Netrin 1

Overview
NameNetrin 1
Smed IDSMED30012792
Length (bp)2046
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Netrin 1 (SMED30012792) t-SNE clustered cells

Violin plots show distribution of expression levels for Netrin 1 (SMED30012792) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Netrin 1 (SMED30012792) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Netrin 1 (SMED30012792) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012792

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
dorsal ventral margin of the whole animalSMED30012792h1SMcG0016110 dd_Smed_v4_18181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30012792h1SMcG0016110 dd_Smed_v6_18181_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30012792h1SMcG0016110 dd_Smed_v4_18181_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Netrin 1 vs. Ensembl Human
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 328.561 bits (841), Expect = 3.264e-103
Identity = 205/618 (33.17%), Postives = 310/618 (50.16%), Query Frame = 2
Query:  239 LSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVCPIKSPRDN----LITDYHLTHNQTCWKSVP-LQANH-VNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK------------YIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            LS        P PC   +G   +C+P F N       ++ + C +                    +C    P+       +TD +  HN TCW+S   LQ  H V +T S  K+FEV Y+SL  C S  P ++A YKS ++G TW P+ + +T C  M+N       + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+DIR+   +      +  +    AR+S     ++SD+ +GGRCKCNGHA  C ++   + + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +GYYRD  KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K              + E  ++ CKA   K  +I  +K+C+KD      +   +  GD+ +F V + +++                        SR+  R    +W++ RD+ C C +++  + YLL+  +     Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:   28 LSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ--------NEQEAVCTD---SHTDMRPLSGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDS--YFYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGK-LKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYK--------------------QGTSRI-RRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSG---IVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. Ensembl Human
Match: NTN3 (netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030])

HSP 1 Score: 274.248 bits (700), Expect = 8.670e-83
Identity = 184/570 (32.28%), Postives = 266/570 (46.67%), Query Frame = 2
Query:  275 PCYAHGSAYQ-CMPPFTNIVENMIPKIETLCKKK--EVCPIKSPR----DNLITDYHLTHNQTCWKS--VPLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSS--LIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKY-----------IQMESAENKCKACDSKRTRIRFQKFCRKD-AVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTY---LLIIKSTTYHYQNRAELLIKSPRSIILTWNPTW 1906
            PC+  G A + C+P   N          + C +     C    PR      L+T    T +  CW+S  +P    +V +T    K FE+ ++SL  C S  P ++A  KS + G +W P  + +++C    ++    +P+   N       E  A CFP  L+  D   ++AF+           DSS  L DW++A+D+R+ L +     P  +   R          + +D+ +GGRCKCNGHA+ C  +     + C C+H TEG DC +CK  Y D PW RAT      C  C CN H+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD  + L  +  C+ C CH +GA     C++ TGQC CK GVTG  CNRCA GF+QS S   PCVK            +Q +  ++ CK       RI  +KFC+KD AV  A     E  G + RF V V  ++ S                     ++R   R ++ +W+   D  C C +L  G+ Y        +       R   LI +  S++L W   W
Sbjct:   29 PCHDEGGAPRGCVPGLVNAALGREVLASSTCGRPATRACDASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFVSLRFC-SAPPASVALLKSQDHGRSWAPLGFFSSHC----DLDYGRLPA-PANGPAGPGPE--ALCFPAPLAQPDGSGLLAFSMQDSSPPGLDLDSSPVLQDWVTATDVRVVLTR-----PSTAGDPRDMEAVVPYSYAATDLQVGGRCKCNGHASRCLLD-TQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRATARESHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRALSDRRACRACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKTPIPGPTEDSSPVQPQDCDSHCKPARGS-YRISLKKFCKKDYAVQVAVGARGEARGAWTRFPVAVLAVFRSGE------------------ERAR---RGSSALWVPAGDAACGCPRLLPGRRYLLLGGGPGAAAGGAGGRGPGLIAARGSLVLPWRDAW 561          
BLAST of Netrin 1 vs. Ensembl Human
Match: NTN5 (netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208])

HSP 1 Score: 203.756 bits (517), Expect = 2.039e-57
Identity = 127/425 (29.88%), Postives = 193/425 (45.41%), Query Frame = 2
Query:  773 VLEGAYENVGDSSLI----DWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK--------------YIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGD-FIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKFQNRSPFRKP 1990
            +L  A+ + G   L+     W  A      +     P PK +      R        ++   + GRC+C+GHA  C       +  C  +H+T G  CE C+ ++ D PW  AT   P  C  C CN H+  C F+ +L+ L    +GGVC  C+H+TAG  CHYC  G++RD ++P+  +  C+ C CH IGA     C++ +GQC CK GVTG  CNRC  G++QS S   PC +              Y      +N C   D+ R  +  +++C++D V  A + + E  G  + R  V V  ++  +           +QP+ R    +          W+   DL C C++LQ G  YLL+  +       R   LI     + L W P W R L R +Q++  G C   +  +P  +P
Sbjct:   91 ILSAAWASGGPWRLLWHRPAWPGALGGPERVTFHSTPGPKATVAASHLRVEFGGQAGLAAAGLRGRCQCHGHAARCAARARPPRCHC--RHHTTGPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPIFSRRACRACQCHPIGATG-GTCNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDT-RVHMSLRRYCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYKQR-----------AQPVRRGDQDA----------WVPRADLTCGCLRLQPGTDYLLLGSAVGDPDPTR---LILDRHGLALPWRPRWARPLKRLQQEERAGGCRGVRAPTPSPRP 487          
BLAST of Netrin 1 vs. Ensembl Human
Match: LAMC1 (laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:6492])

