Otopetrin

Overview
NameOtopetrin
Smed IDSMED30012798
Length (bp)1994
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Otopetrin (SMED30012798) t-SNE clustered cells

Violin plots show distribution of expression levels for Otopetrin (SMED30012798) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Otopetrin (SMED30012798) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Otopetrin (SMED30012798) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012798

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30012798h1SMcG0003405 SmedASXL_013850SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30012798h1SMcG0003405 dd_Smed_v4_12986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012798h1SMcG0003405 dd_Smed_v4_12986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012798h1SMcG0003405 dd_Smed_v4_12986_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Otopetrin vs. Ensembl Human
Match: OTOP1 (otopetrin 1 [Source:HGNC Symbol;Acc:HGNC:19656])

HSP 1 Score: 61.2326 bits (147), Expect = 4.884e-9
Identity = 63/296 (21.28%), Postives = 137/296 (46.28%), Query Frame = 1
Query:  871 HLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKS---------NHSENYSNCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYRE-KYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIV----YQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQ----ALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGH-QYSLIIILFICKSLTEMVQSTIQVLFVLE 1692
            H  +  +Q +F++ + + I    K + RF + + V +N+  W   V+ E  H+L EH+ ++ T           +H+   +     L   +S    +L+P  IEY ++++ + Y + + +GRK   H +++ ++ + G  +            G  +GL     T+  V ++ +   +  T+S S ++    Y ++ +ML+ ++ +    A I++  +  + L E +     LD +LL+    G  S +  +   +I + +   GH +Y+   + +   S+  +V+  IQ LF+ E
Sbjct:  173 HSVHTLLQVYFLWGHAKDIIQSFKTLERFGVIHSVFTNLLLWANGVLNESKHQLNEHKERLITLGFGNITTVLDDHTPQCNCTPPTLCTAISHGIYYLYPFNIEYQILASTMLYVLWKNIGRKVDSHQHQKMQFKSDGVMV------------GAVLGLTVLAATIAVVVVYLIHIGRSKTKSESALIMFYLYAITLLMLMGAAGL----AGIRIYRIDEKSLDESKNPARKLDSDLLV----GTASGSWLISWGSILAILCAEGHPRYTWYNLPY---SILAIVEKYIQNLFIFE 445          
BLAST of Otopetrin vs. Ensembl Human
Match: OTOP2 (otopetrin 2 [Source:HGNC Symbol;Acc:HGNC:19657])

HSP 1 Score: 58.151 bits (139), Expect = 3.397e-8
Identity = 96/488 (19.67%), Postives = 190/488 (38.93%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKIST-------KSNHSENYSNCSQQLSYTVSP--------FLFPCAIEYSLISAAIFYKMLQKVGR---KHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVG-LLFFMVTLVGVAIFFLFKKKIA-----TQSSSVIVYQLSEIMLLVSSIITLVWAFI---KMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTT---------------------KELHI--KLKPGRSLVT------------------------------FLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIW 1941
            RD     ++LR G V FG   ++ D FK    +      C + +      +   ++ +QT+F++   +     H  +    L   +T+N+  W   VV E  H+   + +  S           H++N       L  T           +L+P  IEYSL ++ + Y M + VGR       HS+    ++                   F G +L  ++ +VG+A+F +++ +++     T+ + VI Y  + + L ++++++L  + I     R +   +    + LD  LL+    G ++ + +  ++ +       G    L+  L +  +L  + Q T Q +F++E   +G                         LH      P   LV+                              FL++ N+ LWI+  F A+    + +   +Y  + W++I +  LP  IF+R H+   L++++
Sbjct:   94 RDAHAGPIWLRGGLVLFGICTLIMDVFKTG--YYSSFFECQSAIKILHPLIQAVFVIIQTYFLWVSAKDCVHVHLDLTWCGLMFTLTTNLAIWMAAVVDESVHQSHSYSSSHSNASHARLISDQHADNPVGGDSCLCSTAVCQIFQQGYFYLYPFNIEYSLFASTMLYVMWKNVGRFLASTPGHSHTPTPVSLFRET-------------FFAGPVLGLLLFVVGLAVFIIYEVQVSGDGSRTRQALVIYYSFNIVCLGLTTLVSLSGSIIYRFDRRAMDHHK-NPTRTLDVALLMGAALGQYAISYYSIVAVVA------GTPQDLLAGLNLTHALLMIAQHTFQNMFIIESLHRGPPGAEPHSTHPKEPCQDLTFTNLDALHTLSACPPNPGLVSPSPSDQREAVAIVSTPRSQWRRQCLKDISLFLLLCNVILWIMPAFGARPHFSNTVEVDFYGYSLWAVIVNICLPFGIFYRMHAVSSLLEVY 559          
BLAST of Otopetrin vs. Ensembl Human
Match: OTOP3 (otopetrin 3 [Source:HGNC Symbol;Acc:HGNC:19658])

HSP 1 Score: 50.8322 bits (120), Expect = 7.467e-6
Identity = 96/462 (20.78%), Postives = 174/462 (37.66%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSPF------LFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSS----VIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQL----TEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEG----------------------SRKGTTKE------------------LHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIW 1941
            +D     L++R   V FG      + F++   + +    C ++L      + + +I VQT+ ++K+ +          R  L   + +N+  W   V  +  H  +E    I  + +     + C    +     F      L+P + EY LI  A+ + M + VGR    H       A               H  +F  LL  +V L GV +F LF+ + +  + +     + Y     +L   S+  L  A   +  L  R+L       ++LD  LL+    G      F  ++ +          + L+  L +  SL  ++Q   Q LF++EG                       R+G+  E                  L+ K +  + +  FLI+ N+ LW++  F      E+ +   +Y    W  I +  LPL +F+R HS   L++++
Sbjct:  135 QDPHAGPLWVRGSLVLFGSCTFCLNIFRVG--YDVSHIRCKSQLDLVFSVIEMVFIGVQTWVLWKHCKDCVRVQTNFTRCGLMLTLATNLLLWVLAVTNDSMHREIEAELGILMEKSTGNETNTCLCLNATACEAFRRGFLMLYPFSTEYCLICCAVLFVMWKNVGRHVAPHMGAHPATAP-----------FHLHGAIFGPLLGLLVLLAGVCVFVLFQIEASGPAIACQYFTLYYAFYVAVLPTMSLACL--AGTAIHGLEERELDTVKNPTRSLDVVLLMGAALGQMGIAYFSIVAIVAK------RPHELLNRLILAYSLLLILQHIAQNLFIIEGLHRRPLWETVPEGLAGKQEAEPPRRGSLLELGQGLQRASLAYIHSYSHLNWKRRALKEISLFLILCNITLWMMPAFGIHPEFENGLEKDFYGYQIWFAIVNFGLPLGVFYRMHSVGGLVEVY 575          
BLAST of Otopetrin vs. Ensembl Human
Match: OTOP3 (otopetrin 3 [Source:HGNC Symbol;Acc:HGNC:19658])

HSP 1 Score: 50.8322 bits (120), Expect = 7.579e-6
Identity = 96/462 (20.78%), Postives = 174/462 (37.66%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSPF------LFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSS----VIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQL----TEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEG----------------------SRKGTTKE------------------LHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIW 1941
            +D     L++R   V FG      + F++   + +    C ++L      + + +I VQT+ ++K+ +          R  L   + +N+  W   V  +  H  +E    I  + +     + C    +     F      L+P + EY LI  A+ + M + VGR    H       A               H  +F  LL  +V L GV +F LF+ + +  + +     + Y     +L   S+  L  A   +  L  R+L       ++LD  LL+    G      F  ++ +          + L+  L +  SL  ++Q   Q LF++EG                       R+G+  E                  L+ K +  + +  FLI+ N+ LW++  F      E+ +   +Y    W  I +  LPL +F+R HS   L++++
Sbjct:  153 QDPHAGPLWVRGSLVLFGSCTFCLNIFRVG--YDVSHIRCKSQLDLVFSVIEMVFIGVQTWVLWKHCKDCVRVQTNFTRCGLMLTLATNLLLWVLAVTNDSMHREIEAELGILMEKSTGNETNTCLCLNATACEAFRRGFLMLYPFSTEYCLICCAVLFVMWKNVGRHVAPHMGAHPATAP-----------FHLHGAIFGPLLGLLVLLAGVCVFVLFQIEASGPAIACQYFTLYYAFYVAVLPTMSLACL--AGTAIHGLEERELDTVKNPTRSLDVVLLMGAALGQMGIAYFSIVAIVAK------RPHELLNRLILAYSLLLILQHIAQNLFIIEGLHRRPLWETVPEGLAGKQEAEPPRRGSLLELGQGLQRASLAYIHSYSHLNWKRRALKEISLFLILCNITLWMMPAFGIHPEFENGLEKDFYGYQIWFAIVNFGLPLGVFYRMHSVGGLVEVY 593          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-3 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL0])

HSP 1 Score: 144.821 bits (364), Expect = 1.813e-36
Identity = 120/444 (27.03%), Postives = 216/444 (48.65%), Query Frame = 1
Query:  694 NAEKLSIMRDHEGINLYLRLGAVGFGF-GVMVHDG-FKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYE-------INHELVEHRNKISTKSNHSENYSN-CSQQLSY--TVSPFLFPCAIEYSLISAAI---FYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSF------RQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRK--GTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            +A +  ++ +    +LYLRLG V FG  GV+ +   F I        E   + +    + +   +IFVQ +F++   +IIF     + RF L +L  +N+  W + ++YE       I H  V+H N     ++H E +   C   L      + F++ C +EYSLI A +   F+  L+++ R+  +   +++ I +         +C R+  GLF G    +VT++ +A   LF    + ++ +  ++  + +   + S   +V+AF +MR L F       +    + LD  LL++GL G     L   I  I SFI        L +I+F    L  ++Q T Q   ++  SR     + +  ++ KPG+ ++T L+++N A +++++FEA+++  +      Y    W+I+     PL IF+RFHSS C  +IW K++R
Sbjct:  128 SATEPEVLANTSTGSLYLRLGCVVFGIIGVVYYLLIFVICLLGWSSNEGECSVISDVLNVMAAVFIFVQMWFVYCNGKIIFTGDGNLARFGLMHLTGTNLWMWLRYILYEEVETVKEIRH--VQHANLSKASAHHHEVHEEACKGVLCIFNGYNEFMYTCVVEYSLICAGVAFVFWANLERLKREQMEKKMKKRSILK--------IDCSRTAEGLFAGFACIIVTIIAIA---LFNAYSSDKNVAQWIFSCTNMSFFLVSTFLVVFAFWRMRYLKFLMEDDDEEDDNAELLDRILLVVGLIG----ELIFSIGGILSFIN--NMTIGLPLIIFTTNVL-RLIQVTFQSCLLMVASRLRIEESNQHMLRYKPGKQVITMLLMMNCAQFMMNVFEAQKAGINDEMIHMYGSYYWAIVVRGCSPLTIFYRFHSSACFAEIWKKTFR 551          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-3 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL0])

HSP 1 Score: 144.821 bits (364), Expect = 1.813e-36
Identity = 120/444 (27.03%), Postives = 216/444 (48.65%), Query Frame = 1
Query:  694 NAEKLSIMRDHEGINLYLRLGAVGFGF-GVMVHDG-FKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYE-------INHELVEHRNKISTKSNHSENYSN-CSQQLSY--TVSPFLFPCAIEYSLISAAI---FYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSF------RQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRK--GTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            +A +  ++ +    +LYLRLG V FG  GV+ +   F I        E   + +    + +   +IFVQ +F++   +IIF     + RF L +L  +N+  W + ++YE       I H  V+H N     ++H E +   C   L      + F++ C +EYSLI A +   F+  L+++ R+  +   +++ I +         +C R+  GLF G    +VT++ +A   LF    + ++ +  ++  + +   + S   +V+AF +MR L F       +    + LD  LL++GL G     L   I  I SFI        L +I+F    L  ++Q T Q   ++  SR     + +  ++ KPG+ ++T L+++N A +++++FEA+++  +      Y    W+I+     PL IF+RFHSS C  +IW K++R
Sbjct:  128 SATEPEVLANTSTGSLYLRLGCVVFGIIGVVYYLLIFVICLLGWSSNEGECSVISDVLNVMAAVFIFVQMWFVYCNGKIIFTGDGNLARFGLMHLTGTNLWMWLRYILYEEVETVKEIRH--VQHANLSKASAHHHEVHEEACKGVLCIFNGYNEFMYTCVVEYSLICAGVAFVFWANLERLKREQMEKKMKKRSILK--------IDCSRTAEGLFAGFACIIVTIIAIA---LFNAYSSDKNVAQWIFSCTNMSFFLVSTFLVVFAFWRMRYLKFLMEDDDEEDDNAELLDRILLVVGLIG----ELIFSIGGILSFIN--NMTIGLPLIIFTTNVL-RLIQVTFQSCLLMVASRLRIEESNQHMLRYKPGKQVITMLLMMNCAQFMMNVFEAQKAGINDEMIHMYGSYYWAIVVRGCSPLTIFYRFHSSACFAEIWKKTFR 551          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-8 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:G5EDX5])

HSP 1 Score: 140.969 bits (354), Expect = 6.024e-35
Identity = 121/467 (25.91%), Postives = 214/467 (45.82%), Query Frame = 1
Query:  691 QNAEKLSIMR---DHEGIN-LYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNK------------------------ISTKSNHSENYSNCSQQLSYT------------VSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRGNLNK 1971
            +N+E   IM+   + EG   LYLRLGA+ FG   +V  G ++     +E   C  ++   K  + + + F+Q  FIF   +I     + IV F + +L++ N+  WF+ V+ +   E   H+                          IS   N + N +  ++ +               V+ FL  C +EYSLI AAI + + + +G+ +   S        G+R +    +C  S  GLF G++F + +LV + ++ +F+  +   S + +V+ + ++ L   ++   +    +MR L +R     + +D+ LL+IGL G   Y        ID FI         +  L     +  M+Q  +Q  F+L  SR     +  +K KPG+ ++TFL++ N+ L++   FE  +S            T ++ I + + PL++F+RFHSS CL +IW  +Y    N+
Sbjct:  139 KNSEVWFIMQSQHNGEGAGTLYLRLGALFFGSVGIVLFGLELF--LCIENVAC-KKVAIAKMIVAIVFTFIQMHFIFCNSKITVNSSRKIVAFGMMHLISVNLWTWFRFVLAK--QEAKAHKKAQLKQTFRKYYSSSSSSSSEEIHELISAVLNSTLNNTPATKTMEPVASRLFALEHFGDVATFLTTCIVEYSLIGAAIMFILWKSIGQNNHQQS------NSGKRKVKMRIDCSSSSTGLFAGIIFLIGSLVSMGMYTIFES-LRNSSGAQLVFGIVDLSLFSIALGACIIGLWRMRHLQYRLHAHGEVIDEILLIIGLIGEILYCAV----GIDVFITCRRSADLTVSALPAFVFVIRMIQVVVQAAFILTTSRLRCLSKYSMKYKPGKEIITFLLVSNVTLFVFHTFEGMKSSFGF---SSKAATQYNYIIYAVGPLLVFYRFHSSACLAEIWKHTYSTKSNE 586          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-1 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O45067])

