNLKIGLVFAFLFLVLTVVLIPYFIIRYYMRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESKIDEISLKILIIAIAIHSIFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 333          
BLAST of slc39a-3 vs. Planmine SMEST
Match: SMESG000027903.1 (SMESG000027903.1)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 289/289 (100.00%), Postives = 289/289 (100.00%), Query Frame = 2
Query:  203 MRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 1069
            MRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESKIDEISLKILIIAIAIHSIFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH
Sbjct:    1 MRVKFYKREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESKIDEISLKILIIAIAIHSIFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 289          
BLAST of slc39a-3 vs. Planmine SMEST
Match: SMESG000069905.1 (SMESG000069905.1)

HSP 1 Score: 176.022 bits (445), Expect = 3.361e-51
Identity = 128/367 (34.88%), Postives = 194/367 (52.86%), Query Frame = 2
Query:  101 FFNYLTNLKIGXXXXXXXXXXXXXXIPYFIIRYYMRVKFYKREMKLDSIQKV-------------LSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVR-------------FESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLE------------------KFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 1069
            F N +  +K+G+  A L  V  V LIP+ +IR+        ++  ++S+ K              LS  NCFA GVFL+TG +DI  ++L+ + EA    ++ S FPLG F+ + G F+IL IEE +  I N     +V               ES  + SS   E  F+   + +  N   +      E                           +S+ IL+IAI+IHSIFEGLALGLQ        LF+A+ +HK ++A TI L+L+++ +  KM+ + + IFS ++P G+ +GF +NY E   + S  M + +LQG+ACGTFFYIVFFEILP+E   K  KI+K++++ +GF LVS+ +  +H
Sbjct:   20 FMNPVNQVKLGMAAALLVSVFIVTLIPFIVIRHL------SKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELVTFIKNRFYGSKVSPTKVVINDEFIMPTESNAWPSSAVNENTFDFDKESRDSNQVLKKVSVDRELHDHSIDHAHHDHHDHDLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLFIH 380          
BLAST of slc39a-3 vs. Planmine SMEST
Match: SMESG000056994.1 (SMESG000056994.1)

HSP 1 Score: 157.918 bits (398), Expect = 2.274e-44
Identity = 119/371 (32.08%), Postives = 178/371 (47.98%), Query Frame = 2
Query:   80 SNSTSKV---FFNYLTNLKIGXXXXXXXXXXXXXXIPYFIIRYYMRVKFYKREMKLDSIQKV-------LSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSI---TEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGL-ALGLQVNVKDTLLLFMAISI---------------------------HKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH 1069
            SN+TS     F N +  +K+G+    L  V  V  IP+ +IR   +    +   K     K        LS  NCFA GVFL+TG +DI  ++L+ + EA    +I ++FPLG F+ + G +LIL IEE +  I N     +V     V +      TE   + R++  ++   F E    S +   ++          I           L A  L        +L +AISI                           HK ++A TI L+++++ +  KM+ + + IFS ++P G+ +GF +NY E   + S  M + ILQG+ACGTFFYIVFFEILPQE   +  KIIK ++L +GF LVS+ +  LH
Sbjct:   10 SNTTSVPWVPFMNPVNKVKLGMAAGLLVSVFIVTFIPFIVIRRLDKKWGIENVNKTRETSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKITNSFPLGPFLTLVGFYLILIIEELVTFIKNRFYGPKVSDNKEVVNHEFIIPTESNSWSRSTVSESTFDFVEKIRDSNQTMKKASFSRELHDHSIDHAHHDHHEHDLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQISKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGILQGIACGTFFYIVFFEILPQEFGKRKDKIIKTIALILGFALVSLFMLFLH 380          
BLAST of slc39a-3 vs. Planmine SMEST
Match: SMESG000016934.1 (SMESG000016934.1)