HSP 1 Score: 193.741 bits (491), Expect = 4.625e-51
Identity = 141/423 (33.33%), Postives = 194/423 (45.86%), Query Frame = 2
Query:  290 GSAYQCMPPFTNIVENMIPKIETLC-----------------KKKEVCPIKSPR----DNLITDYHLTHNQTCWKSVPLQA-----NHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFK--------FDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            G   +CMP F N   N+       C                 K   +C    P        +TDY+   + T W+S  + A     + +N+T    K F++ Y+ L    +  P + A YK       W P+ Y + +C       E T         R    EQ A C       +D  P+    VAF+T LEG   AY       L +W++A+DIR+TL +        F++PK  KS  +           +ISD ++GGRCKCNGHA+ C KN   +K+ C C+HNT G DCEKC   + D PW RAT  S ++C  C+CN  S  CYF  +LY  R    GG CTNCQ NT G  C  C + ++R     L +   C  C C  +G+    +CD   G+C CK GV G+ C+RC  GF
Sbjct:   45 GRPQRCMPEFVNAAFNVTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLGKAFDITYVRLK-FHTSRPESFAIYKRTREDGPWIPYQYYSGSC-------ENTYSKANRGFIRTGGDEQQALCTD---EFSDISPLTGGNVAFST-LEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYY-----------AISDFAVGGRCKCNGHASECMKNEF-DKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELY--RSTGHGGHCTNCQDNTDGAHCERCRENFFR-----LGNNEACSSCHCSPVGS-LSTQCDS-YGRCSCKPGVMGDKCDRCQPGF 434          

HSP 2 Score: 78.5666 bits (192), Expect = 3.219e-14
Identity = 60/188 (31.91%), Postives = 81/188 (43.09%), Query Frame = 2
Query:  959 CKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHI-IGAKFPDRCDKRTGQCL-CKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACD 1516
            C CNGH+  C+  P T    C C+ NT G  CEKC   Y    +  +T  + + C+ C C   SS     +   +        VCTNC   T G RC  C+DGY+ D         +C+ C C   I       C++ TG+CL C     G  C+RC  GF  +     P           +KCKAC+
Sbjct:  724 CACNGHSETCD--PETGV--CNCRDNTAGPHCEKCSDGY----YGDSTAGTSSDCQPCPCPGGSSCAVVPKTKEV--------VCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPA----------DKCKACN 885          

HSP 3 Score: 68.9366 bits (167), Expect = 2.706e-11
Identity = 57/181 (31.49%), Postives = 85/181 (46.96%), Query Frame = 2
Query:  899 FARNSPKKILSISDISIGGRCKCNGHANAC-NKNPITNKIECV-CQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQIT----GGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRC 1423
              RN P ++  +       +C  N   NA  N N +T   EC+ C +NT G  C++CK  +   P A    N   +CK C CNL+ +          +++Q +     G C  C  +  G  C  C+ G+Y      L     C++C CH +G+    +CD RTGQC C+ G+TG+ C RC
Sbjct:  816 LGRNGPVRLCRLC------QCSDNIDPNAVGNCNRLTG--ECLKCIYNTAGFYCDRCKDGFFGNPLA---PNPADKCKACNCNLYGT----------MKQQSSCNPVTGQC-ECLPHVTGQDCGACDPGFYN-----LQSGQGCERCDCHALGST-NGQCDIRTGQCECQPGITGQHCERC 968          

HSP 4 Score: 67.781 bits (164), Expect = 6.299e-11
Identity = 55/167 (32.93%), Postives = 76/167 (45.51%), Query Frame = 2
Query:  959 CKCNGHANACNKNPITNKIECV-CQHNTEGQDCEKCKKNYLDLPWARATVNSPAQ-CKKCECNLH-----SSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGA-KFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            C C G  ++C   P T ++ C  C   T G+ CE C   Y   P  R   N P + C+ C+C+ +       NC           ++TG  C  C +NTAG  C  C DG++ +   P +    CK C C++ G  K    C+  TGQC C   VTG+ C  C  GF
Sbjct:  773 CPCPG-GSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGR---NGPVRLCRLCQCSDNIDPNAVGNC----------NRLTG-ECLKCIYNTAGFYCDRCKDGFFGNPLAP-NPADKCKACNCNLYGTMKQQSSCNPVTGQCECLPHVTGQDCGACDPGF 923          
BLAST of Netrin 1 vs. Ensembl Human
Match: LAMA5 (laminin subunit alpha 5 [Source:HGNC Symbol;Acc:HGNC:6485])

HSP 1 Score: 190.66 bits (483), Expect = 7.179e-50
Identity = 114/348 (32.76%), Postives = 176/348 (50.57%), Query Frame = 2
Query:  446 WKSVPL----QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLAT---NCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPK-KSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITN--KIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQIT-------GGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPD-RCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            W+S PL    + N VN+T    + F V Y+ +    S  P+     +S +FG T++PW + A+   +CL  F  +  T+  +  +D  I   E + R  PL+    + E VV+      GA        L ++  A+++R+   + +           R    + +   SI DISIGGRC C+GHA+AC+    T+  +++C CQHNT G  C++C   +   PW  AT NS  +C+ C C  H+++CY+  ++   R   +       GGVC +CQH+T GV C  C  G+YR    PLD   VC++C C    + F D  C+  TG+C C+   +GE C+ CA GF
Sbjct:  128 WQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGRTYQPWQFFASSKRDCLERFGPQ--TLERITRDDAAICTTEYS-RIVPLE----NGEIVVSLVNGRPGAMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRCVCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATANSANECQSCNCYGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPNHPLDSPHVCRRCNCE---SDFTDGTCEDLTGRCYCRPNFSGERCDVCAEGF 465          

HSP 2 Score: 78.5666 bits (192), Expect = 3.758e-14
Identity = 42/141 (29.79%), Postives = 62/141 (43.97%), Query Frame = 2
Query: 1010 KIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASG 1432
            + +C+C+    G  CE+C   +   P    +      C+ C+C+ +        D   L      G C  C  +T G RC  C  G+Y +   P +    C +C C   G    + CD  +G CLCK+GVTG  C+RC  G
Sbjct: 1934 RTQCLCKPGYAGASCERCAPGFFGNPLVLGS-----SCQPCDCSGNGDPNLLFSDCDPLT-----GACRGCLRHTTGPRCEICAPGFYGNALLPGN----CTRCDCTPCGT---EACDPHSGHCLCKAGVTGRRCDRCQEG 2057          