HSP 1 Score: 138.658 bits (348), Expect = 3.853e-34
Identity = 114/450 (25.33%), Postives = 211/450 (46.89%), Query Frame = 1
Query:  736 NLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEIN------HELVEHRNK-----------------------ISTKSNHSENY------SNCS--QQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSF------RQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGH-QYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSY 1953
            +L+LRLG+V FG   +V+  F +   F  E +   + L T      + +IF+Q  FIF   ++       + R    +LV +N+  W + V+ E         E+  HR                         +   S+  E++       +C   + +  ++S  +F   +EYSLI+AA+ Y + + +GR+ +  +Y ++      R+     +C ++  GLF+GL F  VT   + +++ F     +QS++  VY  +++   V S I ++ A  +MR L +       Q ++++ LD  LL IGL G   Y       ++   + L G  Q++    + +   +  ++Q   Q  F+L  +R       H + +PG+  +TFL+  NLA++ +++FE++++    +  +YY K  W  +  +  PL IF+RFHSS+C  +IW   Y
Sbjct:  181 SLFLRLGSVVFGVTGVVYYAFLV---FLCELDPNCSALSTSLDVCAILFIFIQMHFIFCNWKLSITGSHMVARVGTMHLVAANLWTWIRYVLMEEGVMEKEIREVFNHRPPGHNYMRSNSSDSSSSAENSMEQFLGDGSHEDEHFEKKIMPGSCQAVECILGSMSEIMFTSIVEYSLIAAAVMYIVWRNIGRQDQGSTYVKR--KHQIRV-----DCSKTTTGLFLGLAFLAVTFTSMVVYYGFTMMNKSQSAA-FVYAFTDMFQYVLSTIGVLTAIYQMRALKYFNKKTKLQNSDQELLDQILLSIGLVGELIY-------SVAGLVGLTGEKQWTNFSFILLFVHIFRLIQVGTQT-FLLHVARSVRMGCEHREAQPGKQAITFLLTANLAIFFMNLFESEKAGVSEMIIEYYGKRSWVFLVRSFSPLTIFYRFHSSVCFAEIWKNVY 611          
BLAST of Otopetrin vs. Ensembl Celegans
Match: otpl-1 (OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O45067])

HSP 1 Score: 138.272 bits (347), Expect = 4.403e-34
Identity = 114/450 (25.33%), Postives = 211/450 (46.89%), Query Frame = 1
Query:  736 NLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEIN------HELVEHRNK-----------------------ISTKSNHSENY------SNCS--QQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSF------RQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGH-QYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSY 1953
            +L+LRLG+V FG   +V+  F +   F  E +   + L T      + +IF+Q  FIF   ++       + R    +LV +N+  W + V+ E         E+  HR                         +   S+  E++       +C   + +  ++S  +F   +EYSLI+AA+ Y + + +GR+ +  +Y ++      R+     +C ++  GLF+GL F  VT   + +++ F     +QS++  VY  +++   V S I ++ A  +MR L +       Q ++++ LD  LL IGL G   Y       ++   + L G  Q++    + +   +  ++Q   Q  F+L  +R       H + +PG+  +TFL+  NLA++ +++FE++++    +  +YY K  W  +  +  PL IF+RFHSS+C  +IW   Y
Sbjct:  165 SLFLRLGSVVFGVTGVVYYAFLV---FLCELDPNCSALSTSLDVCAILFIFIQMHFIFCNWKLSITGSHMVARVGTMHLVAANLWTWIRYVLMEEGVMEKEIREVFNHRPPGHNYMRSNSSDSSSSAENSMEQFLGDGSHEDEHFEKKIMPGSCQAVECILGSMSEIMFTSIVEYSLIAAAVMYIVWRNIGRQDQGSTYVKR--KHQIRV-----DCSKTTTGLFLGLAFLAVTFTSMVVYYGFTMMNKSQSAA-FVYAFTDMFQYVLSTIGVLTAIYQMRALKYFNKKTKLQNSDQELLDQILLSIGLVGELIY-------SVAGLVGLTGEKQWTNFSFILLFVHIFRLIQVGTQT-FLLHVARSVRMGCEHREAQPGKQAITFLLTANLAIFFMNLFESEKAGVSEMIIEYYGKRSWVFLVRSFSPLTIFYRFHSSVCFAEIWKNVY 595          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0331167)

HSP 1 Score: 244.202 bits (622), Expect = 2.118e-68
Identity = 147/457 (32.17%), Postives = 239/457 (52.30%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGEN-CHNELWTPKHCLHLSYIFVQTFFIF-KYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELV-----EHRN-KISTK-SNHSENYS----------------------------NCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQG-ERIIAKYS-ECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTL---SFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSL--IIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            RD    + YLR+GAV FG G M++ G +    F L  +  CHN L        +++IF+Q +FIF    +I   ++K I RF L +++ +N+  W   ++ E  HE++     E+R  +IS +   HS  ++                            N    L    SPFLFPC IEYSLI AAI Y M + + R       R   I+   +R    YS +C R+H+GLFVG+L  ++T++ + IFF+   +    + +V    + E+++  ++ I  +   I++R L   ++R  +    LDD LL+   +G F YN+F  I+         GH ++L    +L    +L  +VQ+  Q +F+L+ SR+      H++ KPGR +VTF++++NLA+W +S  E  R++ H I   +Y    W+IITH  +PL IF+RFHS++CL +IW ++Y+
Sbjct: 1007 RDAHYGSFYLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAYRSFS----LDDILLVGAQTGSFLYNIFTVIA---------GH-FTLRSDDMLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYK 1449          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0346834)

HSP 1 Score: 244.202 bits (622), Expect = 2.195e-68
Identity = 147/457 (32.17%), Postives = 239/457 (52.30%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGEN-CHNELWTPKHCLHLSYIFVQTFFIF-KYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELV-----EHRN-KISTK-SNHSENYS----------------------------NCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQG-ERIIAKYS-ECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTL---SFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSL--IIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            RD    + YLR+GAV FG G M++ G +    F L  +  CHN L        +++IF+Q +FIF    +I   ++K I RF L +++ +N+  W   ++ E  HE++     E+R  +IS +   HS  ++                            N    L    SPFLFPC IEYSLI AAI Y M + + R       R   I+   +R    YS +C R+H+GLFVG+L  ++T++ + IFF+   +    + +V    + E+++  ++ I  +   I++R L   ++R  +    LDD LL+   +G F YN+F  I+         GH ++L    +L    +L  +VQ+  Q +F+L+ SR+      H++ KPGR +VTF++++NLA+W +S  E  R++ H I   +Y    W+IITH  +PL IF+RFHS++CL +IW ++Y+
Sbjct: 1007 RDAHYGSFYLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAYRSFS----LDDILLVGAQTGSFLYNIFTVIA---------GH-FTLRSDDMLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYK 1449          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLc (gene:FBgn0259150 transcript:FBtr0331168)

HSP 1 Score: 243.817 bits (621), Expect = 2.420e-68
Identity = 147/457 (32.17%), Postives = 239/457 (52.30%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGEN-CHNELWTPKHCLHLSYIFVQTFFIF-KYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELV-----EHRN-KISTK-SNHSENYS----------------------------NCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQG-ERIIAKYS-ECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTL---SFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSL--IIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            RD    + YLR+GAV FG G M++ G +    F L  +  CHN L        +++IF+Q +FIF    +I   ++K I RF L +++ +N+  W   ++ E  HE++     E+R  +IS +   HS  ++                            N    L    SPFLFPC IEYSLI AAI Y M + + R       R   I+   +R    YS +C R+H+GLFVG+L  ++T++ + IFF+   +    + +V    + E+++  ++ I  +   I++R L   ++R  +    LDD LL+   +G F YN+F  I+         GH ++L    +L    +L  +VQ+  Q +F+L+ SR+      H++ KPGR +VTF++++NLA+W +S  E  R++ H I   +Y    W+IITH  +PL IF+RFHS++CL +IW ++Y+
Sbjct: 1007 RDAHYGSFYLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAYRSFS----LDDILLVGAQTGSFLYNIFTVIA---------GH-FTLRSDDMLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYK 1449          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLb (gene:FBgn0031514 transcript:FBtr0077608)

HSP 1 Score: 178.718 bits (452), Expect = 8.012e-48
Identity = 131/481 (27.23%), Postives = 222/481 (46.15%), Query Frame = 1
Query:  736 NLYLRLGAVGFGFGVMVHDGFKIADKFRLEG-ENCHNELWTPKHCLHLSYIFVQTFFIF-KYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHE--------------LVEHRNKIS-------------------------------------TKSNHSENYSNCSQ-----QLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKY--SECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKK-----IATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQ----ALDDNLLLIGLSGVFSYNLF-LFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRS---DEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRG 1959
            + YLR+GA+ F  G MV+ G +    F L G   C +          +     Q  FIF     +   +HK   RF L ++V +N+C+W   +V E  HE              LV H + +S                                     T S     +S CS+      L   +SPFLFPC IEYSLI A I ++M + V         R+  +       A +   +C +SH+GLF G+L  ++T++ + ++F+   +     +ATQ   V +++     +  +++IT     I MR L + + T ++     LD+ LL++  +GV+ Y +F +  S    +  +P     +I  +F       +VQ+++Q +F+L  S +       ++ KPGR ++TFL++ N+A+W V+     R+   + HL   +++    W+IITH  +PL IF+RFHS+ICL ++W  +Y+ 
Sbjct:  160 SFYLRVGAIAFAIGTMVYSGLEFGQFFELNGHPGCRDVFVAITPICRMVLCIAQVQFIFLNTTYMDMARHKVTSRFGLMHMVATNLCEWLYVLVEETKHEIFHISQHEVDPAHDLVIHNSSMSRTDWAAVNESLHQHHHHHALNNTLVANVSSVIVNMTITPSPTPAAFSGCSRTTIMGALVQQLSPFLFPCTIEYSLICAVILFEMWKTVKSIPDIDKTRKNSVKPAAAKPAHHFSVDCSQSHKGLFFGILIIVMTIISMIMYFVLYTQPGYELVATQE--VTLWETFMYFMCAAAVIT---GMILMRDLRYIKNTSDEHHSMDLDNLLLIVAQTGVYLYGMFSILGSYFAKWDTVPDRVEGIIAEVF------GVVQTSLQTMFILHSSHRRCRGTNQVRRKPGREIITFLLVANIAIWFVNTLIKGRAVFRESHL---EFFGVWGWTIITHISMPLAIFYRFHSTICLFEVWKITYKA 626          
BLAST of Otopetrin vs. Ensembl Fly
Match: OtopLb (gene:FBgn0031514 transcript:FBtr0344796)

HSP 1 Score: 178.333 bits (451), Expect = 1.417e-47
Identity = 131/481 (27.23%), Postives = 222/481 (46.15%), Query Frame = 1
Query:  736 NLYLRLGAVGFGFGVMVHDGFKIADKFRLEG-ENCHNELWTPKHCLHLSYIFVQTFFIF-KYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHE--------------LVEHRNKIS-------------------------------------TKSNHSENYSNCSQ-----QLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKY--SECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKK-----IATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQ----ALDDNLLLIGLSGVFSYNLF-LFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRS---DEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRG 1959
            + YLR+GA+ F  G MV+ G +    F L G   C +          +     Q  FIF     +   +HK   RF L ++V +N+C+W   +V E  HE              LV H + +S                                     T S     +S CS+      L   +SPFLFPC IEYSLI A I ++M + V         R+  +       A +   +C +SH+GLF G+L  ++T++ + ++F+   +     +ATQ   V +++     +  +++IT     I MR L + + T ++     LD+ LL++  +GV+ Y +F +  S    +  +P     +I  +F       +VQ+++Q +F+L  S +       ++ KPGR ++TFL++ N+A+W V+     R+   + HL   +++    W+IITH  +PL IF+RFHS+ICL ++W  +Y+ 
Sbjct:  178 SFYLRVGAIAFAIGTMVYSGLEFGQFFELNGHPGCRDVFVAITPICRMVLCIAQVQFIFLNTTYMDMARHKVTSRFGLMHMVATNLCEWLYVLVEETKHEIFHISQHEVDPAHDLVIHNSSMSRTDWAAVNESLHQHHHHHALNNTLVANVSSVIVNMTITPSPTPAAFSGCSRTTIMGALVQQLSPFLFPCTIEYSLICAVILFEMWKTVKSIPDIDKTRKNSVKPAAAKPAHHFSVDCSQSHKGLFFGILIIVMTIISMIMYFVLYTQPGYELVATQE--VTLWETFMYFMCAAAVIT---GMILMRDLRYIKNTSDEHHSMDLDNLLLIVAQTGVYLYGMFSILGSYFAKWDTVPDRVEGIIAEVF------GVVQTSLQTMFILHSSHRRCRGTNQVRRKPGREIITFLLVANIAIWFVNTLIKGRAVFRESHL---EFFGVWGWTIITHISMPLAIFYRFHSTICLFEVWKITYKA 644          
BLAST of Otopetrin vs. Ensembl Zebrafish
Match: otop2 (otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2])