HSP 1 Score: 144.821 bits (364), Expect = 1.750e-39
Identity = 106/325 (32.62%), Postives = 169/325 (52.00%), Query Frame = 2
Query:  221 KREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIKSTFPLGTFVVICGIFLILYIEEGI-------------------RLIPNLCKQKRVRF----------------------ESRVFHSSITEEVQFERTSDGKTYNTFSENKEKSLEKFPESXXXXXXXXXXXXXXXXXXXFEGLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFATIFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEILPQEMSNKNHKI--IKVLSLSIGFILVSVLIFVL 1066
            +R    D +Q  ++  +CFAAGVFL+TG LDI  DV+K ++ A K   +   FPL +F  + G FLIL IE+ I                   R+ P   ++ +  F                      +SR   S + +   F  T+D    + F+ N+ +S E       ++  +  L+ A++ H++FEGLA+GL   +   L LF+A+S+HK ++A ++GL LA  ++   + +  A IFS +SPIGI +G ++   E  +    L+G  IL+G+ACGTF Y+VFFEILP E+ +  HK    K+  + +GFI V + I ++
Sbjct:   55 QRNSFRDKVQLWVARLSCFAAGVFLSTGFLDIFPDVIKSIDTAGKKLNLNLWFPLASFFTLIGFFLILSIEQLILIYKNHLAMIGSGSIKNIKRISPIFEEESQEAFLTEISDVNVNASFDKLAGQGISKSRSTDSDLMDHKHFSETTD----DDFNNNELESDEIGNILHHNKSRIFALMFAMSFHAVFEGLAIGLGTTIAGILQLFIALSMHKLIIAASLGLNLATAELKLWIKISVAMIFSCASPIGIGLGALIMSQEKGHDVLFLVGG-ILEGIACGTFLYVVFFEILPHELGHSAHKDRGAKLACVLMGFIFVCIYILLV 374          
The following BLAST results are available for this feature:
BLAST of slc39a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC39A13.091e-3632.48solute carrier family 39 member 1 [Source:HGNC Sym... [more]
SLC39A13.091e-3632.48solute carrier family 39 member 1 [Source:HGNC Sym... [more]
SLC39A13.091e-3632.48solute carrier family 39 member 1 [Source:HGNC Sym... [more]
SLC39A13.091e-3632.48solute carrier family 39 member 1 [Source:HGNC Sym... [more]
SLC39A13.091e-3632.48solute carrier family 39 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of slc39a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zipt-11.151e-2327.43Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-2.21.454e-2129.77Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-2.12.773e-2127.36Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-2.12.773e-2127.36Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-2.12.477e-1927.68Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
back to top
BLAST of slc39a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Zip42C.22.831e-2730.95gene:FBgn0033097 transcript:FBtr0306802[more]
Zip42C.18.719e-2227.45gene:FBgn0033096 transcript:FBtr0086139[more]
Zip89B1.812e-2140.63gene:FBgn0038412 transcript:FBtr0083266[more]
Zip88E5.078e-932.08gene:FBgn0038312 transcript:FBtr0290018[more]
back to top
BLAST of slc39a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc39a15.987e-3329.55solute carrier family 39 member 1 [Source:NCBI gen... [more]
slc39a15.987e-3329.55solute carrier family 39 member 1 [Source:NCBI gen... [more]
slc39a31.284e-923.42solute carrier family 39 member 3 [Source:NCBI gen... [more]
back to top
BLAST of slc39a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc39a35.739e-3132.13solute carrier family 39 member 3 [Source:NCBI gen... [more]
alkbh61.423e-2631.14alkB homolog 6 [Source:Xenbase;Acc:XB-GENE-5891943... [more]
slc39a16.001e-2226.84solute carrier family 39 member 1 [Source:NCBI gen... [more]
camk2n21.966e-1726.60calcium/calmodulin-dependent protein kinase II inh... [more]
back to top
BLAST of slc39a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc39a15.671e-3632.85solute carrier family 39 (zinc transporter), membe... [more]
Slc39a31.388e-2725.48solute carrier family 39 (zinc transporter), membe... [more]
Slc39a32.453e-2725.48solute carrier family 39 (zinc transporter), membe... [more]
Slc39a32.453e-2725.48solute carrier family 39 (zinc transporter), membe... [more]
Slc39a23.619e-2024.08solute carrier family 39 (zinc transporter), membe... [more]
back to top
BLAST of slc39a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3SYU3|S39A1_BOVIN7.264e-3632.85Zinc transporter ZIP1 OS=Bos taurus OX=9913 GN=SLC... [more]
sp|Q9NY26|S39A1_HUMAN1.484e-3532.48Zinc transporter ZIP1 OS=Homo sapiens OX=9606 GN=S... [more]
sp|Q9QZ03|S39A1_MOUSE3.967e-3532.85Zinc transporter ZIP1 OS=Mus musculus OX=10090 GN=... [more]
sp|P59889|S39A1_DANRE4.520e-3229.55Zinc transporter ZIP1 OS=Danio rerio OX=7955 GN=sl... [more]
sp|Q6QQT1|S39A1_TAKRU5.846e-3231.94Zinc transporter ZIP1 OS=Takifugu rubripes OX=3103... [more]
back to top
BLAST of slc39a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKH60.000e+0100.00Slc39a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKI31.209e-4734.88Slc39a-13 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A433TTJ21.827e-4135.25Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0H3YJF68.330e-3632.62Slc39a-11 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
K1QDS49.569e-3632.73Zinc transporter ZIP1 OS=Crassostrea gigas OX=2915... [more]
back to top
BLAST of slc39a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc39a11.130e-3430.12zinc transporter ZIP1-like [Source:NCBI gene;Acc:1... [more]
SLC39A31.697e-2327.37solute carrier family 39 member 3 [Source:NCBI gen... [more]
SLC39A12.593e-1925.34zinc transporter ZIP1 [Source:NCBI gene;Acc:103025... [more]
back to top
BLAST of slc39a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SLC39A33.441e-1731.85solute carrier family 39 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc39a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc39a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO343116.864e-3433.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc39a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc39a12.869e-3429.69solute carrier family 39 member 1 [Source:NCBI gen... [more]
SLC39A34.710e-2526.41solute carrier family 39 member 3 [Source:NCBI gen... [more]
back to top
BLAST of slc39a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027903.10.000e+0100.00SMESG000027903.1[more]
SMESG000027903.10.000e+0100.00SMESG000027903.1[more]
SMESG000069905.13.361e-5134.88SMESG000069905.1[more]
SMESG000056994.12.274e-4432.08SMESG000056994.1[more]
SMESG000016934.11.750e-3932.62SMESG000016934.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012799
GenBankAKN21668.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012799 ID=SMED30012799|Name=slc39a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1157bp
GAAATGATTTTCATTTTTGTTTTATGAAATTTTAAATTAAAATTGTAAAA
TTATTTCAATTTTCAACTAAATGGATCTGTCGAATAGCACTTCAAAAGTC
TTCTTCAATTACTTGACGAATCTAAAAATTGGATTGGTGTTCGCATTTTT
ATTTTTAGTATTAACGGTTGTTCTCATTCCTTACTTCATAATACGATATT
ACATGCGAGTGAAATTTTACAAAAGAGAAATGAAACTGGATTCCATTCAA
AAGGTTTTGTCAGTTTGTAACTGCTTTGCTGCTGGAGTTTTTCTCACAAC
AGGAATGTTAGACATATTAAACGACGTTCTGAAGGACATGAACGAAGCAA
TGAAAACGTATCAAATCAAATCGACCTTTCCACTTGGAACATTCGTCGTC
ATTTGCGGAATATTCCTTATTTTGTATATTGAAGAAGGAATTCGTTTAAT
TCCCAATTTATGTAAACAGAAGCGAGTGAGATTTGAATCTCGAGTTTTCC
ATTCATCGATTACAGAAGAAGTTCAATTTGAAAGAACCTCAGATGGAAAA
ACATATAATACTTTTTCTGAAAATAAGGAAAAGTCATTGGAAAAGTTTCC
AGAGTCTAAAATAGACGAAATAAGCTTAAAAATACTTATTATTGCAATTG
CAATTCATTCCATTTTTGAAGGTCTCGCATTAGGTCTACAAGTAAATGTC
AAAGATACGCTACTACTTTTTATGGCTATTTCCATTCATAAATCAGTTTT
AGCATTAACTATTGGTTTAGAGTTGGCCCAGACTGATATTTCGTACAAAA
TGTCTGTTATATTTGCAACAATATTTTCCATTTCATCTCCGATTGGAATT
TGTATTGGTTTCATTCTCAATTACTTCGAGAACCCGAATAGCCCTTCTTT
ACTCATGGGATCAACGATATTGCAAGGTTTAGCTTGTGGGACATTCTTTT
ATATTGTATTTTTTGAAATTCTACCCCAAGAAATGTCAAACAAAAACCAT
AAGATTATAAAAGTTTTAAGTTTATCTATTGGATTTATATTAGTTTCAGT
GTTGATCTTCGTTCTTCATTGACCCGTTACTCTTTTATTCATATAAACAA
GAATACTAAATATTTTATATTGACTTATAAAATTCTGTTCCTTAAATTCT
GTTAAAG
back to top