HSP 3 Score: 73.9442 bits (180), Expect = 9.761e-13
Identity = 46/158 (29.11%), Postives = 64/158 (40.51%), Query Frame = 2
Query:  977 ANACNKNPITNKIE-CVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTC--HIIGAKFPDRCDKRTG--QCLCKSGVTGEMCNRCASGF 1435
            A+   +  + + +E C+C  +  G  C++C   +    +         +C  C+C+ HS  C               GVC +CQHNT G  C  C  G+      P      C  C C   +    F + C  R G  QCLCK G  G  C RCA GF
Sbjct: 1816 ASPAGQGALASNVELCLCPASYRGDSCQECAPGF----YRDVKGLFLGRCVPCQCHGHSDRCLPGS-----------GVCVDCQHNTEGAHCERCQAGFVSSRDDP---SAPCVSCPCPLSVPSNNFAEGCVLRGGRTQCLCKPGYAGASCERCAPGF 1955          

HSP 4 Score: 67.781 bits (164), Expect = 7.073e-11
Identity = 49/170 (28.82%), Postives = 66/170 (38.82%), Query Frame = 2
Query:  956 RCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNS---------PA-QCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            RC C           +T +  C C+ N  G+ C+ C + +   P    T +S         PA Q   C+C+   +           RK    G C  C+ N  G  C  C  G+Y            C+ C C   G    DRCD  TGQC C+ G  G  C+RCA G+
Sbjct:  428 RCNCESDFTDGTCEDLTGR--CYCRPNFSGERCDVCAEGFTGFPSCYPTPSSSNDTREQVLPAGQIVNCDCSAAGTQGN------ACRKDPRVGRCL-CKPNFQGTHCELCAPGFYGPG---------CQPCQCSSPGVA-DDRCDPDTGQCRCRVGFEGATCDRCAPGY 578          

HSP 5 Score: 63.5438 bits (153), Expect = 1.436e-9
Identity = 41/141 (29.08%), Postives = 63/141 (44.68%), Query Frame = 2
Query: 1010 KIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHK--FVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCA 1426
            ++ C+C+ + EG  C++CK  +    W  +  N P  C +C C+L  +    ++       Q   G C  C+ +  G  C  C DG++      LD    F C+ C C I GA     C+ RTG C C+    G  C+  A
Sbjct:  741 QVPCMCRAHVEGPSCDRCKPGF----WGLSPSN-PEGCTRCSCDLRGTLGGVAE------CQPGTGQCF-CKPHVCGQACASCKDGFF-----GLDQADYFGCRSCRCDIGGA-LGQSCEPRTGVCRCRPNTQGPTCSEPA 863          

HSP 6 Score: 59.3066 bits (142), Expect = 2.434e-8
Identity = 53/211 (25.12%), Postives = 75/211 (35.55%), Query Frame = 2
Query: 1016 ECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCY-----FSQDLYILRKQITG-----------------------------GVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFV-CKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASG-FRQSNSTETPCVKYIQMESAENKCKACDSKRTRIRF 1540
            +C C  +  G+DC +C   Y   P  R     P  C    C+  +  C         D  + + Q  G                             G C  C+ N  G RC  C+ G+         H +  C+ C CH  G   P  CD  TGQC CK  V G  C++C+ G F    +    C +     + E +C++  S  TR  F
Sbjct: 1456 QCPCHAHVIGRDCSRCATGYWGFPNCR-----PCDCGARLCDELTGQCICPPRTIPPDCLLCQPQTFGCHPLVGCEECNCSGPGIQELTDPTCDTDSGQC-KCRPNVTGRRCDTCSPGF---------HGYPRCRPCDCHEAGTA-PGVCDPLTGQCYCKENVQGPKCDQCSLGTFSLDAANPKGCTRCFCFGATE-RCRS--SSYTRQEF 1647          

HSP 7 Score: 56.9954 bits (136), Expect = 1.400e-7
Identity = 61/229 (26.64%), Postives = 80/229 (34.93%), Query Frame = 2
Query:  869 PKPKKSNIFRFARNSPKKILSISDISIGGRCKCNG---HANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPA-----------QCKKCECNLHSSNC------YFSQDLYILRKQITGGVCTN---------CQHNTAGVRCHYCNDGYYRDWTKPLDHKFV-CKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPC 1465
            P P  SN      ++ +++L    I     C C+      NAC K+P   +  C+C+ N +G  CE C   +          +SP            QC+ C      + C      YF   L  L      G             CQ   AG  C  C  GY         H F  C+ CTC   GA   D+     G C C+ G TG  C  C+ GF    S   PC
Sbjct:  473 PTPSSSN------DTREQVLPAGQIV---NCDCSAAGTQGNACRKDPRVGR--CLCKPNFQGTHCELCAPGFYGPGCQPCQCSSPGVADDRCDPDTGQCR-CRVGFEGATCDRCAPGYFHFPLCQLCGCSPAGTLPEGCDEAGRCLCQPEFAGPHCDRCRPGY---------HGFPNCQACTCDPRGAL--DQLCGAGGLCRCRPGYTGTACQECSPGFHGFPSC-VPC 677          

HSP 8 Score: 56.6102 bits (135), Expect = 1.631e-7
Identity = 41/160 (25.62%), Postives = 64/160 (40.00%), Query Frame = 2
Query:  956 RCKCNG-HANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECN--LHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCA 1426
            RC C      AC+ +       C+C+    G+ C++C++ +          +    C+ C C      S C+              G C +C+  T G +C  C  GY   W  P      C++C C         RCD  TG+C C  G++GE C+ C+
Sbjct: 2022 RCDCTPCGTEACDPH----SGHCLCKAGVTGRRCDRCQEGHFGF-------DGCGGCRPCACGPAAEGSECH-----------PQSGQC-HCRPGTMGPQCRECAPGY---WGLPEQG---CRRCQCP------GGRCDPHTGRCNCPPGLSGERCDTCS 2146          