HSP 1 Score: 80.4925 bits (197), Expect = 2.326e-15
Identity = 103/473 (21.78%), Postives = 196/473 (41.44%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSP--------------FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLV-GVAIFFLFKKKIA-----TQSSSVIVY---QLSEIMLLVSSIIT--LVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIK--------------------------------LKPGR---------SLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDI 1938
            +D     ++LR G V FG   ++ D FKI   F +   NC + +      +   ++ VQT+ ++ + +      + I R  L   +++N+  W   V  E  H+ V     +   +N++   +  SQQ   +                 +L+P  IEYSL ++A+ Y M + VGRK  DH                  + H S   + VG L  ++ LV G+A F +++  ++      +  ++I++    +  ++L+ SS +   +++   K   +S +  T  ++LD  LL+    G F    F  ++ + S ++  GH   L +    C  LT +++  IQ  F+++G  +   KE  +                                 L  GR          +  FL++ N+ LWI+  F A+   ++ +    Y+   W+ + +  +P  IF+R HS   L ++
Sbjct:  106 KDSHAGPVWLRTGLVLFGICSVIMDIFKII--FYVGRMNCESPVKIAFPVVQAVFVIVQTYVLWIHAKDCVQIKQNITRCGLMLTLSTNLMVWMMAVTEESLHQTVA---PVKPPTNNNIGSAVASQQGGPSECECLHNMCDLFEKAYYYLYPFNIEYSLFASAMTYVMWKNVGRKMDDHHSH---------------KLHFSLWDVLVGPLAGLIVLVAGLATFVVYEVDVSKDDPKKKEEALIMHYIMNIVAVLLMSSSALAGCILFRMDKREQVSGKNPT--RSLDVGLLVGASLGQFLICYFTIVAVLASGVQ--GHTNGLNL---ACAMLT-VIELCIQNAFLIKGLHREPFKETEVATVFANVMAVKERDPERRSSSIVPAHTLPIPLTLLQGRMSWKRRVLKEICAFLLLCNVTLWIIPAFGARPQFDNTVGPDVYEFQTWAAVVNIGMPFGIFYRMHSVASLFEV 550          
BLAST of Otopetrin vs. Ensembl Zebrafish
Match: otop2 (otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2])

HSP 1 Score: 80.1073 bits (196), Expect = 3.508e-15
Identity = 103/474 (21.73%), Postives = 198/474 (41.77%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELV----------EHRNKISTKSNHSE-----NYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLV-GVAIFFLFKKKIA-----TQSSSVIVY---QLSEIMLLVSSIIT--LVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIK--------------------------------LKPGR---------SLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDI 1938
            +D     ++LR G V FG   ++ D FKI   F +   NC + +      +   ++ VQT+ ++ + +      + I R  L   +++N+  W   V  E  H+ V           + + +  ++  SE     N  +  ++  Y    +L+P  IEYSL ++A+ Y M + VGRK  DH                  + H S   + VG L  ++ LV G+A F +++  ++      +  ++I++    +  ++L+ SS +   +++   K   +S +  T  ++LD  LL+    G F    F  ++ + S ++  GH   L +    C  LT +++  IQ  F+++G  +   KE  +                                 L  GR          +  FL++ N+ LWI+  F A+   ++ +    Y+   W+ + +  +P  IF+R HS   L ++
Sbjct:  106 KDSHAGPVWLRTGLVLFGICSVIMDIFKII--FYVGRMNCESPVKIAFPVVQAVFVIVQTYVLWIHAKDCVQIKQNITRCGLMLTLSTNLMVWMMAVTEESLHQTVAPVKPPTNNNSYNDTLDGRAAASECECLHNMCDLFEKAYY----YLYPFNIEYSLFASAMTYVMWKNVGRKMDDHHSH---------------KLHFSLWDVLVGPLAGLIVLVAGLATFVVYEVDVSKDDPKKKEEALIMHYIMNIVAVLLMSSSALAGCILFRMDKREQVSGKNPT--RSLDVGLLVGASLGQFLICYFTIVAVLASGVQ--GHTNGLNL---ACAMLT-VIELCIQNAFLIKGLHREPFKETEVATVFANVMAVKERDPERRSSSIVPAHTLPIPLTLLQGRMSWKRRVLKEICAFLLLCNVTLWIIPAFGARPQFDNTVGPDVYEFQTWAAVVNIGMPFGIFYRMHSVASLFEV 550          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: slc46a2 (solute carrier family 46 member 2 [Source:Xenbase;Acc:XB-GENE-988711])

HSP 1 Score: 81.2629 bits (199), Expect = 2.252e-15
Identity = 115/483 (23.81%), Postives = 205/483 (42.44%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHEL--VEHRNKI---STKSNHS--------ENYSNCSQQLSY---TVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLF-FMVTLVGVAIFFLFKKKIATQS----SSVIVYQLSEIMLLVSSIITL----VWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEG------------SRKG--------------------TTKELHIKLKPGRSLVT---------------FLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKS 1950
            +D     ++LR G V FG   +V D FKI   + +   +C + +      +  ++I +QT+F++   +     H  I R+ L  ++ +N+  W   V  E  H+   +E  +KI   S   +H         E+   CS  L +   T   +L+P  IEYSL ++A+ Y M + VGR+  D       +A   R+    S C    + +F G L    V L GV +  ++K KI        + ++ Y  + + L + S+ +L    ++ F K    + +  T  + LD  LLL    G +  + +  ++ + +    PG    LI  L +  S+  +VQ T+Q  F++EG              KG                    +        KP +S+                 FL++ N+ LW++  F A+   ++ +   +Y    W+IIT+  LP  IF+R H++  L++++  S
Sbjct:  194 KDSHAGPVWLRGGLVFFGICSLVMDVFKIG--YYISYIDCESPIKLIHPMVQSAFIIMQTYFLWVSSKHCVQIHTNISRYGLMLILITNLSIWMAAVTDESVHQTRDLEDDHKIVHSSPAGSHDHKEVGGAHEHTCQCSNHLCHIFQTGYYYLYPFNIEYSLFASAMTYVMWKNVGREMDDQ------VAHHSRL----SLCFY-FKNMFAGFLIGGAVLLCGVVVLVIYKVKINLPDKLYRAHILFYSFNILALALMSLGSLAGSIIYRFDKRHMDAHKNPT--RTLDVTLLLGAALGQYCISYYSIVAMVATS---PG---ELINALNLVYSILMIVQLTLQNTFIIEGLHREPFQDAAPQPEKGLIFANEAVAPSLAHNETPGFSAPAPEFPAKPKQSITEPPWNLKRRMVQEISLFLLLCNIILWLMPAFGARPQLKNNLERNFYGLYVWTIITNICLPFGIFYRMHAAASLLEVFRMS 655          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: ENSXETT00000014404.1 (otopetrin-1 gene 2 [Source:NCBI gene;Acc:100494873])

HSP 1 Score: 75.8702 bits (185), Expect = 8.257e-14
Identity = 100/494 (20.24%), Postives = 193/494 (39.07%), Query Frame = 1
Query:  691 QNAEKLSIMRD---HEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKIST------KSNHSENYSNCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFF--LFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKM---RTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILF-ICKSLTEMVQSTIQVLFVLE---------GSRKGTTKELHIKLKPGRSLVT------------------------------------------------FLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSK 1947
            +N+ K S  ++   H G   +LR G   F       D  K+   + +    C           H  +   Q +F++ + + +   +K + RF L + V +N+  W   V  E  H+L EH  ++S+        +      NC+  + +  S    +++P  IEY ++++A+ Y + + +G   + H  R+++   G  I            G  +GL+    T+  V I+   + + K +++S+  I Y  S I+L   S+ + V+  I     +  +++  +    LD +LL+   S         +I+   + + L      LI   F +  S+  ++Q  +Q +F+++          S      E+ I + P  ++VT                                                FL + N++LWI   F  +   ++ +    Y  +PW I+    LP  IF+R HS   L D++ K
Sbjct:   83 RNSTKKSGQKEKDLHAGAR-WLRCGISFFALTTTAMDALKLG--YFIGYRACMPLTEGVYPVAHFIHTLFQVYFLWFHSQDVIKSYKTLERFGLIHSVFTNLLLWASAVATESKHQLAEHMGRLSSLGFVNISVDEITPLCNCTTNVCHEFSKGIYYIYPFNIEYHILASAMLYVLWKNIGNHIKHHGSRKRFKLHGVAI------------GTILGLIVLAATIGAVFIYIVRIGRSKTSSESALTIYYWYSIIVLFAMSLAS-VFGLILYKLEKKPTYQAFSPSIKLDASLLVGAASAS-------WITAWGAILALTFSGSRLIYTWFNLPYSVLVIIQKYVQNIFIIDYLYCENEHTDSITLDNIEIPIPILPSEAMVTENHTAMEAFPEEVKEEKDGNIFLNDKATIHKIRDSPSFRKALLKNLTVFLFLCNVSLWIPPAFGCRPQYDNGLEALVYGFSPWIILVDIALPFSIFYRMHSVYSLFDVYCK 553          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: ENSXETT00000044569.1 (otopetrin-3-like [Source:NCBI gene;Acc:101731580])

HSP 1 Score: 73.9442 bits (180), Expect = 3.236e-13
Identity = 108/447 (24.16%), Postives = 186/447 (41.61%), Query Frame = 1
Query:  712 IMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVG-LLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLS-EIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKP-----------------------GRSLVT---------FLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIW 1941
            I+RDH    L+L+     FG   ++   FKI   + +   NC   +     C+ + ++ +QT  ++   +        I R+ +   +T+N+  W   V   I+  L   R+  S +SN ++     +  L +T       ++P  +EYSLI A+I Y M + VGRK + H               K S      RG+  G LL     LVG++IF  ++     Q+S  +V  LS ++    S  +T   +               ++LD  LLL    G F  + F  I+ + +      + +  +  L +  SL  ++Q   Q +F++EG + G  ++ H+  +P                       GR  V+         FLI+ N+  WI+  F A     + +   +Y  T W  I +  LPL +F+R HS   LM+++
Sbjct:   97 ILRDHHTGALWLKASLALFGLCSVLLSIFKIG--YVILTLNCKLPMNIIFSCVEIVFVSIQTILLWVCCKDCIQVQHNITRYGIMLTLTTNMLLWLLAV---IDDSL--ERDLESLQSNITQACECPTHSLCWTFKKGFVTMYPFNLEYSLICASILYIMWKNVGRKEQPH--------------PKTSLPRFRLRGVVYGPLLGGAALLVGISIFVQYQ----VQASVGLVPFLSFQVYYAQSHNLTGDISNPHKTHHGSASKNYARSLDVTLLLASAVGQFCISYFSIIAIVVT------NAWDSLNALSLSNSLLLVLQCLSQTMFIIEGMQGGHEEQKHLAAQPQETSRRMSMLEIRRASLAYLQDAGRLSVSRRVVKETAMFLILCNIMCWIMGAFGAHPLYMNGLERHFYGSTIWLAILNIGLPLSVFYRMHSVGSLMEVY 512          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: ENSXETT00000044547.1 (otopetrin 2 [Source:NCBI gene;Acc:100496174])

HSP 1 Score: 73.1738 bits (178), Expect = 6.657e-13
Identity = 85/348 (24.43%), Postives = 158/348 (45.40%), Query Frame = 1
Query:  715 MRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYE---INHELVEHRN-----KISTKSNHSENYS-NCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFM-VTLVGVAIFFLFKKKI---ATQSSSVIVYQLSEI-----MLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEG 1695
            ++D     ++LR G V FG   +V D  KI     L   +C + +      +   ++ +QT+F++   +     H  + R  L   +++N+  W   V  E   + HEL    N      +  ++   E++   C+  +  T      +L+P  IEYSL ++A+ Y M + VGR    H +  ++         K+       R LFVGL+  + V + G+ +F ++K ++    T+S ++ ++ +  I     M +VS   T+++ F K    + +  T  + LD  LLL    G +  + F  ++ +      PG Q   +I++    +L  +VQ TIQ  F++EG
Sbjct:  124 LKDSHAGPIWLRGGLVLFGVCTLVLDVMKIGKSVTLI--HCESPVKIVHPVIQGVFVVIQTYFLWVSCKDCAQIHMNLTRCGLMITLSTNLAVWMAAVTDESLHLTHELNMDVNYTVSATVGPRAAGGESHGCECATHVCKTFQNGYYYLYPFNIEYSLFASAMSYVMWKNVGRVMSGHHHHTQH---------KFKT-----RNLFVGLICGIGVFVAGLGVFIVYKIEVDVEETRSQAITMFYIFNITALSLMSVVSLAGTIIYRFYKRDMDNHKNPT--RTLDVVLLLGAALGQYCISFFSIVAMVA---LQPGGQLHTLILV---NALLLIVQHTIQNTFIIEG 447          
BLAST of Otopetrin vs. Ensembl Xenopus
Match: ENSXETT00000044555.1 (otopetrin 2 [Source:NCBI gene;Acc:100496174])

HSP 1 Score: 72.4034 bits (176), Expect = 1.122e-12
Identity = 85/348 (24.43%), Postives = 158/348 (45.40%), Query Frame = 1
Query:  715 MRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYE---INHELVEHRN-----KISTKSNHSENYS-NCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFM-VTLVGVAIFFLFKKKI---ATQSSSVIVYQLSEI-----MLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEG 1695
            ++D     ++LR G V FG   +V D  KI     L   +C + +      +   ++ +QT+F++   +     H  + R  L   +++N+  W   V  E   + HEL    N      +  ++   E++   C+  +  T      +L+P  IEYSL ++A+ Y M + VGR    H +  ++         K+       R LFVGL+  + V + G+ +F ++K ++    T+S ++ ++ +  I     M +VS   T+++ F K    + +  T  + LD  LLL    G +  + F  ++ +      PG Q   +I++    +L  +VQ TIQ  F++EG
Sbjct:   86 LKDSHAGPIWLRGGLVLFGVCTLVLDVMKIGKSVTLI--HCESPVKIVHPVIQGVFVVIQTYFLWVSCKDCAQIHMNLTRCGLMITLSTNLAVWMAAVTDESLHLTHELNMDVNYTVSATVGPRAAGGESHGCECATHVCKTFQNGYYYLYPFNIEYSLFASAMSYVMWKNVGRVMSGHHHHTQH---------KFKT-----RNLFVGLICGIGVFVAGLGVFIVYKIEVDVEETRSQAITMFYIFNITALSLMSVVSLAGTIIYRFYKRDMDNHKNPT--RTLDVVLLLGAALGQYCISFFSIVAMVA---LQPGGQLHTLILV---NALLLIVQHTIQNTFIIEG 409          
BLAST of Otopetrin vs. Ensembl Mouse
Match: Otop1 (otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363])