protein sequence of SMED30012799-orf-1

>SMED30012799-orf-1 ID=SMED30012799-orf-1|Name=SMED30012799-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=334bp
MDLSNSTSKVFFNYLTNLKIGLVFAFLFLVLTVVLIPYFIIRYYMRVKFY
KREMKLDSIQKVLSVCNCFAAGVFLTTGMLDILNDVLKDMNEAMKTYQIK
STFPLGTFVVICGIFLILYIEEGIRLIPNLCKQKRVRFESRVFHSSITEE
VQFERTSDGKTYNTFSENKEKSLEKFPESKIDEISLKILIIAIAIHSIFE
GLALGLQVNVKDTLLLFMAISIHKSVLALTIGLELAQTDISYKMSVIFAT
IFSISSPIGICIGFILNYFENPNSPSLLMGSTILQGLACGTFFYIVFFEI
LPQEMSNKNHKIIKVLSLSIGFILVSVLIFVLH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0002056medial muscle cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR003689ZIP
Vocabulary: molecular function
TermDefinition
GO:0046873metal ion transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0030001metal ion transport
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 80..100
NoneNo IPR availablePANTHERPTHR11040:SF152SOLUTE CARRIER FAMILY 39 (ZINC TRANSPORTER), MEMBER 3-RELATEDcoord: 19..331
NoneNo IPR availablePANTHERPTHR11040ZINC/IRON TRANSPORTERcoord: 19..331
NoneNo IPR availableTMHMMTMhelixcoord: 246..268
NoneNo IPR availableTMHMMTMhelixcoord: 188..210
NoneNo IPR availableTMHMMTMhelixcoord: 102..124
NoneNo IPR availableTMHMMTMhelixcoord: 63..82
NoneNo IPR availableTMHMMTMhelixcoord: 315..332
NoneNo IPR availableTMHMMTMhelixcoord: 214..233
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 283..302
IPR003689Zinc/iron permeasePFAMPF02535Zipcoord: 18..328
e-value: 1.2E-48
score: 166.0