HSP 9 Score: 56.6102 bits (135), Expect = 1.853e-7
Identity = 38/139 (27.34%), Postives = 55/139 (39.57%), Query Frame = 2
Query: 1019 CVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKF-VCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASG 1432
            C+CQ    G  C++C+  Y   P           C+ C C+   +         + +    GG+C  C+    G  C  C+ G+         H F  C  C C   G+     CD R+GQC C+  VTG  C+ C  G
Sbjct:  605 CLCQPEFAGPHCDRCRPGYHGFP----------NCQACTCDPRGA---------LDQLCGAGGLC-RCRPGYTGTACQECSPGF---------HGFPSCVPCHCSAEGS-LHAACDPRSGQCSCRPRVTGLRCDTCVPG 713          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 311.612 bits (797), Expect = 4.913e-97
Identity = 192/641 (29.95%), Postives = 321/641 (50.08%), Query Frame = 2
Query:  194 RYIFTVYFSM--FYKFVLSQLHMNNLTPSPCYAH-GSAYQCMPPFTNIVENMIPKIETLC---KKKEVCPIKSPRD---------------------NLITDYHLTHNQTCWKSVP-LQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEG--AYENVGDSSLI-DWMSASDIRITLFKFDNPKPKKSNIFRFARN------------SPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK------YIQMESAE--NKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKF 1963
            RY+  +YF M   +    SQ  M      PC+ H G   +C+P F N            C   +  + C +K   D                     +L+TD +   N TCW S P L   +V++T S  K+FE+ Y+S+  C S +P+++A YKS +FG TW P+ + ++ C  +F       P +       +  EQ A C    + +      VAF   LE   + +N  +S ++ DW++A+DI++    F    P ++ ++  + +              +   S+ ++++GGRCKCNGHA+ C  + +  +  C C+HNT G +CE CK  + D PW RAT NS   C  C CN H+  C F  +L+ L    +GGVC NC+HNTAG  CH C  G+ RD + P+ H+  CK C CH +G+     C++ +GQC+CK GVTG  CNRCA G++QS ST TPC+K      +I    +E  ++C  C     R+  +KFC++D      + S+E++  + ++ + V++++  K   +++  G  S                   +W+  + + C C +L++G+ YLL+ K+ + H ++    L+ +P+++++ W      ++ RF +K + G+C + 
Sbjct:    7 RYVLALYFCMGIAHGAYFSQFSMRAPDHDPCHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVSTPSLSPQNVSLTLSLGKKFELTYVSMHFC-SRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGRD----PDVSIT----KSNEQEAVCTASHI-MGPGGNRVAF-PFLENRPSAQNFENSPVLQDWVTATDIKVV---FSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKM-GRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGS-LGKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVF--KRGTENMQRGETS-------------------LWISPQGVICKCPKLRVGRRYLLLGKNDSDHERDG---LMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEI 607          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 311.612 bits (797), Expect = 4.913e-97
Identity = 192/641 (29.95%), Postives = 321/641 (50.08%), Query Frame = 2
Query:  194 RYIFTVYFSM--FYKFVLSQLHMNNLTPSPCYAH-GSAYQCMPPFTNIVENMIPKIETLC---KKKEVCPIKSPRD---------------------NLITDYHLTHNQTCWKSVP-LQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEG--AYENVGDSSLI-DWMSASDIRITLFKFDNPKPKKSNIFRFARN------------SPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK------YIQMESAE--NKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKF 1963
            RY+  +YF M   +    SQ  M      PC+ H G   +C+P F N            C   +  + C +K   D                     +L+TD +   N TCW S P L   +V++T S  K+FE+ Y+S+  C S +P+++A YKS +FG TW P+ + ++ C  +F       P +       +  EQ A C    + +      VAF   LE   + +N  +S ++ DW++A+DI++    F    P ++ ++  + +              +   S+ ++++GGRCKCNGHA+ C  + +  +  C C+HNT G +CE CK  + D PW RAT NS   C  C CN H+  C F  +L+ L    +GGVC NC+HNTAG  CH C  G+ RD + P+ H+  CK C CH +G+     C++ +GQC+CK GVTG  CNRCA G++QS ST TPC+K      +I    +E  ++C  C     R+  +KFC++D      + S+E++  + ++ + V++++  K   +++  G  S                   +W+  + + C C +L++G+ YLL+ K+ + H ++    L+ +P+++++ W      ++ RF +K + G+C + 
Sbjct:    7 RYVLALYFCMGIAHGAYFSQFSMRAPDHDPCHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVSTPSLSPQNVSLTLSLGKKFELTYVSMHFC-SRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGRD----PDVSIT----KSNEQEAVCTASHI-MGPGGNRVAF-PFLENRPSAQNFENSPVLQDWVTATDIKVV---FSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKM-GRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGS-LGKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVF--KRGTENMQRGETS-------------------LWISPQGVICKCPKLRVGRRYLLLGKNDSDHERDG---LMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEI 607          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: lam-2 (Laminin-like protein lam-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18823])

HSP 1 Score: 175.637 bits (444), Expect = 1.757e-45
Identity = 132/456 (28.95%), Postives = 202/456 (44.30%), Query Frame = 2
Query:  215 FSMFYKFVLSQLHMNNLTPS-----------PCYAHGS--AYQCMPPFTNIVENMIPKIETLCKKK---------------EVCPIKSPRDN-------LITDYHLTHNQTCWKSVPLQANH-----VNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFN---TVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPIT---NKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            FS+   + + Q     L PS           PCY   +    +C+P F N   N+  ++   C  K                VC     R          +TD+++ +N+T W+S  +Q         N+T    K F++ Y+ L    S  P +   YK  +    W+PW + + +C + + + +   P L  N       E  A+C       +D  P+   N   + LEG   A+       L  W++AS IRI+L + +    +   +F+  +       +ISD ++GGRCKCNGHA+ C  +      N++ C C+HNT+G DC +C   Y D PW   T     +C  C C+  S+ CYF Q L+   +   GG C +CQ NT GV C  C       W +P ++   C  C C+ IG+    +CD   G+C CK GVTG  C++C  GF
Sbjct:    8 FSLAVLWHMGQPQPAELYPSVDPNHFGADGNPCYDRATRQPQRCVPDFVNAAFNLEVQVTNTCGTKRPTKFCVQSGHTGQRSVCETCDDRHEGFSHPAKYLTDFNVGNNETWWQSDTMQEGQQYPTTTNLTLVLGKSFDITYVRLKFI-SPRPESFTIYKKTHTDSEWEPWQFYSGSCRATYGLSDRA-PILPGN-------EATAQCTK---EFSDISPITGGNIAFSTLEGRPSAHAFEESEVLQKWVTASAIRISLNRMNTFGDE---VFKDPQVLRSYYYAISDFAVGGRCKCNGHASECVGSSSVDGENRLVCRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQLF--EETGHGGHCIDCQGNTQGVHCEQC---IANHWRRPGEN--YCVACGCNEIGS-LSTQCDNE-GKCQCKPGVTGRFCDQCLDGF 439          