HSP 1 Score: 59.6918 bits (143), Expect = 8.783e-9
Identity = 61/295 (20.68%), Postives = 141/295 (47.80%), Query Frame = 1
Query:  871 HLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKS---------NHSENYSNCS-----QQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIV----YQLSEIMLLVSSIITLVWAF-IKMRTLSFRQLTEEQALDDNLLLIGLSG--VFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLE 1692
            H  +  +Q +F++ + + I +  K + RF + + V +N+  W  +V+ E  H+L EH+ ++ T           +H+    NC+       LS+ +  +L+P  IEY ++++ + Y + + +GR+  D S  +K   + + ++           G  +GL     T+  V ++ +   +  ++S S ++    Y ++ ++L+ ++ +   W + +  ++L   +    + LD +LL+   SG  + S+   L I+  ++  R P   Y+L   + +      +V+  +Q +F++E
Sbjct:  171 HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLGFGNITIVLDDHTPQ-CNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGRR-VDSSQHQKMQCRFDGVLV----------GSVLGLTVLAATIAVVVVYMIHIGRSKSKSESALIMFYLYAITVLLLMGAAGLVGSWIYRVDEKSLDESK-NPARKLDVDLLVATGSGSWLLSWGSILAIACAET--RPPYTWYNLPYSVLV------IVEKYVQNIFIIE 443          
BLAST of Otopetrin vs. Ensembl Mouse
Match: Otop1 (otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363])

HSP 1 Score: 59.3066 bits (142), Expect = 1.143e-8
Identity = 61/295 (20.68%), Postives = 141/295 (47.80%), Query Frame = 1
Query:  871 HLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKS---------NHSENYSNCS-----QQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIV----YQLSEIMLLVSSIITLVWAF-IKMRTLSFRQLTEEQALDDNLLLIGLSG--VFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLE 1692
            H  +  +Q +F++ + + I +  K + RF + + V +N+  W  +V+ E  H+L EH+ ++ T           +H+    NC+       LS+ +  +L+P  IEY ++++ + Y + + +GR+  D S  +K   + + ++           G  +GL     T+  V ++ +   +  ++S S ++    Y ++ ++L+ ++ +   W + +  ++L   +    + LD +LL+   SG  + S+   L I+  ++  R P   Y+L   + +      +V+  +Q +F++E
Sbjct:  168 HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLGFGNITIVLDDHTPQ-CNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGRR-VDSSQHQKMQCRFDGVLV----------GSVLGLTVLAATIAVVVVYMIHIGRSKSKSESALIMFYLYAITVLLLMGAAGLVGSWIYRVDEKSLDESK-NPARKLDVDLLVATGSGSWLLSWGSILAIACAET--RPPYTWYNLPYSVLV------IVEKYVQNIFIIE 440          
BLAST of Otopetrin vs. Ensembl Mouse
Match: Otop2 (otopetrin 2 [Source:MGI Symbol;Acc:MGI:2388365])

HSP 1 Score: 58.151 bits (139), Expect = 2.356e-8
Identity = 99/492 (20.12%), Postives = 185/492 (37.60%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHEL----VEHRNKISTKSNHS---------ENYSNCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFF-------MVTLVGVAIFFLFKKKIA-----TQSSSVIVYQLSEIMLLVSSIITLVWAFI---KMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSL--VTF-----------------LIIINLA----------------------------------LWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIW 1941
            RD     ++LR G V FG   +V D FK    +      C + +      +   ++ VQT+F++   +     H  + R  L   + +N+  W   VV E  H+       H N   T+ N           E+   CS  +         +L+P  IEYSL ++ + Y M + VGR                 + + +   H   R       FF       ++ +VG+A+F L++ +++     T+ + VI Y  + + L + ++++L  + I     R +   +    + LD  LL+    G ++ + +  ++ +       G    L   L +  +L  + Q T Q +F++E   +G       ++ P      +TF                 L+I NL                                   LWI+  F A+    + +   +Y  + W+ I +  LP  IF+R H+   L++++
Sbjct:   94 RDAHAGPIWLRGGLVLFGICTLVMDVFKTG--YYSSFFECQSAIKILHPIIQAVFVIVQTYFLWISAKDCIHTHLDLTRCGLMFTLATNLAIWMAAVVDESVHQAHSYSGSHGNTSHTRLNPDSKRAGGAAEEDPCLCSTAICQIFQQGYFYLYPFNIEYSLFASTMLYVMWKNVGRL----------------LASTHGHGHTPSRVSLFRETFFAGPVLGLLLFVVGLAVFILYEVQVSGERGHTRQALVIYYSFNIVCLGLMTLVSLSGSVIYRFDRRAMDHHK-NPTRTLDVALLMGAALGQYAISYYSIVAVVV------GSPRDLQGALNLSHALLMIAQHTFQNVFIIESLHRGPPGAEPREMPPKEPCQGITFANLDAIRTLPSCPPTPRLVIPNLESPQEAVAIISAPRCHWRRRCLKDISLFLLLCNVILWIMPAFGARPHFSNTVEVDFYGYSLWAAIVNICLPFGIFYRMHAVSSLLEVY 560          
BLAST of Otopetrin vs. Ensembl Mouse
Match: Otop2 (otopetrin 2 [Source:MGI Symbol;Acc:MGI:2388365])

HSP 1 Score: 58.151 bits (139), Expect = 2.356e-8
Identity = 99/492 (20.12%), Postives = 185/492 (37.60%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHEL----VEHRNKISTKSNHS---------ENYSNCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFF-------MVTLVGVAIFFLFKKKIA-----TQSSSVIVYQLSEIMLLVSSIITLVWAFI---KMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSL--VTF-----------------LIIINLA----------------------------------LWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIW 1941
            RD     ++LR G V FG   +V D FK    +      C + +      +   ++ VQT+F++   +     H  + R  L   + +N+  W   VV E  H+       H N   T+ N           E+   CS  +         +L+P  IEYSL ++ + Y M + VGR                 + + +   H   R       FF       ++ +VG+A+F L++ +++     T+ + VI Y  + + L + ++++L  + I     R +   +    + LD  LL+    G ++ + +  ++ +       G    L   L +  +L  + Q T Q +F++E   +G       ++ P      +TF                 L+I NL                                   LWI+  F A+    + +   +Y  + W+ I +  LP  IF+R H+   L++++
Sbjct:   94 RDAHAGPIWLRGGLVLFGICTLVMDVFKTG--YYSSFFECQSAIKILHPIIQAVFVIVQTYFLWISAKDCIHTHLDLTRCGLMFTLATNLAIWMAAVVDESVHQAHSYSGSHGNTSHTRLNPDSKRAGGAAEEDPCLCSTAICQIFQQGYFYLYPFNIEYSLFASTMLYVMWKNVGRL----------------LASTHGHGHTPSRVSLFRETFFAGPVLGLLLFVVGLAVFILYEVQVSGERGHTRQALVIYYSFNIVCLGLMTLVSLSGSVIYRFDRRAMDHHK-NPTRTLDVALLMGAALGQYAISYYSIVAVVV------GSPRDLQGALNLSHALLMIAQHTFQNVFIIESLHRGPPGAEPREMPPKEPCQGITFANLDAIRTLPSCPPTPRLVIPNLESPQEAVAIISAPRCHWRRRCLKDISLFLLLCNVILWIMPAFGARPHFSNTVEVDFYGYSLWAAIVNICLPFGIFYRMHAVSSLLEVY 560          
BLAST of Otopetrin vs. Ensembl Mouse
Match: Otop3 (otopetrin 3 [Source:MGI Symbol;Acc:MGI:1916852])

HSP 1 Score: 53.9138 bits (128), Expect = 5.937e-7
Identity = 99/480 (20.62%), Postives = 188/480 (39.17%), Query Frame = 1
Query:  679 SIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSP-------FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFK-----KKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQL----TEEQALDDNLLL---IGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEG----------------------SRKGTTKELHIKLKPG------------------RSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIW 1941
            ++ +       + RD     +++R   V FG   +  + F++   + +   +C +E+      + + ++ +QT+ ++++ +          R  L   + +N+  W   V  +  H  +E     +     S N +N    L+ TV          L+P + EY LI  A+ + M + V R    H+      A   R         R H  +F  LL  +  + GV +F LF+       IA Q  + + Y     +L   S+  L  A   +  L  R+L       ++LD  LL+   +G  G+  +++   ++T           + L+  L +  SL  ++Q   Q LF++EG                       R+G+ +EL   L+                    + +  FLI+ N+ LW++  F      E+ +   +Y    W  I +  LPL +F+R HS   L++++
Sbjct:  121 TVGTTRKPHAVLYRDPHAGPIWVRGSLVLFGSCTVCLNIFRMG--YDVSHIHCKSEVELIFPAIEIVFMIIQTWVLWRHCKDCVQVQTNFTRCGLMLTLATNLLMWVLAVTNDSMHREIEAELD-ALMEKFSGNGTNTCMCLNTTVCEVFRKGYLMLYPFSTEYCLICCAVLFVMWKNVSRSLAAHTG-----AHPNR------SPFRLHGTIFGPLLGLLALVAGVCVFVLFQIEASGPDIARQYFT-LYYAFYVAVLPTMSLACL--AGTAIHGLEERELDTLKNPTRSLDVVLLMGAALGQMGIAYFSIVAIVAT---------QPHELLNQLILAYSLLLILQHITQNLFIIEGLHRRPLWEPAVSGVMEKQDVELPRRGSLRELGQDLRRASRAYIHSFSHLNWKRRMLKEISLFLILCNITLWMMPAFGIHPEFENGLEKDFYGYRTWFTIVNFGLPLGVFYRMHSVGGLVEVY 574          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|B7Z0W9|OTOP_DROME (Proton channel OtopLc OS=Drosophila melanogaster OX=7227 GN=OtopLc PE=3 SV=2)

HSP 1 Score: 244.202 bits (622), Expect = 2.123e-67
Identity = 147/457 (32.17%), Postives = 239/457 (52.30%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGEN-CHNELWTPKHCLHLSYIFVQTFFIF-KYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELV-----EHRN-KISTK-SNHSENYS----------------------------NCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQG-ERIIAKYS-ECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTL---SFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSL--IIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            RD    + YLR+GAV FG G M++ G +    F L  +  CHN L        +++IF+Q +FIF    +I   ++K I RF L +++ +N+  W   ++ E  HE++     E+R  +IS +   HS  ++                            N    L    SPFLFPC IEYSLI AAI Y M + + R       R   I+   +R    YS +C R+H+GLFVG+L  ++T++ + IFF+   +    + +V    + E+++  ++ I  +   I++R L   ++R  +    LDD LL+   +G F YN+F  I+         GH ++L    +L    +L  +VQ+  Q +F+L+ SR+      H++ KPGR +VTF++++NLA+W +S  E  R++ H I   +Y    W+IITH  +PL IF+RFHS++CL +IW ++Y+
Sbjct: 1007 RDAHYGSFYLRMGAVAFGIGSMIYSGLEFGQYFELNPDTKCHNVLLALTPATRMAFIFIQMYFIFLNNEQIKVYRYKIIARFGLMHMIGTNLAVWLNVLIQETKHEILTFYNPENRTLRISHRIPGHSRGHAIIQHDPTAHLRVPRGLKGPYQIFECRRTNIIGTLVQDASPFLFPCTIEYSLICAAILYVMWRSISRPQTPTPQRPDMISSPMKRSPHHYSVDCARAHKGLFVGILILVLTIISLIIFFVLISRPEFVAMAVTEVTICELLIYGTATIATLVGMIQIRHLQYDAYRSFS----LDDILLVGAQTGSFLYNIFTVIA---------GH-FTLRSDDMLVPINALASIVQTACQTMFILDASRRQAVSPEHLRKKPGREIVTFMLVVNLAMWAISTLEKSRAESHPIQLNFYGLWAWTIITHVSMPLAIFYRFHSTVCLCEIWKRAYK 1449          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|Q7M734|OTOP1_RAT (Proton channel OTOP1 OS=Rattus norvegicus OX=10116 GN=Otop1 PE=2 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.403e-8
Identity = 61/295 (20.68%), Postives = 141/295 (47.80%), Query Frame = 1
Query:  871 HLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKS---------NHSENYSNCSQQ-----LSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIV----YQLSEIMLLVSSIITLVWAF-IKMRTLSFRQLTEEQALDDNLLLIGLSG--VFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLE 1692
            H  +  +Q +F++ + + I +  K + RF + + V +N+  W  +V+ E  H+L EH+ ++ T           +H+    NC+       LS+ +  +L+P  IEY ++++ + Y + + +GR+  D S  +K   + + ++           G  +GL     T+  V ++ +   +  ++S S ++    Y ++ ++L+ ++ +   W + +  ++L   +    + LD +LL+   SG  + S+   L I+  ++  R P   Y+L   + +      +V+  +Q +F++E
Sbjct:  171 HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLGFGNITIVLDDHTPQ-CNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGRR-VDSSRHQKMQCRFDGVLV----------GSVLGLTVLAATIAVVVVYMIHIGRSKSKSESALIMFYLYAITVLLLMGAAGLVGSWIYRVDEKSLDESK-NPARKLDADLLVATASGSWLLSWGSILAIACAET--RPPYTWYNLPYSVLV------IVEKYVQNIFIIE 443          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|Q7RTM1|OTOP1_HUMAN (Proton channel OTOP1 OS=Homo sapiens OX=9606 GN=OTOP1 PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.345e-8
Identity = 63/296 (21.28%), Postives = 137/296 (46.28%), Query Frame = 1
Query:  871 HLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKS---------NHSENYSNCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYRE-KYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIV----YQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQ----ALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGH-QYSLIIILFICKSLTEMVQSTIQVLFVLE 1692
            H  +  +Q +F++ + + I    K + RF + + V +N+  W   V+ E  H+L EH+ ++ T           +H+   +     L   +S    +L+P  IEY ++++ + Y + + +GRK   H +++ ++ + G  +            G  +GL     T+  V ++ +   +  T+S S ++    Y ++ +ML+ ++ +    A I++  +  + L E +     LD +LL+    G  S +  +   +I + +   GH +Y+   + +   S+  +V+  IQ LF+ E
Sbjct:  173 HSVHTLLQVYFLWGHAKDIIQSFKTLERFGVIHSVFTNLLLWANGVLNESKHQLNEHKERLITLGFGNITTVLDDHTPQCNCTPPTLCTAISHGIYYLYPFNIEYQILASTMLYVLWKNIGRKVDSHQHQKMQFKSDGVMV------------GAVLGLTVLAATIAVVVVYLIHIGRSKTKSESALIMFYLYAITLLMLMGAAGL----AGIRIYRIDEKSLDESKNPARKLDSDLLV----GTASGSWLISWGSILAILCAEGHPRYTWYNLPY---SILAIVEKYIQNLFIFE 445          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|Q80VM9|OTOP1_MOUSE (Proton channel OTOP1 OS=Mus musculus OX=10090 GN=Otop1 PE=1 SV=3)