HSP 2 Score: 72.7886 bits (177), Expect = 6.388e-13
Identity = 59/188 (31.38%), Postives = 86/188 (45.74%), Query Frame = 2
Query:  956 RCKCNGHANACNKNPITN--KIECVCQH---NTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCAS---GFRQSNSTETPCVKYIQMESAE 1495
             C C+G+ +    N I N  KI   C+    NT G +CE CK  Y    W  A +     C+ C C   +     + D  +L      G C +C  N  G++C  C  G+Y      +     C++C C  +G++  + CD  TGQC CK GVTG+ C+RCA    GF  +      C +YI  E+ +
Sbjct:  834 ECACSGNTDP---NSIGNCDKITGECKKCIFNTHGFNCENCKPGY----WGDALIEPKGNCQSCGC-FAAGTRRPNNDYTLLECNQQDGQC-DCLPNVIGIQCDQCAHGFYN-----ITSGLGCQECNCDPLGSE-GNTCDVNTGQCQCKPGVTGQRCDRCADYHFGFSANGCQPCDC-EYIGSENQQ 1005          

HSP 3 Score: 68.5514 bits (166), Expect = 1.175e-11
Identity = 56/211 (26.54%), Postives = 83/211 (39.34%), Query Frame = 2
Query:  956 RCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECN------LHSSN---CYFSQDLYILRK------------------------------------QITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPD------RCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            +C C+ H+N+C     +    C+C+HNT G  CE+C + Y    +  A   +   C+KC C       LH+     C    + Y  R+                                    +IT G C  C  NT G  C  C  GY+ D    ++ K  C+ C C   G + P+       C+++ GQC C   V G  C++CA GF
Sbjct:  735 KCDCHNHSNSCEAESGS----CICEHNTAGDTCERCARGY----YGDALQGTEEDCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGNTDPNSIGNCDKIT-GECKKCIFNTHGFNCENCKPGYWGDAL--IEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGF 934          

HSP 4 Score: 53.9138 bits (128), Expect = 4.049e-7
Identity = 54/192 (28.12%), Postives = 79/192 (41.15%), Query Frame = 2
Query:  911 SPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCH-----IIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK 1471
            S K I  +S++++G         +A N    T    C C     GQ CE C+  +          N    C KC+C+ HS++C           +   G C  C+HNTAG  C  C  GYY D  +  +    C+KC C      I+ A     C +      C +G TG  C+ C+ G+  +    T CV+
Sbjct:  669 SYKDIGYLSNVNLG---TAGVAPSAANPKQATWIEHCECLPGFVGQFCESCESGFRRETKFGGPFN---HCIKCDCHNHSNSC-----------EAESGSCI-CEHNTAGDTCERCARGYYGDALQGTEED--CQKCPCPNDGPCILHADGDVICTE------CPNGYTGRRCDECSDGYFGNPKDGTECVE 834          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: lam-3 (LAMinin related. See also lmb; Laminin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5ECE3])

HSP 1 Score: 159.073 bits (401), Expect = 5.068e-40
Identity = 125/409 (30.56%), Postives = 185/409 (45.23%), Query Frame = 2
Query:  416 DYHLTHNQTCWKSVPLQAN-----HVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLA---TNCLSMFNMKETT-IPSLQFNDFRIQRREQAARCFPLK-----LSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSP--------KKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQIT-------GGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRC---------DKRTGQCLCKSGVTGEMCNRCASGFRQSNSTET-PC-----VKYIQMESAENKCKA 1510
            +Y +   +  W+S P  AN      VNIT    + ++V YI L    S  P      KS + G  ++PW Y A     C+  F +  TT +P  Q  D  +    + ++  PL+      SL +  P  A NT LE          L  +  A  +R+ L    +P+   +++    + S         +   SISDISIGG+C C GHA +C  +P+T + +C C+HNT G+ C +C   +  LPW   T + P  C++C+C  H+ +C +  +L   +  IT       GG C  C HNT G  C  C DGYYR        +  C+ C C  +G+   D C          ++ G C+CK G  G  C RCA G+R   + E  PC     V +   + A  +CKA
Sbjct:  110 EYAIDGTRRWWQS-PSLANGLRFEKVNITIDLRQEYQVAYIILKMGNSPRPGTWVLEKSLD-GEYYEPWQYYAMQDAECMRQFGIPATTGVPRFQKED-EVHCTSEYSKITPLENGEIHTSLVNGRPG-AENTSLE----------LQKFTRARFVRLRLI---SPRTLNADLMIINKKSDSLDKSVTMRYFYSISDISIGGQCICYGHAESCPSDPVTGQFKCECRHNTCGESCNRCCPLFNQLPWKPGTNSHPNVCQQCQCFNHAHSCVYDDELDRNKWSITPEGVYEGGGRCLECAHNTEGFNCERCKDGYYRPSGLSHYREDACRTCECDPVGS-VSDACVRDDQSAENGQKPGDCICKPGFGGRRCERCAPGYRNHPTCEPCPCNRAGSVNFDTCDGASCQCKA 500          

HSP 2 Score: 77.0258 bits (188), Expect = 3.502e-14
Identity = 60/168 (35.71%), Postives = 85/168 (50.60%), Query Frame = 2
Query:  950 GGRC-KCNGHANACNKNPITNKIECV-CQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCEC---NLHSSNCYFSQDLYILRKQITGG---VCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHI-IGAKFPDRCDKRTGQCL-CKSGVTGEMCNRC 1423
            GGRC KC+ H N+   +P T   EC+ C+HNT G  CE CK  ++  P     + +   C++CEC   +L+ +    S +L +L    +     VC NC     G +C YC+DG++ D   PL  K  C +CTC+  I       CD  TG+CL C    TG+ C  C
Sbjct:  768 GGRCEKCDCHGNSEECDPFTG--ECLNCRHNTTGSRCELCKPGHVGNPSRGGELGA---CEQCECPSLDLNPNPECISTELAVLGSVASNEDNYVCINCPLGYEGNKCEYCSDGFFED---PLTGK--CIECTCNGNIDPMGIGNCDSETGKCLKCIGHTTGDSCESC 925          

HSP 3 Score: 73.559 bits (179), Expect = 4.680e-13
Identity = 53/155 (34.19%), Postives = 68/155 (43.87%), Query Frame = 2
Query:  959 CKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRC 1423
            C C+GH+  CN +     +   C+HNT G  CE C   Y+      A       C KC C L  ++  FS D  +      G VC +C+    G  C  C  GYY D   P      C  C CH  G+     C+  +GQC CK GVTG  C+ C
Sbjct: 1540 CSCHGHSQTCNPD---TSVCTDCEHNTFGDFCEHCLPGYI----GDAREGGANACTKCACPLVENS--FS-DSCVAVDHGRGYVCNSCKPGYTGQYCETCVAGYYGD---PQHIGGTCSPCDCHPDGS-LHGACNPLSGQCECKPGVTGRTCSMC 1680          

HSP 4 Score: 63.5438 bits (153), Expect = 4.435e-10
Identity = 43/140 (30.71%), Postives = 66/140 (47.14%), Query Frame = 2
Query: 1016 ECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            EC C+ N  G  C++CK+N+ D+            C  C+CN   S      D      Q++G    NC+    G +C  C   Y+ ++T        C+ C C+I G+    +CD+ TG+C C+  V G MC +CA G+
Sbjct:  959 ECECKENYIGAQCDRCKENHGDVENG---------CPACDCNDTGS---IGSDC----DQVSGQC--NCKQGVFGKQCDQCRPSYF-NFTDA-----GCQFCHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEKCADGY 1074          

HSP 5 Score: 60.8474 bits (146), Expect = 3.501e-9
Identity = 41/140 (29.29%), Postives = 64/140 (45.71%), Query Frame = 2
Query: 1016 ECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            +C C+    G+ C++C+ +Y +         + A C+ C CN++ S       +   +   T G C  C+ N  G  C  C DGY+      +     C+ C C   G++    C+  TGQC+CK GVTG  C+ C   F
Sbjct: 1006 QCNCKQGVFGKQCDQCRPSYFNF--------TDAGCQFCHCNIYGS-------IEDGKCDQTTGKC-ECRENVEGTMCEKCADGYFN-----ITSGDGCEDCGCDPTGSE-DVSCNLVTGQCVCKPGVTGLKCDSCLPNF 1123          

HSP 6 Score: 50.0618 bits (118), Expect = 7.496e-6
Identity = 49/189 (25.93%), Postives = 70/189 (37.04%), Query Frame = 2
Query:  959 CKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVN---SPAQCKKCECNLHSSNCYFSQDLYILR--------KQITGGVCTNCQH-------------------NTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            C CN + +  +        +C C+ N EG  CEKC   Y ++       +    P   +   CNL +  C     +  L+          +T   CT C+                    NT G  C  C    + D+  PL+    CK C C  IG+     C+  TGQC CK+   G  C+ C  GF
Sbjct: 1036 CHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEKCADGYFNITSGDGCEDCGCDPTGSEDVSCNLVTGQCVCKPGVTGLKCDSCLPNFYGLTSEGCTECEPCPAPGQVCDPIDGSCVCPPNTVGEMCENCTTNAW-DY-HPLNG---CKLCDCSDIGSD-GGMCNTFTGQCKCKAAYVGLKCDLCTHGF 1218          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: lam-1 (LAMinin related. See also lmb [Source:UniProtKB/TrEMBL;Acc:V6CIX7])

HSP 1 Score: 145.206 bits (365), Expect = 1.510e-35
Identity = 104/373 (27.88%), Postives = 165/373 (44.24%), Query Frame = 2
Query:  401 DNLITDYHLTHNQTCWKSVPLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARN--------SPKKILSISDISIGGRCKCNGHANAC-------NKNPITNKIE-----CVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKR--------TGQCLCKSGVTGEMCNRCASGF 1435
            +N++T+     N+  W      A +V+I+F     F   ++ +T  +S  P A+   +S +FG TW+ + Y A +C S F       P    +                 +  T     VA +T  E  Y+ +    + +   A +I  TL K  N +   + +     +          K   +I +I + G C C GHA+ C       + N +  + +     C C HNTEG +CEKCK  Y DLPW  A  +   +C++C CN H+  C+F + +Y     ++GGVC +C HNT G  C  C   +YRD  + +D   VC  C C   G++    C+           G+C CK+ V G  C+RC +G+
Sbjct:  101 ENVVTEVMDDKNRN-WYQSENGAQNVSISFDLEAEFHFTHLIMTF-KSFRPAAMIIERSADFGKTWQVYRYFAYDCDSSFPGIPEGPPKKHTD-----------------VICTSQYSDVAPSTGGEIVYKVISPHIVTENPYADEIS-TLLKITNLRFNFTKLHTLGDDLLDYRPEIDEKYYYAIYEIVVRGSCSCYGHASRCIPIDPHVSPNTVMERADIVHGRCECMHNTEGLNCEKCKAFYNDLPWRPAIGDEKNECRQCNCNRHALRCHFDRAVYESSGFVSGGVCDDCMHNTQGKNCEQCKPFFYRDPRRTIDDPHVCLPCECDKAGSQNKGICEGEEDAERGLVAGKCYCKTNVDGNRCDRCKNGY 453          

HSP 2 Score: 80.1073 bits (196), Expect = 3.423e-15
Identity = 61/199 (30.65%), Postives = 91/199 (45.73%), Query Frame = 2
Query:  956 RCKCNGHANACN--------KNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSN----CYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACD 1516
            +C CN HA  C+           ++  +   C HNT+G++CE+CK  +   P  R T++ P  C  CEC+   S     C   +D     + +  G C  C+ N  G RC  C +GY+      +D    C  CTC+++G    + CDK TG C CK  VTGE C++C               ++  +    + CKACD
Sbjct:  343 QCNCNRHALRCHFDRAVYESSGFVSGGVCDDCMHNTQGKNCEQCKPFFYRDP--RRTIDDPHVCLPCECDKAGSQNKGICEGEEDA---ERGLVAGKCY-CKTNVDGNRCDRCKNGYWNLTETNVDG---CVACTCNLLGTYNNEGCDKYTGMCTCKRLVTGENCDQCLP-------------EHYGLSEHVDGCKACD 519          