HSP 1 Score: 59.6918 bits (143), Expect = 6.143e-8
Identity = 61/295 (20.68%), Postives = 141/295 (47.80%), Query Frame = 1
Query:  871 HLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKS---------NHSENYSNCS-----QQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIV----YQLSEIMLLVSSIITLVWAF-IKMRTLSFRQLTEEQALDDNLLLIGLSG--VFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLE 1692
            H  +  +Q +F++ + + I +  K + RF + + V +N+  W  +V+ E  H+L EH+ ++ T           +H+    NC+       LS+ +  +L+P  IEY ++++ + Y + + +GR+  D S  +K   + + ++           G  +GL     T+  V ++ +   +  ++S S ++    Y ++ ++L+ ++ +   W + +  ++L   +    + LD +LL+   SG  + S+   L I+  ++  R P   Y+L   + +      +V+  +Q +F++E
Sbjct:  171 HAVHTLLQVYFLWGHAKDIIMSFKTLERFGVIHSVFTNLLLWANSVLNESKHQLNEHKERLITLGFGNITIVLDDHTPQ-CNCTPPALCSALSHGIY-YLYPFNIEYQILASTMLYVLWKNIGRR-VDSSQHQKMQCRFDGVLV----------GSVLGLTVLAATIAVVVVYMIHIGRSKSKSESALIMFYLYAITVLLLMGAAGLVGSWIYRVDEKSLDESK-NPARKLDVDLLVATGSGSWLLSWGSILAIACAET--RPPYTWYNLPYSVLV------IVEKYVQNIFIIE 443          
BLAST of Otopetrin vs. UniProt/SwissProt
Match: sp|Q7RTS6|OTOP2_HUMAN (Proton channel OTOP2 OS=Homo sapiens OX=9606 GN=OTOP2 PE=1 SV=3)

HSP 1 Score: 58.151 bits (139), Expect = 1.632e-7
Identity = 96/488 (19.67%), Postives = 190/488 (38.93%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKIST-------KSNHSENYSNCSQQLSYTVSP--------FLFPCAIEYSLISAAIFYKMLQKVGR---KHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVG-LLFFMVTLVGVAIFFLFKKKIA-----TQSSSVIVYQLSEIMLLVSSIITLVWAFI---KMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTT---------------------KELHI--KLKPGRSLVT------------------------------FLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIW 1941
            RD     ++LR G V FG   ++ D FK    +      C + +      +   ++ +QT+F++   +     H  +    L   +T+N+  W   VV E  H+   + +  S           H++N       L  T           +L+P  IEYSL ++ + Y M + VGR       HS+    ++                   F G +L  ++ +VG+A+F +++ +++     T+ + VI Y  + + L ++++++L  + I     R +   +    + LD  LL+    G ++ + +  ++ +       G    L+  L +  +L  + Q T Q +F++E   +G                         LH      P   LV+                              FL++ N+ LWI+  F A+    + +   +Y  + W++I +  LP  IF+R H+   L++++
Sbjct:   94 RDAHAGPIWLRGGLVLFGICTLIMDVFKTG--YYSSFFECQSAIKILHPLIQAVFVIIQTYFLWVSAKDCVHVHLDLTWCGLMFTLTTNLAIWMAAVVDESVHQSHSYSSSHSNASHARLISDQHADNPVGGDSCLCSTAVCQIFQQGYFYLYPFNIEYSLFASTMLYVMWKNVGRFLASTPGHSHTPTPVSLFRET-------------FFAGPVLGLLLFVVGLAVFIIYEVQVSGDGSRTRQALVIYYSFNIVCLGLTTLVSLSGSIIYRFDRRAMDHHK-NPTRTLDVALLMGAALGQYAISYYSIVAVVA------GTPQDLLAGLNLTHALLMIAQHTFQNMFIIESLHRGPPGAEPHSTHPKEPCQDLTFTNLDALHTLSACPPNPGLVSPSPSDQREAVAIVSTPRSQWRRQCLKDISLFLLLCNVILWIMPAFGARPHFSNTVEVDFYGYSLWAVIVNICLPFGIFYRMHAVSSLLEVY 559          
BLAST of Otopetrin vs. TrEMBL
Match: A0A074Z2Q4 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_15458 PE=4 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 4.940e-124
Identity = 220/541 (40.67%), Postives = 321/541 (59.33%), Query Frame = 1
Query:  442 QNIKQEIENGILDEKKKKKSVDVIAEDKLDISE--SPKVTFDLKAEVQNHQRSNEISITSMQEDDIFLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKF--RLEGEN-CHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEIN-------------------HELVE------------HRNKISTKSNHSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            QN+ +  ++  L+ ++  +S + IA+D         P+V  + K     + R    S+  +Q   +F    + S P     S            RD EG+NLYLRLGAVGFGFGVM+ DGFKIA+ +  RL  ++ CHN  W P H LH  Y+F QT+F+FK+H+++F   K ++RF+L +L  +N+CQW KTVV EI+                   HEL              H       + HS +  +  +  +  ++PFLFPCAIEYSLI+ A+FYKM QKVG   R  S R + I Q   +   ++ECHRSH+GLF+GLL FMVTLV + +FF+F  ++  +++++ +YQ +E++LL  S++T V+  I++R L    L+EE A DDNLLL+GL G+  Y+LFL +  +++   +P  +  +   LF  K+L E+ QS +QV F+LEGSR+      H+  KPGR+L+TFL+I+NLA+W V+ FE KR+D H I   YY    W IITH  LP+I+FFRFHS++CL DIW+ +YR
Sbjct:  234 QNVIKGDKSQALEVEQGARSDNSIADDDSTCEHLHVPEVPSNSKIPTVRNFRQKLSSVLPLQV--LFGDDPQKSRPPGWYFS------------RDTEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEARLNDQDSCHNHFWIPIHILHFIYVFWQTYFLFKHHQVVFNVQKFVLRFLLCHLAVANLCQWLKTVVDEISVEPHETTTSTLPLTLHETTHELKNLSLLQTSSVSTVHTTTDPHMATHSRSIGHGCRSTAKYLAPFLFPCAIEYSLIAGAMFYKMFQKVGHV-RQESERLERIRQANNVSGHFAECHRSHKGLFIGLLLFMVTLVSMCLFFIFFTRLDKRNTAITLYQCTELVLLGLSMLTCVFTMIRLRVLHLSNLSEEGAFDDNLLLVGLVGMIFYDLFLLVPALEA---IPSGK--IAAKLFAAKALMEIAQSMVQVFFILEGSRRCAGSVAHVHNKPGRTLITFLLILNLAMWFVNTFEVKRADNHSIHIDYYTGMAWKIITHISLPMIVFFRFHSTVCLSDIWANAYR 754          
BLAST of Otopetrin vs. TrEMBL
Match: A0A4S2LBS8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008757 PE=4 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 1.111e-123
Identity = 201/447 (44.97%), Postives = 286/447 (63.98%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRL---EGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEIN---------------HELVEHRNKISTKSN----------------HSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            RD EG+NLYLRLGAVGFGFGVM+ DGFKIA+ +     + E+CHN  W P H LH  Y+F QT+F+FK+H+++F   K ++RF+L +L  +N+CQW KTVV EI+               HE   +   +S                    HS +  +  +  +  ++PFLFPCAIEYSLI+ A+FYKM QKVG   R  S R + I Q   +   ++ECHRSH+GLF+GLL FMVTLV + +FF+F  ++  +++++ +YQ +E++LL  S++T V+  I++R L    L+EE A DDNLLL+GL G+  Y+LFL +  +++   +P  +  +   LF  K+L E+ QS +QV F+LEGSR+      H+  KPGR+L+TFL+I+NLA+W V+ FE KR+D H I   YY    W IITH  LP+I+FFRFHS++CL DIW+ +YR
Sbjct:  312 RDTEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEARLNDQESCHNHFWIPIHILHFIYVFWQTYFLFKHHQVVFNVQKFVLRFLLCHLAVANLCQWLKTVVDEISVEPHETTTSTLPLTLHETTHNLKNLSLPQTSSMSTVHTTTDPHMITHSRSSGHGCRSTAKYLAPFLFPCAIEYSLIAGAMFYKMFQKVGHV-RQESERLERIRQANNVSGHFAECHRSHKGLFIGLLLFMVTLVSMCLFFIFFTRLDKRNTAITLYQCTELVLLGLSMLTCVFTMIRLRVLHLSNLSEEGAFDDNLLLVGLVGMIFYDLFLLVPALEA---IPSGK--IAAKLFAAKALMEIAQSMVQVFFILEGSRRCAGSVAHVHNKPGRTLITFLLILNLAMWFVNTFEVKRADNHSIHIDYYTGMAWKIITHISLPMIVFFRFHSTVCLSDIWANAYR 752          
BLAST of Otopetrin vs. TrEMBL
Match: G7YVK5 (Otopetrin OS=Clonorchis sinensis OX=79923 GN=CLF_111941 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 1.547e-123
Identity = 201/447 (44.97%), Postives = 285/447 (63.76%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRL---EGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEIN-------------------HELVE------------HRNKISTKSNHSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            RD EG+NLYLRLGAVGFGFGVM+ DGFKIA+ +     + E+CHN  W P H LH  Y+F QT+F+FK+H+++F   K ++RF+L +L  +N+CQW KTVV EI+                   H+L              H         HS +  +  +  +  ++PFLFPCAIEYSLI+ A+FYKM QKVG   R  S R + I Q   +   ++ECHRSH+GLF+GLL FMVTLV + +FF+F  ++  +++++ +YQ +E++LL  S++T V+  I++R L    L+EE A DDNLLL+GL G+  Y+LFL +  +++   +P  +  +   LF  K+L E+ QS +QV F+LEGSR+      H+  KPGR+L+TFL+I+NLA+W V+ FE KR+D H I   YY    W IITH  LP+I+FFRFHS++CL DIW+ +YR
Sbjct:  312 RDTEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEARLNDQESCHNHFWIPIHILHFIYVFWQTYFLFKHHQVVFNVQKFVLRFLLCHLAVANLCQWLKTVVDEISVEPHEATTSTLPLTLHQATHDLTNLSLPQTSSVSIVHTTMDPHMVTHSRSIGHGCRSTAKYLAPFLFPCAIEYSLIAGAMFYKMFQKVGHV-RQESERLERIRQANNVSGHFAECHRSHKGLFIGLLLFMVTLVSMCLFFIFFTRLDKRNTAITLYQCTELVLLGLSMLTCVFTMIRLRVLHLSNLSEEGAFDDNLLLVGLVGMIFYDLFLLVPALEA---IPSGK--IAAKLFAAKALMEIAQSMVQVFFILEGSRRCAGSVAHVHNKPGRTLITFLLILNLAMWFVNTFEVKRADNHSIHIDYYTGMAWKIITHISLPMIVFFRFHSTVCLSDIWANAYR 752          
BLAST of Otopetrin vs. TrEMBL
Match: A0A4S2LI03 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008757 PE=4 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 9.110e-123
Identity = 201/447 (44.97%), Postives = 286/447 (63.98%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRL---EGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEIN---------------HELVEHRNKISTKSN----------------HSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            RD EG+NLYLRLGAVGFGFGVM+ DGFKIA+ +     + E+CHN  W P H LH  Y+F QT+F+FK+H+++F   K ++RF+L +L  +N+CQW KTVV EI+               HE   +   +S                    HS +  +  +  +  ++PFLFPCAIEYSLI+ A+FYKM QKVG   R  S R + I Q   +   ++ECHRSH+GLF+GLL FMVTLV + +FF+F  ++  +++++ +YQ +E++LL  S++T V+  I++R L    L+EE A DDNLLL+GL G+  Y+LFL +  +++   +P  +  +   LF  K+L E+ QS +QV F+LEGSR+      H+  KPGR+L+TFL+I+NLA+W V+ FE KR+D H I   YY    W IITH  LP+I+FFRFHS++CL DIW+ +YR
Sbjct:  391 RDTEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEARLNDQESCHNHFWIPIHILHFIYVFWQTYFLFKHHQVVFNVQKFVLRFLLCHLAVANLCQWLKTVVDEISVEPHETTTSTLPLTLHETTHNLKNLSLPQTSSMSTVHTTTDPHMITHSRSSGHGCRSTAKYLAPFLFPCAIEYSLIAGAMFYKMFQKVGHV-RQESERLERIRQANNVSGHFAECHRSHKGLFIGLLLFMVTLVSMCLFFIFFTRLDKRNTAITLYQCTELVLLGLSMLTCVFTMIRLRVLHLSNLSEEGAFDDNLLLVGLVGMIFYDLFLLVPALEA---IPSGK--IAAKLFAAKALMEIAQSMVQVFFILEGSRRCAGSVAHVHNKPGRTLITFLLILNLAMWFVNTFEVKRADNHSIHIDYYTGMAWKIITHISLPMIVFFRFHSTVCLSDIWANAYR 831          

HSP 2 Score: 62.3882 bits (150), Expect = 3.113e-6
Identity = 38/96 (39.58%), Postives = 51/96 (53.12%), Query Frame = 1
Query:  151 KRKHGYKKNRRHNVAFADFAIPDTRASIRVSCTLLFAMCQLFCGIVIPLSDSFVTISDSRMGHA-YYLEAFLIIQYFSAILFVFYLQGYIFMCERR 435
            KR   + + RR +VA AD+ I DTR S   S  LLFA+ +  CG  +P+   F   S     H  YY E FL  QY  +IL + YLQ  IF  +++
Sbjct:   52 KRTKQHPEYRRPSVALADYEISDTRTSAMSSLLLLFAILEGMCGFALPICSVF---SKPAGPHGRYYYENFLFFQYGLSILALCYLQALIFYYDQK 144          
BLAST of Otopetrin vs. TrEMBL
Match: A0A504YZQ1 (Otopetrin (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_06924 PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 1.590e-122
Identity = 202/467 (43.25%), Postives = 283/467 (60.60%), Query Frame = 1
Query:  718 RDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLE---GENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEIN----HELVEHRNKISTKS-------------------------------------NH----------SENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            RD EG+NLYLRLGAVGFGFGVM+ DGFKIA+ +  +      CH+ LW P H LH  Y+F QT+F+FK+H+++F   K  +RF+L +L  +N+CQW KT+V EI+    HE   H N   T+                                      NH          S ++ +C     Y ++PFLFPCAIEYSLI+ AIFYKM QKVG   R+ S R   + +   +  +++ECHRSH+GLF+GLL FM TLV + +FF+F  K   +++++ +YQ +E++LL  S+ T V   I+ R L   +L+EE A DDNLLL+GL G+  Y+LFL +  I++      +   ++  LF  K+L E+VQS +QV F+LE SR+      H++ KPGR+L+TFL+I+NLA+W V+ FE KR+D   I   YY    W IITH  LP+I+FFRFHS++CL DIW+ +YR
Sbjct:  305 RDSEGVNLYLRLGAVGFGFGVMIFDGFKIAEPWEADITGAGPCHSTLWIPIHVLHFVYVFWQTYFLFKHHQVVFNVQKFALRFLLCHLAVANLCQWLKTIVDEISNEPAHESPTHVNTSDTREDRVDLLWEAFSHSITRRDGSLNVSSDEIYGTYSTERLNHTVPHTVGVEISSHFGSCRSTAKY-LAPFLFPCAIEYSLIAGAIFYKMFQKVGHV-REESERLARMRKANTMTRRFAECHRSHKGLFIGLLLFMATLVTMCLFFIFFTKENKKNTAITLYQSTELVLLALSLFTCVAIMIQFRVLKLSELSEEGAFDDNLLLVGLIGMIFYDLFLLVPAIEAI-----NTGMIVARLFAAKALLEIVQSMLQVFFILEASRRCAGSLAHVRNKPGRTLITFLLILNLAMWFVNTFEVKRADNQSIHIDYYTGMAWKIITHIALPMIVFFRFHSTVCLSDIWANAYR 764          
BLAST of Otopetrin vs. Ensembl Cavefish
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:103039885])

HSP 1 Score: 96.2857 bits (238), Expect = 2.059e-20
Identity = 108/482 (22.41%), Postives = 211/482 (43.78%), Query Frame = 1
Query:  697 AEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELV--EHRNKIST----KSNHSENYSNCSQQLSYTVSP-------FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSH-RGLFVGLLFFMVTLV-GVAIFFLFKKKIAT-----QSSSVIVYQLSE-----IMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKEL---------------------HIKLKPGRS------------------LVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKS 1950
             E+  + +D     ++LR G V FG   ++ D FKIA  + +   +C + +      +   +I VQT+F++ + +      + + R  L   + +N+  W   V  E  H+ V  +  N+ S     ++  S+  S+C  Q S+T          +L+P  IEYSL ++A+ Y M + VGR   DH   E                HR H R + +G    +V LV G+A F +++  +++     + +++ +Y ++      +M +V+    +++   +    S +  T  ++LD  LL+    G F+ + F  ++ + + +   GH    +  L +  S+  +++  +Q +F++EG R+    ++                     H+   P  S                  +  FL++ N+ LWI+  F A+   ++ I T++YQ   W  + +  LP  IF+R HS   L +++  S
Sbjct:  134 GEEAVLYKDVHAGPVWLRGGLVLFGVCSLIMDVFKIA--YYVGYTHCQSPVKIVFPVVQAVFILVQTYFLWLHAKDCVQVQRNVTRCGLMLTLATNLMLWMTAVTEESLHQTVYPDGTNQTSRTLLLRAAASDGDSSC--QCSHTSCSIFEQAYYYLYPFNIEYSLFASAMTYVMWRNVGRLVDDHPAHE----------------HRFHLRDVLLGPAGGLVVLVAGLATFVVYEVDVSSGDQEKRDTALTLYYITNTVTIALMTMVTVAGCVIYRLERREHASGKNPT--RSLDMGLLVGSSMGQFTVSYFTVVAVLGTGVD--GH----VNALNLAWSVITLLELCVQNVFIIEGIRREPHHDVRRASIFSNLLALHAQEDRRSSHVPTSPRGSIAIPVHKPLPWKRKILKEIAAFLLLSNIILWIMPAFGARPQFDNPIGTEFYQFNMWVAVVNVGLPFSIFYRMHSVASLFEVYLTS 587          
BLAST of Otopetrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000564.1 (pep scaffold:Pmarinus_7.0:GL476591:206565:219203:-1 gene:ENSPMAG00000000506.1 transcript:ENSPMAT00000000564.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.597e-8
Identity = 86/371 (23.18%), Postives = 153/371 (41.24%), Query Frame = 1
Query:  709 SIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKSNHS-----------ENYSNCSQQLS-----YTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVG----VAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFI--KMRTLSFRQLTEEQALDDNLLLIGLS-GVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEG-SRKGTTKELHIKLK-PGR 1746
            SI  DH     +L+ G   F    ++ D F+I   +     +C +        L   +  +    ++ Y +    + + + R  + + + ++I  WF TV+ E    + EHR  I    N S            N + C+ Q++     Y    FL P  IE+SL S+A+ Y M + +GR    HS  E ++    R+             + +G +F +V L      +    +  +  AT+  ++ +Y L  I++  S  I  V   +  K+     R         D LLLIG S G+F+   F  I+    F   P   +S ++   +  +  ++V+   Q LF++EG  R   T  +H +++ P R
Sbjct:   70 SIPMDHHAGAKWLKGGLALFALATIILDAFRIG--YYTGMTHCESVALAIFPVLQAIFSIILVLLLWVYGKYCVREWQTLHRLGMMHTLATSILIWFNTVIEESIKVIKEHRFSIINMGNGSITIIMKYRHVTYNETECTCQMNFCQMFYDSVLFLDPFNIEFSLFSSAMLYVMWKNMGRIDA-HSVCEPHVKPKMRM-----------DNVLLGPIFGIVVLASTLVVLVTVEVQVRTPATKGQALSMYYLYGIVIYSSMAICGVAGLVIYKLGNSGLRNDKNVVRNLDVLLLIGSSIGLFTSAYFSVIAA--GFSLSPETNFSTLV---MAAAFCKIVELISQNLFIIEGLHRSPRTVLVHDQVRNPSR 421          
BLAST of Otopetrin vs. Ensembl Nematostella
Match: EDO48113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK62])

HSP 1 Score: 89.3521 bits (220), Expect = 1.155e-18
Identity = 125/480 (26.04%), Postives = 192/480 (40.00%), Query Frame = 1
Query:  745 LRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPK---HCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKI----STKSNHSENYSNCSQQLSYTVS-------PFLFPCAIEYSLISAAIFYKML------------------------------QKVGRKHRDHSY---------REKYIAQG-------ERIIAKYSECH--------------RSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTE-EQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIV-SIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYR 1956
            L  GA  FG G  V D   IA  F +E   C + L  P          +IF Q  F+ K+     L   P +R +L++++ +N+C WF+         L  H   I     T +  S   + C   L Y++S       P+L+P  +EYSLI+  I Y M                               +++ +   DH Y         R+   +          R ++  S C                S  GL VGLLF  + L+ V + ++ K+     S+++  Y L +I LL    I+    ++ ++ L  ++ T    A DD LL+   SG+F Y      + I  +         LI    I KS   + Q+ +Q   V++  R     E+   +   R    FL+  N ALW   S FE +      + T +Y +  W  IT    PL IFFRFHS+ CL ++WS S+R
Sbjct:  164 LMAGAYVFGAGSCVMDLLHIA--FYVE---CSSNL--PSLFFSVFKAVFIFSQILFLRKFATAT-LHKSPSIRLVLFHILGTNVCIWFRA--------LFSHSRSIFSVRGTTTLDSAAETEC-IALHYSMSKIWEASEPYLYPFTMEYSLIAGGILYNMWSGMRDLDPDPQDIYIYDELSDFNTTSDNLSERLEKFEEDHGYGTCEAHTPSRDSVASSRFFSRFSLNRAVSNSSICQTCVDNGMVRNTSVPSSDPGLLVGLLFSTLLLLAVGLLWVDKQ----SSNALRFYYLYQITLLTFMCIS---CWVILKCLMNQKFTWYPLAPDDTLLIASFSGLFLYAGLCLTAGIAEY-----KNKQLISSFSIAKSTLILFQAMLQASAVIKALRFKPIDEIGANVI--RQGALFLLTTNFALWAQDSFFELRNFATTPVQTVFYGEKSWRAITTLAYPLCIFFRFHSAACLFEVWS-SFR 611          
BLAST of Otopetrin vs. Ensembl Nematostella
Match: EDO39144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAV2])

HSP 1 Score: 75.8702 bits (185), Expect = 2.762e-14
Identity = 81/369 (21.95%), Postives = 150/369 (40.65%), Query Frame = 1
Query:  955 FILYNLVTSNICQWFKTVVYEINHEL--VEHRNKISTKSNHSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGER------------IIAKYSECHRSH---------------RGLFVGLLFFMVTLVGVAIFFLF---KKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEG---SRKGTTKELHIKLKPG------RSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDI 1938
            F L +++  N+C WF  ++ E   ++   +  N  S   N +    N  ++ +Y    FL+P  IEYS++S+ + + +   + ++  D++  E   A  E             + A  S C +                 +    G    ++TLVG+ +  +    +K +A  +     Y +  ++ ++ +  +LV     +        +    +D  LL+IG+SG F    F  +     F  L   +    +  F+  ++   VQ T+Q LFV+     S +    E++  +         R +   L I+N ALW ++ FE    + +         T WS++ H   PL IFFR HS  C  +I
Sbjct:  337 FFLMHIIGVNMCSWFYVIIEESAEDMKPTKPPNTYSQSCNATMAMENLIKKANY----FLYPFEIEYSVMSSGLLFNLWYSL-KQPPDYNSVESSDANSETNGNGIFSSKFCGLSAACSTCCKCKPESSPQGHARTVAFWKNAICGFSIGIITLVGLLVLIICVYAEKDVARINPWNAYYGVRILIYIMMAFASLV-GINCLVHFHPSSSSSHTIVDTVLLMIGISGAFILTGFQIVV---GFTELKSKRDKTYVTFFLLDAVAATVQFTVQTLFVIRALLRSAESYDNEVYRDVSIRTLSWFIRQIAALLSIVNFALWAMNTFEINFKEMNNPEISVIDSTVWSVVRHIAYPLCIFFRLHSVFCCFEI 696          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 90.5077 bits (223), Expect = 1.533e-18
Identity = 105/467 (22.48%), Postives = 200/467 (42.83%), Query Frame = 1
Query:  679 SIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVV-----------YEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSS--------SVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEE---QALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRK------------------GTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKS 1950
            +I  +  E   I +D     ++LR G V FG   ++ D FKIA        +C + +      + L ++ VQT+F++ + +      K I    L   +++N+  W   V            YE+N   +  R+   +K+ + ++   CS            +L+P  IEYSL ++A+ + M + VGR   +HS         + +I           G  VG+L   + + G+A F +++ ++ T  S        +V+++ +  I+++    ++ V      +      ++E+   ++LD  LL+    G F  + F  I+TI +  +  GH   L     +   +  + Q  +Q  F++EG  +                  G   +L  K +  R +  FL++ N+ LWI+  F A+   +H    ++Y+   W+ I +  LP  IF+R HS   L +++  S
Sbjct:  116 TIYMRRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYL--HCDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCVQLQKNISCCGLMLTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARSLYISKAGYGDDSCKCSHTSCGVFKEAYYYLYPFNIEYSLFASAMSFVMWKNVGRVASEHSKHNFKFTLKDIVI-----------GPVVGIL---LVIAGLATFIVYEIEMKTYRSDDDDINDHAVMMHFIMNIVIVTMMSVSTVIGCAIFKVDHREHVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAK--GHLNRL----NLAWGVLMVFQLGLQNFFIIEGLHREPFHEVEDNEKSEESCFEGHKHKLLWKRRVLREVCVFLLLGNIILWIMPAFGARPQFDHDTEVEFYKFNMWAAIVNVGLPFGIFYRMHSVASLFEVFLNS 560          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 79.7221 bits (195), Expect = 3.498e-15
Identity = 108/479 (22.55%), Postives = 196/479 (40.92%), Query Frame = 1
Query:  679 SIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKIS-TKSNHSENYSNCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSS--------SVIVYQLSEI----MLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEG--------------SRKGTTKELHIKLKPG-------------------------RSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKS 1950
            +I  +  E   I +D     ++LR G V FG   ++ D FKIA        +C + +      + L ++ VQT+F++ + +      K I    L   +++N+  W   V  E  H+ V    +++ TK +   +   CS            +L+P  IEYSL ++A+ + M + VGR   +HS         + +I           G  VG+L   + + G+A F +++ ++ T  S        +V+++ +  I    M+ VS++I      +  R     +    ++LD  LL+    G F  + F  I+TI +  +  GH       L +   +  + Q  +Q  F++EG              +   T +      KP                          R +  FL++ N+ LWI+  F A+   +H    ++Y+   W+ I +  LP  IF+R HS   L +++  S
Sbjct:  115 TIYMRRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYL--HCDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCVQLQKNISCCGLMLTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARNDSCKCSHTSCGVFKEAYYYLYPFNIEYSLFASAMSFVMWKNVGRVASEHSKHNFKFTLKDIVI-----------GPVVGIL---LVIAGLATFIVYEIEMKTYRSDDDDINDHAVMMHFIMNIVIVTMMSVSTVIGCAIFKVDHRE-HVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAK--GHLNR----LNLAWGVLMVFQLGLQNFFIIEGLHREPFHEVEELEKTNASTFERGEGAAKPNLVPATLNYSSATEHKHKLLWKRRVLREVCVFLLLGNIILWIMPAFGARPQFDHDTEVEFYKFNMWAAIVNVGLPFGIFYRMHSVASLFEVFLNS 570          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 76.6406 bits (187), Expect = 2.941e-14
Identity = 110/498 (22.09%), Postives = 200/498 (40.16%), Query Frame = 1
Query:  679 SIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVV-----------YEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSS--------SVIVYQLSEI----MLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGH------QYSLIII-------LFICKSLTE----------MVQSTIQVLFVLEGSRKGTTKELHIKLKPG-------------------------RSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKS 1950
            +I  +  E   I +D     ++LR G V FG   ++ D FKIA        +C + +      + L ++ VQT+F++       +  K  V   L   +++N+  W   V            YE+N   +  R+   +K+ + ++   CS            +L+P  IEYSL ++A+ + M + VGR   +HS         + +I           G  VG+L   + + G+A F +++ ++ T  S        +V+++ +  I    M+ VS++I      +  R     +    ++LD  LL+    G F  + F  I+TI +  +  GH       + ++++        FI + L             V     VL +LE +   T +      KP                          R +  FL++ N+ LWI+  F A+   +H    ++Y+   W+ I +  LP  IF+R HS   L +++  S
Sbjct:   79 TIYMRRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYL--HCDSAVKVAFPVVQLVFVIVQTYFLW-------IHSKDCVHCGLMLTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARSLYISKAGYGDDSCKCSHTSCGVFKEAYYYLYPFNIEYSLFASAMSFVMWKNVGRVASEHSKHNFKFTLKDIVI-----------GPVVGIL---LVIAGLATFIVYEIEMKTYRSDDDDINDHAVMMHFIMNIVIVTMMSVSTVIGCAIFKVDHRE-HVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAK--GHLNRLNLAWGVLMVFQLGLQNFFIIEGLHREPFHEVEEPITVVENPYVLELLEKTNASTFERGEGAAKPNLVPATLNYSSATEHKHKLLWKRRVLREVCVFLLLGNIILWIMPAFGARPQFDHDTEVEFYKFNMWAAIVNVGLPFGIFYRMHSVASLFEVFLNS 550          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 60.077 bits (144), Expect = 5.156e-9
Identity = 83/365 (22.74%), Postives = 155/365 (42.47%), Query Frame = 1
Query:  679 SIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVV-----------YEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSP---FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSS--------SVIVYQLSEI----MLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEG 1695
            +I  +  E   I +D     ++LR G V FG   ++ D FKIA        +C + +      + L ++ VQT+F++ + +      K I    L   +++N+  W   V            YE+N   +  R+   +K+ + ++   CS            +L+P  IEYSL ++A+ + M + VGR   +HS         + +I           G  VG+L   + + G+A F +++ ++ T  S        +V+++ +  I    M+ VS++I      +  R     +    ++LD  LL+    G F  + F  I+TI +  +  GH   L +       +  + Q  +Q  F++EG
Sbjct:  119 TIYMRRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYL--HCDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCVQLQKNISCCGLMLTLSTNLALWMAAVTEESLHQTVLPDYEVNVTKLSARSLYISKAGYGDDSCKCSHTSCGVFKEAYYYLYPFNIEYSLFASAMSFVMWKNVGRVASEHSKHNFKFTLKDIVI-----------GPVVGIL---LVIAGLATFIVYEIEMKTYRSDDDDINDHAVMMHFIMNIVIVTMMSVSTVIGCAIFKVDHRE-HVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAK--GHLNRLNLAW----GVLMVFQLGLQNFFIIEG 460          
BLAST of Otopetrin vs. Ensembl Medaka
Match: otop2 (otopetrin 2 [Source:NCBI gene;Acc:101171833])