HSP 3 Score: 67.0106 bits (162), Expect = 4.296e-11
Identity = 45/156 (28.85%), Postives = 70/156 (44.87%), Query Frame = 2
Query:  974 HANAC---NKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRK-QITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGA-KFPDRCDKRTGQCLCKSGVTGEMCNRCA 1426
            HA+ C   N    T  I C C+   +G+ C +C +N+   P           C++C+CN        + D+ +        G C  C H+T G +C +C DGYY D          C++C C+ +G       CD+ +GQC C   + G  C++CA
Sbjct:  936 HADTCYLRNSGNNTQDIVCNCKSGYQGERCGECAQNHWGSPREVG-----GTCERCDCN-------GNIDMAMEGSCDAATGECLKCLHHTEGAQCEHCVDGYYGDAKLK-----TCQRCVCNELGTNSTKGACDRVSGQCPCHDNIIGMQCDQCA 1074          

HSP 4 Score: 60.8474 bits (146), Expect = 2.918e-9
Identity = 42/140 (30.00%), Postives = 66/140 (47.14%), Query Frame = 2
Query: 1016 ECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            +C C  N  G  C++C +N+ +L        S A C+ C C+ +       + +  L+  I  G C  C+    G +C  C D Y+ D T P      C +C C+  G+K   +C +  G C C++G  G +CN CA G+
Sbjct: 1058 QCPCHDNIIGMQCDQCAENHFNLA-------SGAGCEACGCDSNGV-VLNHEGVPHLQCNIFDGQC-QCKPGRGGRKCDQCEDLYWGDPTTPDG----CHRCECNPTGSKSL-QCHRNNGTCECQAGSGGALCNECARGY 1183          

HSP 5 Score: 53.1434 bits (126), Expect = 8.098e-7
Identity = 45/148 (30.41%), Postives = 58/148 (39.19%), Query Frame = 2
Query: 1016 ECVC-QHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTC---HIIGAKFPDRCDKRTGQ-------CLCKSGVTGEMCNRCA 1426
            +CVC +    G+ C +C+  +   P          +C+ C+CN H++ C  S            G C  C+  T G  C  C DGYY D    L     CK C C      G +  D C  R          C CKSG  GE C  CA
Sbjct:  845 QCVCREKGIYGRQCNQCQPGFWGFP----------ECRTCQCNDHANICDQSS-----------GACIECRDLTTGHYCDRCQDGYYGD--PRLGVGIPCKPCPCPGGPTSGYQHADTCYLRNSGNNTQDIVCNCKSGYQGERCGECA 969          
BLAST of Netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0073942)

HSP 1 Score: 286.189 bits (731), Expect = 4.371e-86
Identity = 199/723 (27.52%), Postives = 315/723 (43.57%), Query Frame = 2
Query:  209 VYFSMFYKFVLSQLHMNNLTPSPCY--AHGSAYQCMPPFTNIVENMIPKIETLCKK---KEVC----------------PIKSPRDNLITDYHLTHNQTCWKSVPL--QANHVNITFSFAKRFEVYYISLTPC-ESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSS--LIDWMSASDIRITLFKFDNPKPK-------------------------------KSNIFRFARNSPKKI-LSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK----YIQMESAEN-------------------------------------KCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWH--SKNSIKDLYPGIFSQPIM------------------------------------RPSSKSRLNNRPTNP---------IW-LKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQK 1936
            VYF MF +    +         PCY  AH     C+P F N   +      + C     +  C                P++S     +TD + ++N TCW+S P+    ++V +T S  K+FE+ Y+ L  C  +  P+++  YKS + G++W+P+ + ++ C  +F       P+ Q      +  E  ARC  +   L      +AF+T+         DSS  L DW++A+DIR+   +   P P+                               ++N+      S   +  +ISD S+GGRCKCNGHA+ C+ +  + ++ C C HNT G+DCE+CK  + D PWARAT     +CK+C CN H+  C F+ +++ L + ++GGVC NC+H+T G  CH C +G+YRD TKPL H+ VCK C CH IG+     C+  +GQC CK GVTG  CNRCA G++QS S   PC+K     I M   +N                                     +C  C     R+   KFC++D    A +  ++   + +  +V    +    +   +  + PG    PI                                     RP   S   N    P          W +  +DL+C C ++++ ++YL++ + +    +     L   P SI++ W   W RR+ RF+++
Sbjct:   25 VYFKMFSQQAPPE--------DPCYNKAH-EPRACIPDFVNAAYDAPVVASSTCGSSGAQRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGR-----PARQSTG---RHNEHEARCSDVTRPLVSR---IAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTD-ASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSG-KICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAIMAKVIGRDTSSEAVSREVQRRAMDPDVADYEMDQVQPGSARSPITGVYEFQAADYPNPNPNPRGSEMERFDLQIQAVFKRSRPGESSGAGNVYGMPNTTLKRGPMTWIIPTKDLECRCPRIRVNRSYLILGRDS----EAPPGYLGIGPHSIVIEWKEDWYRRMKRFQRR 721          
BLAST of Netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0346088)

HSP 1 Score: 286.189 bits (731), Expect = 4.371e-86
Identity = 199/723 (27.52%), Postives = 315/723 (43.57%), Query Frame = 2
Query:  209 VYFSMFYKFVLSQLHMNNLTPSPCY--AHGSAYQCMPPFTNIVENMIPKIETLCKK---KEVC----------------PIKSPRDNLITDYHLTHNQTCWKSVPL--QANHVNITFSFAKRFEVYYISLTPC-ESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSS--LIDWMSASDIRITLFKFDNPKPK-------------------------------KSNIFRFARNSPKKI-LSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK----YIQMESAEN-------------------------------------KCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWH--SKNSIKDLYPGIFSQPIM------------------------------------RPSSKSRLNNRPTNP---------IW-LKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQK 1936
            VYF MF +    +         PCY  AH     C+P F N   +      + C     +  C                P++S     +TD + ++N TCW+S P+    ++V +T S  K+FE+ Y+ L  C  +  P+++  YKS + G++W+P+ + ++ C  +F       P+ Q      +  E  ARC  +   L      +AF+T+         DSS  L DW++A+DIR+   +   P P+                               ++N+      S   +  +ISD S+GGRCKCNGHA+ C+ +  + ++ C C HNT G+DCE+CK  + D PWARAT     +CK+C CN H+  C F+ +++ L + ++GGVC NC+H+T G  CH C +G+YRD TKPL H+ VCK C CH IG+     C+  +GQC CK GVTG  CNRCA G++QS S   PC+K     I M   +N                                     +C  C     R+   KFC++D    A +  ++   + +  +V    +    +   +  + PG    PI                                     RP   S   N    P          W +  +DL+C C ++++ ++YL++ + +    +     L   P SI++ W   W RR+ RF+++
Sbjct:   25 VYFKMFSQQAPPE--------DPCYNKAH-EPRACIPDFVNAAYDAPVVASSTCGSSGAQRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGR-----PARQSTG---RHNEHEARCSDVTRPLVSR---IAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTD-ASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSG-KICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAIMAKVIGRDTSSEAVSREVQRRAMDPDVADYEMDQVQPGSARSPITGVYEFQAADYPNPNPNPRGSEMERFDLQIQAVFKRSRPGESSGAGNVYGMPNTTLKRGPMTWIIPTKDLECRCPRIRVNRSYLILGRDS----EAPPGYLGIGPHSIVIEWKEDWYRRMKRFQRR 721          
BLAST of Netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0308337)