HSP 1 Score: 59.3066 bits (142), Expect = 9.961e-9
Identity = 89/365 (24.38%), Postives = 159/365 (43.56%), Query Frame = 1
Query:  679 SIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHE----LVEHRNKISTK--SNH-SENYSNCSQQLSYTVSP-------FLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSS--------SVIVYQLSEI----MLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEG 1695
            +I  +  E   I +D     ++LR G V FG   ++ D FKIA        +C + +      + L ++ VQT+F++ + +      K I    L   +++N+  W   V  E  H+    L   RN+  TK  S H +  Y + S + S+T          +L+P  IEYSL ++A+ + M + VGR   +HS         + +I           G  VG+L   + + G+A F +++ ++ T  S        +V+++ +  I    M+ VS++I      +  R     +    ++LD  LL+    G F  + F  I+TI +  +  GH   L +       +  + Q  +Q  F++EG
Sbjct:  119 TIYMRRTENAVIYKDEHAGPIWLRGGLVLFGILSIIMDIFKIASYVGYL--HCDSAVKVAFPVVQLVFVIVQTYFLWIHSKDCVQLQKNISCCGLMLTLSTNLALWMAAVTEESLHQTPLTLQSVRNQQLTKLFSCHPAAGYGDDSCKCSHTSCGVFKEAYYYLYPFNIEYSLFASAMSFVMWKNVGRVASEHSKHNFKFTLKDIVI-----------GPVVGIL---LVIAGLATFIVYEIEMKTYRSDDDDINDHAVMMHFIMNIVIVTMMSVSTVIGCAIFKVDHRE-HVSEKNPTRSLDVGLLVGASMGQFIISYFSIIATIATGAK--GHLNRLNLAW----GVLMVFQLGLQNFFIIEG 460          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018671.1 (SMESG000018671.1)

HSP 1 Score: 1261.9 bits (3264), Expect = 0.000e+0
Identity = 616/619 (99.52%), Postives = 616/619 (99.52%), Query Frame = 1
Query:  121 MEHPLFRSVDKRKHGYKKNRRHNVAFADFAIPDTRASIRVSCTLLFAMCQLFCGIVIPLSDSFVTISDSRMGHAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQRSNEISITSMQEDDIFLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRGNLNKSN 1977
            MEHPLFRSVDKRKHGYKKNRRHNVAFADFAIPDTRASIRVSCTLLFAMCQLFCGIVIPLSDSFVTISDS MGHAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQRSNEISITSMQEDDIFLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKIS KSN SENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRGNLNKSN
Sbjct:    1 MEHPLFRSVDKRKHGYKKNRRHNVAFADFAIPDTRASIRVSCTLLFAMCQLFCGIVIPLSDSFVTISDSGMGHAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQRSNEISITSMQEDDIFLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISMKSNLSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRGNLNKSN 619          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018671.1 (SMESG000018671.1)

HSP 1 Score: 1117.84 bits (2890), Expect = 0.000e+0
Identity = 550/563 (97.69%), Postives = 552/563 (98.05%), Query Frame = 1
Query:  289 IPLSDSFVTISDSRMGHAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQRSNEISITSMQEDDIFLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRGNLNKSN 1977
            +P  + FV      MGHAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQRSNEISITSMQEDDIFLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKIS KSN SENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRGNLNKSN
Sbjct:   33 LPCVNYFVVYG---MGHAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQRSNEISITSMQEDDIFLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISMKSNLSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRGNLNKSN 592          

HSP 2 Score: 85.1149 bits (209), Expect = 5.328e-17
Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 2
Query:  161 MVIRKTEDTMWHSPILQYLTHELQYVYLALYYLPCVNY 274
            MVIRKTEDTMWHSPILQYLTHELQYVYLALYYLPCVNY
Sbjct:    1 MVIRKTEDTMWHSPILQYLTHELQYVYLALYYLPCVNY 38          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018672.1 (SMESG000018672.1)

HSP 1 Score: 746.117 bits (1925), Expect = 0.000e+0
Identity = 383/618 (61.97%), Postives = 469/618 (75.89%), Query Frame = 1
Query:  169 KKNRRHNVAFADFAIPDTRASIRVSCTLLFAMCQLFCGIVIPLSDSFVTISDSRMGHAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQRSNEISITSMQEDDI-----------FLTSFKNSHPSSEVSSIASQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRN--KISTKSNHSENYSN--CSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIA--KYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSYRGNLNK 1971
            + +RRH+VAFADFAI + R+SI VSCTLLFAM QLF GIVIPLSDSFVTIS+    HAYYLEAFLIIQY +AI  VF+LQGY+++ +   K+N            KK     D I  + +D+ +S KVTF L     +HQ + ++ + ++  DD            F T  K+SH  +++    SQ      ++++  GINLYLRLGAVGFGFGVMVHDGFK+AD+ RL+   CHN+LWTPK CLHL+YIF+QTFFIFKYHR IFLKHK ++RFILY+L  SNICQWFKTVVYEINHEL++H+N  +I+   N +  + N  C+ QLSY+VSP+LFPCAIEYSLISAAIFYKMLQ+VG    D  +    + Q + ++   KYSECHRSH+GLFVGLLFFMVTLVG+AIF LFKK   TQ+ +V+VYQ+SEI+LLVSS I LV AFIKMR L F QL+EE+ALDDNLLL+GL+GVF+YNLFLFISTIDS  +L   ++SL IILF+CKS+TE++QS +QVLFVLE SRK       +++KPGRSLVTFLI+ NLALW VSIFEAKR+DEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICL DIW+K+Y+ N+ K
Sbjct:   18 RSDRRHSVAFADFAINNPRSSIAVSCTLLFAMSQLFFGIVIPLSDSFVTISEKETEHAYYLEAFLIIQYVTAIASVFFLQGYVYIHDCYLKKN-----------NKKDDPCQDEITRELVDL-DSQKVTFKL-----SHQNTEDVELENISNDDTTHLSTNNLSNAFNTDDKSSHLENKL--FTSQQFNNYYVIKETNGINLYLRLGAVGFGFGVMVHDGFKVADQVRLQNSFCHNQLWTPKQCLHLAYIFIQTFFIFKYHRAIFLKHKAVIRFILYHLTISNICQWFKTVVYEINHELLDHKNTSQINIHGNSTIRHENKTCTDQLSYSVSPYLFPCAIEYSLISAAIFYKMLQRVGGNEHDEKHSSDKL-QTQVVVKNIKYSECHRSHKGLFVGLLFFMVTLVGLAIFLLFKKTDKTQTLAVMVYQVSEIILLVSSSIALVCAFIKMRGLRFCQLSEEEALDDNLLLVGLAGVFAYNLFLFISTIDSSNKLDNSKHSLSIILFLCKSMTEIIQSLLQVLFVLESSRKCAQSFHDVRVKPGRSLVTFLIVTNLALWTVSIFEAKRADEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLTDIWTKAYKINITK 615          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018670.1 (SMESG000018670.1)

HSP 1 Score: 671.003 bits (1730), Expect = 0.000e+0
Identity = 337/602 (55.98%), Postives = 439/602 (72.92%), Query Frame = 1
Query:  178 RRHNVAFADFAIPDTRASIRVSCTLLFAMCQLFCGIVIPLSDSFVTISDSRMGHAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQ--RSNEISITSMQEDDIFLTSFKNSHPSSEVSSIA--------SQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSY 1953
            R+ ++   +F I ++R+S  VS T+L+AM QLF GIV+PLSDSFV+ SD    H YYLE +L+IQY  A++ +FYLQGYI++ E+              L  K+ K +     + ++++  +    FD   ++        NEI +++ ++++   TS +N++  S+++ I+        S+N +   I  D++GIN+YLRLGAVGFGFGVMVHDGFKIAD+ R +  +CHN LWTPK CLHL+YIF QTFFIFKYHRII+LKHK I+RFILY+L  SNIC+WFKTVVYEINHEL+EH  K   KS+   N + C+ +LS++V+P+LFPCAIEYSLISAA+FYKM QKVG  +   + +       E+   KYSECHRSH+GLF+GLLFFM TLVG+A F +FK+   TQ+ +++VYQ+SEI+LL SSII+L+ AFI+MR L FRQLTEE+  DDNL+L+ L+GVF+YNLFLFISTIDS +R+   + SL + LF+CKSLTE++QS IQV FVLE SRK    +     K GRS+VTFLII NLALW +SIFEAKR+DEHLIFT+YYQKTPW+IITHTLLPLIIFFRFHSSICL  IW KSY
Sbjct:   23 RKQSIGLMEFRINNSRSSTSVSITILYAMSQLFLGIVLPLSDSFVSNSDYEADHTYYLEIYLMIQYILAVISIFYLQGYIYIYEK-------------FLSRKRNKNAEIKEEDKEIEVILANNF-FDNNNKIDESYIINQNEIEVSAKEDEE--RTSLENTNFISKINQISVSNSNLADSENIDNKFIFHDNDGINVYLRLGAVGFGFGVMVHDGFKIADQVRAQNSSCHNHLWTPKQCLHLAYIFSQTFFIFKYHRIIYLKHKIIIRFILYHLTISNICEWFKTVVYEINHELIEHNIKFIDKSDF-HNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQVSEIVLLASSIISLIVAFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKHAINQKQALEKSGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKTPWTIITHTLLPLIIFFRFHSSICLTAIWRKSY 607          
BLAST of Otopetrin vs. Planmine SMEST
Match: SMESG000018670.1 (SMESG000018670.1)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 337/602 (55.98%), Postives = 439/602 (72.92%), Query Frame = 1
Query:  178 RRHNVAFADFAIPDTRASIRVSCTLLFAMCQLFCGIVIPLSDSFVTISDSRMGHAYYLEAFLIIQYFSAILFVFYLQGYIFMCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKAEVQNHQ--RSNEISITSMQEDDIFLTSFKNSHPSSEVSSIA--------SQNAEKLSIMRDHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCLHLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEINHELVEHRNKISTKSNHSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAIFYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFMVTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRTLSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLIIILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLIIINLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSSICLMDIWSKSY 1953
            R+ ++   +F I ++R+S  VS T+L+AM QLF GIV+PLSDSFV+ SD    H YYLE +L+IQY  A++ +FYLQGYI++ E+              L  K+ K +     + ++++  +    FD   ++        NEI +++ ++++   TS +N++  S+++ I+        S+N +   I  D++GIN+YLRLGAVGFGFGVMVHDGFKIAD+ R +  +CHN LWTPK CLHL+YIF QTFFIFKYHRII+LKHK I+RFILY+L  SNIC+WFKTVVYEINHEL+EH  K   KS+   N + C+ +LS++V+P+LFPCAIEYSLISAA+FYKM QKVG  +   + +       E+   KYSECHRSH+GLF+GLLFFM TLVG+A F +FK+   TQ+ +++VYQ+SEI+LL SSII+L+ AFI+MR L FRQLTEE+  DDNL+L+ L+GVF+YNLFLFISTIDS +R+   + SL + LF+CKSLTE++QS IQV FVLE SRK    +     K GRS+VTFLII NLALW +SIFEAKR+DEHLIFT+YYQKTPW+IITHTLLPLIIFFRFHSSICL  IW KSY
Sbjct:   21 RKQSIGLMEFRINNSRSSTSVSITILYAMSQLFLGIVLPLSDSFVSNSDYEADHTYYLEIYLMIQYILAVISIFYLQGYIYIYEK-------------FLSRKRNKNAEIKEEDKEIEVILANNF-FDNNNKIDESYIINQNEIEVSAKEDEE--RTSLENTNFISKINQISVSNSNLADSENIDNKFIFHDNDGINVYLRLGAVGFGFGVMVHDGFKIADQVRAQNSSCHNHLWTPKQCLHLAYIFSQTFFIFKYHRIIYLKHKIIIRFILYHLTISNICEWFKTVVYEINHELIEHNIKFIDKSDF-HNKTVCADELSHSVAPYLFPCAIEYSLISAAVFYKMFQKVGLANYQKNLKSFCSLNSEKHTIKYSECHRSHKGLFIGLLFFMATLVGLATFLMFKRNNKTQTLAIMVYQVSEIVLLASSIISLIVAFIQMRKLGFRQLTEEETFDDNLILVSLAGVFTYNLFLFISTIDSTVRMKNRKNSLTLTLFLCKSLTEIIQSLIQVFFVLESSRKHAINQKQALEKSGRSVVTFLIINNLALWTISIFEAKRADEHLIFTQYYQKTPWTIITHTLLPLIIFFRFHSSICLTAIWRKSY 605          
The following BLAST results are available for this feature:
BLAST of Otopetrin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
OTOP14.884e-921.28otopetrin 1 [Source:HGNC Symbol;Acc:HGNC:19656][more]
OTOP23.397e-819.67otopetrin 2 [Source:HGNC Symbol;Acc:HGNC:19657][more]
OTOP37.467e-620.78otopetrin 3 [Source:HGNC Symbol;Acc:HGNC:19658][more]
OTOP37.579e-620.78otopetrin 3 [Source:HGNC Symbol;Acc:HGNC:19658][more]
back to top
BLAST of Otopetrin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otpl-31.813e-3627.03OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL... [more]
otpl-31.813e-3627.03OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:Q95QL... [more]
otpl-86.024e-3525.91OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:G5EDX... [more]
otpl-13.853e-3425.33OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O4506... [more]
otpl-14.403e-3425.33OToPetrin-Like [Source:UniProtKB/TrEMBL;Acc:O4506... [more]
back to top
BLAST of Otopetrin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OtopLc2.118e-6832.17gene:FBgn0259150 transcript:FBtr0331167[more]
OtopLc2.195e-6832.17gene:FBgn0259150 transcript:FBtr0346834[more]
OtopLc2.420e-6832.17gene:FBgn0259150 transcript:FBtr0331168[more]
OtopLb8.012e-4827.23gene:FBgn0031514 transcript:FBtr0077608[more]
OtopLb1.417e-4727.23gene:FBgn0031514 transcript:FBtr0344796[more]
back to top
BLAST of Otopetrin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
otop22.326e-1521.78otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2][more]
otop23.508e-1521.73otopetrin 2 [Source:ZFIN;Acc:ZDB-GENE-050104-2][more]
back to top
BLAST of Otopetrin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc46a22.252e-1523.81solute carrier family 46 member 2 [Source:Xenbase;... [more]
ENSXETT00000014404.18.257e-1420.24otopetrin-1 gene 2 [Source:NCBI gene;Acc:100494873... [more]
ENSXETT00000044569.13.236e-1324.16otopetrin-3-like [Source:NCBI gene;Acc:101731580][more]
ENSXETT00000044547.16.657e-1324.43otopetrin 2 [Source:NCBI gene;Acc:100496174][more]
ENSXETT00000044555.11.122e-1224.43otopetrin 2 [Source:NCBI gene;Acc:100496174][more]
back to top
BLAST of Otopetrin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Otop18.783e-920.68otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363][more]
Otop11.143e-820.68otopetrin 1 [Source:MGI Symbol;Acc:MGI:2388363][more]
Otop22.356e-820.12otopetrin 2 [Source:MGI Symbol;Acc:MGI:2388365][more]
Otop22.356e-820.12otopetrin 2 [Source:MGI Symbol;Acc:MGI:2388365][more]
Otop35.937e-720.63otopetrin 3 [Source:MGI Symbol;Acc:MGI:1916852][more]
back to top
BLAST of Otopetrin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B7Z0W9|OTOP_DROME2.123e-6732.17Proton channel OtopLc OS=Drosophila melanogaster O... [more]
sp|Q7M734|OTOP1_RAT1.403e-820.68Proton channel OTOP1 OS=Rattus norvegicus OX=10116... [more]
sp|Q7RTM1|OTOP1_HUMAN2.345e-821.28Proton channel OTOP1 OS=Homo sapiens OX=9606 GN=OT... [more]
sp|Q80VM9|OTOP1_MOUSE6.143e-820.68Proton channel OTOP1 OS=Mus musculus OX=10090 GN=O... [more]
sp|Q7RTS6|OTOP2_HUMAN1.632e-719.67Proton channel OTOP2 OS=Homo sapiens OX=9606 GN=OT... [more]
back to top
BLAST of Otopetrin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074Z2Q44.940e-12440.67Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2LBS81.111e-12344.97Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7YVK51.547e-12344.97Otopetrin OS=Clonorchis sinensis OX=79923 GN=CLF_1... [more]
A0A4S2LI039.110e-12344.97Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A504YZQ11.590e-12243.25Otopetrin (Fragment) OS=Fasciola gigantica OX=4683... [more]
back to top
BLAST of Otopetrin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
otop22.059e-2022.41otopetrin 2 [Source:NCBI gene;Acc:103039885][more]
back to top
BLAST of Otopetrin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000564.11.597e-823.18pep scaffold:Pmarinus_7.0:GL476591:206565:219203:-... [more]
back to top
BLAST of Otopetrin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Otopetrin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO481131.155e-1826.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391442.762e-1421.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Otopetrin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
otop21.533e-1822.48otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
otop23.498e-1522.55otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
otop22.941e-1422.09otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
otop25.156e-922.74otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
otop29.961e-924.38otopetrin 2 [Source:NCBI gene;Acc:101171833][more]
back to top
BLAST of Otopetrin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018671.10.000e+099.52SMESG000018671.1[more]
SMESG000018671.15.328e-1797.69SMESG000018671.1[more]
SMESG000018672.10.000e+061.97SMESG000018672.1[more]
SMESG000018670.10.000e+055.98SMESG000018670.1[more]
SMESG000018670.10.000e+055.98SMESG000018670.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012798 ID=SMED30012798|Name=Otopetrin|organism=Schmidtea mediterranea sexual|type=transcript|length=1994bp
ATTTGGCTCTGGAATTAGCACACATTATTTGCGGTGCTCATTGAACCGTG
TCCATTATAATGTGCATATATAAATGTATTGATTTATGAAAAATACGTTT
AAATTGTTATTATTTATATTATGGAGCATCCTTTATTTAGATCAGTAGAC
AAGAGAAAACATGGTTATAAGAAAAACAGAAGACACAATGTGGCATTCGC
CGATTTTGCAATACCTGACACACGAGCTTCAATACGTGTATCTTGCACTT
TATTATTTGCCATGTGTCAATTATTTTGTGGTATAGTAATTCCTCTTTCT
GATTCTTTTGTTACAATCTCAGATAGCCGAATGGGCCATGCATATTATTT
AGAGGCATTCCTAATCATTCAGTATTTCTCAGCAATCCTTTTTGTATTTT
ATCTGCAAGGTTACATATTTATGTGCGAAAGAAGAAATAAGCAAAACATA
AAACAAGAAATTGAAAATGGCATTCTTGATGAAAAGAAAAAAAAGAAATC
AGTCGATGTAATTGCAGAAGATAAGTTAGACATTTCAGAATCACCAAAAG
TGACATTTGACTTGAAAGCCGAAGTTCAAAATCACCAAAGATCAAATGAA
ATTTCAATCACATCAATGCAAGAGGATGATATTTTTTTAACCTCTTTTAA
GAATAGCCATCCTTCATCTGAAGTGAGTAGTATTGCTTCTCAAAATGCTG
AAAAACTATCTATTATGCGAGACCATGAAGGTATAAATCTATATTTGAGG
CTCGGAGCAGTTGGTTTTGGATTCGGAGTGATGGTACATGACGGATTTAA
AATTGCTGACAAATTTAGATTAGAAGGTGAAAATTGTCACAATGAACTCT
GGACTCCAAAGCATTGTTTGCATTTATCATACATATTTGTCCAAACCTTT
TTCATTTTTAAGTATCACAGAATTATTTTTCTAAAACACAAGCCAATAGT
TAGATTCATTTTATATAATCTTGTCACTTCAAATATATGTCAATGGTTCA
AGACGGTTGTTTATGAAATTAACCATGAGTTAGTAGAACATCGTAACAAA
ATAAGTACGAAATCAAATCACAGTGAAAATTATTCCAACTGCTCTCAACA
ATTATCATACACAGTTTCTCCGTTTCTCTTTCCATGTGCCATTGAATATA
GTTTGATAAGTGCGGCAATATTTTATAAAATGCTTCAAAAAGTAGGAAGA
AAACATAGAGACCACAGTTATCGGGAAAAATATATAGCGCAAGGTGAAAG
AATCATTGCCAAATATTCTGAATGCCACAGATCTCACCGAGGACTTTTTG
TTGGGTTGCTATTTTTTATGGTCACTTTGGTTGGAGTAGCTATATTTTTT
CTTTTTAAAAAGAAAATAGCTACTCAGTCTTCCTCAGTAATTGTTTATCA
ACTTTCAGAAATTATGCTCTTAGTTTCAAGTATCATAACTCTTGTGTGGG
CTTTTATTAAAATGAGAACTCTTTCATTTCGACAATTAACAGAAGAACAA
GCTTTAGATGATAATCTTTTATTAATTGGTTTATCTGGTGTTTTTTCATA
CAATCTTTTCTTATTTATTTCAACTATAGACTCTTTCATTCGATTACCGG
GTCATCAGTATTCCTTGATTATTATTTTGTTTATTTGTAAATCACTAACG
GAAATGGTACAGTCAACAATACAAGTACTTTTTGTTCTTGAGGGCTCCAG
AAAAGGAACCACGAAGGAATTGCATATTAAGCTAAAACCTGGACGATCAT
TGGTTACTTTTTTAATTATTATCAACTTAGCCCTTTGGATTGTCAGTATA
TTTGAGGCTAAAAGATCGGATGAGCACTTAATATTTACTAAATATTATCA
AAAAACACCTTGGAGTATTATCACCCACACACTGTTACCTCTTATAATCT
TTTTCCGTTTCCATTCTTCAATATGTTTGATGGATATTTGGAGTAAAAGC
TACCGAGGAAATCTCAATAAATCAAATTAGATTTTTGTATCATA
back to top

protein sequence of SMED30012798-orf-1

>SMED30012798-orf-1 ID=SMED30012798-orf-1|Name=SMED30012798-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=620bp
MEHPLFRSVDKRKHGYKKNRRHNVAFADFAIPDTRASIRVSCTLLFAMCQ
LFCGIVIPLSDSFVTISDSRMGHAYYLEAFLIIQYFSAILFVFYLQGYIF
MCERRNKQNIKQEIENGILDEKKKKKSVDVIAEDKLDISESPKVTFDLKA
EVQNHQRSNEISITSMQEDDIFLTSFKNSHPSSEVSSIASQNAEKLSIMR
DHEGINLYLRLGAVGFGFGVMVHDGFKIADKFRLEGENCHNELWTPKHCL
HLSYIFVQTFFIFKYHRIIFLKHKPIVRFILYNLVTSNICQWFKTVVYEI
NHELVEHRNKISTKSNHSENYSNCSQQLSYTVSPFLFPCAIEYSLISAAI
FYKMLQKVGRKHRDHSYREKYIAQGERIIAKYSECHRSHRGLFVGLLFFM
VTLVGVAIFFLFKKKIATQSSSVIVYQLSEIMLLVSSIITLVWAFIKMRT
LSFRQLTEEQALDDNLLLIGLSGVFSYNLFLFISTIDSFIRLPGHQYSLI
IILFICKSLTEMVQSTIQVLFVLEGSRKGTTKELHIKLKPGRSLVTFLII
INLALWIVSIFEAKRSDEHLIFTKYYQKTPWSIITHTLLPLIIFFRFHSS
ICLMDIWSKSYRGNLNKSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004878Otopetrin
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004878OtopetrinPFAMPF03189Otopetrincoord: 208..323
e-value: 4.2E-29
score: 101.7
coord: 322..597
e-value: 6.6E-70
score: 236.1
IPR004878OtopetrinPANTHERPTHR21522OTOPETRINcoord: 41..612
NoneNo IPR availableTMHMMTMhelixcoord: 466..486
NoneNo IPR availableTMHMMTMhelixcoord: 423..445
NoneNo IPR availableTMHMMTMhelixcoord: 43..65
NoneNo IPR availableTMHMMTMhelixcoord: 391..413
NoneNo IPR availableTMHMMTMhelixcoord: 205..222
NoneNo IPR availableTMHMMTMhelixcoord: 80..102
NoneNo IPR availableTMHMMTMhelixcoord: 581..603
NoneNo IPR availableTMHMMTMhelixcoord: 544..561
NoneNo IPR availableTMHMMTMhelixcoord: 330..352
NoneNo IPR availableTMHMMTMhelixcoord: 501..523