HSP 1 Score: 271.552 bits (693), Expect = 3.258e-81
Identity = 161/479 (33.61%), Postives = 241/479 (50.31%), Query Frame = 2
Query:  209 VYFSMFYKFVLSQLHMNNLTPSPCY--AHGSAYQCMPPFTNIVENMIPKIETLCKKK---------------EVC----PIKSPRDNLITDYHLTHNQTCWKSVPL--QANHVNITFSFAKRFEVYYISLTPC-ESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSS--LIDWMSASDIRITLFKFDNPKPK-------------------------------KSNIFRFARNSPKKI-LSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK 1471
            VYF MF +    +         PCY  AH     C+P F N   +      + C                    C    P++S     +TD + ++N TCW+S P+    ++V +T S  K+FE+ Y+ L  C  +  P+++  YKS + G++W+P+ + ++ C  +F       P+ Q      +  E  ARC  +   L      +AF+T+         DSS  L DW++A+DIR+   +   P P+                               ++N+      S   +  +ISD S+GGRCKCNGHA+ C+ +  + ++ C C HNT G+DCE+CK  + D PWARAT     +CK+C CN H+  C F+ +++ L + ++GGVC NC+H+T G  CH C +G+YRD TKPL H+ VCK C CH IG+     C+  +GQC CK GVTG  CNRCA G++QS S   PC+K
Sbjct:   25 VYFKMFSQQAPPE--------DPCYNKAH-EPRACIPDFVNAAYDAPVVASSTCGSSGAQRYCEYQDHERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSGDNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGR-----PARQSTG---RHNEHEARCSDVTRPLVSR---IAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTD-ASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGSSG-KICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIK 481          
BLAST of Netrin 1 vs. Ensembl Fly
Match: NetB (gene:FBgn0015774 transcript:FBtr0304875)

HSP 1 Score: 225.328 bits (573), Expect = 2.659e-63
Identity = 133/412 (32.28%), Postives = 202/412 (49.03%), Query Frame = 2
Query:  929 SISDISIGGRCKCNGHANAC-------NKNPITNK-----------------------------IECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK------YIQMESA----------------------ENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIK---DLYP------GIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEK 1945
            ++SD ++GGRCKCNGHA+ C       +   ++++                             + C C+HNT G +CE+CK  Y D PW RAT N   +CK C+CN H+  C F+ +LY L  +++GGVC NCQH+T G  CHYC +GYYRD TKP +H+ VCK+C CH +G+     C+  +GQC CK GVTG  CNRCA G++Q+ S   PC+K       IQ ESA                      +  C  C +   ++   KFC +D           I+   I  D    +I   K SI+   ++Y        IF +  M  ++ S L  R    + +  + ++C C +++L ++YL++ + +    +     L   P S++L W   W  R+ RF+++  K
Sbjct:  395 AVSDFAVGGRCKCNGHASECVATVSSGSGTALSDQDDGQDEDTPSAPSLANHFGRSTQMSAKLTMTCACKHNTAGPECERCKPFYFDRPWGRATDNDANECKMCQCNGHARRCRFNLELYKLSGRVSGGVCYNCQHDTTGRYCHYCREGYYRDATKPPNHRKVCKRCDCHPVGSTG-KTCNHLSGQCPCKEGVTGLTCNRCARGYQQTRSHVAPCIKVPTNANMIQAESAGGGGGGGTGDYKDGGGSQVEEMKKYCGKCKASPKKLNLNKFCMEDYA---------ILAKVIGHDRASQDISTEKFSIERQNEIYKYEINIQTIFKRNPMSGTTSSLL-GRGNMMLLVPRKSIECQCPKIKLNKSYLILGRDS----EAAPGYLAIGPSSVVLEWKDEWSLRMKRFQRRARK 791          

HSP 2 Score: 93.9745 bits (232), Expect = 1.548e-19
Identity = 67/240 (27.92%), Postives = 108/240 (45.00%), Query Frame = 2
Query:  275 PCYAHGSAYQCMPPFTNIVENMIPKIETLCKKKE-----------------VCPIKSPRDNLITDYHLTHNQTCWKSVPLQANH---------VNITFSFAKRFEVYYISLTPC-ESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLI--DWMSASDIRITLFKFDNP----KPKKSNIF 895
            PCY  G   +C+P F N       +  ++C  ++                  C  +      +TD +   N TCW+S  +   H         V +T S  K++E+ YISL+ C  S  P+++A +KS++FG TW+P+ + ++ C   +   +    S +FN       EQ ARC   +          AFNT+      N  DSSL+  DW++A+DIR+   + + P    K K +N F
Sbjct:   33 PCYFEGKPRKCLPSFVNAAYGNPVQASSVCGAQQPERYCELLRDGNAGECRSCEQQRYGPAALTDLNNPSNVTCWRSGAVNVPHDPDSAPPDNVTLTLSLGKKYELTYISLSFCPRSPRPDSLAIFKSSDFGQTWQPFQFYSSQCQKFYGRPDRAKIS-KFN-------EQEARCINSQHDTGGAAQRFAFNTLEGRPSANDLDSSLVLQDWVTATDIRVVFHRLELPPQLLKVKNANAF 264          
BLAST of Netrin 1 vs. Ensembl Fly
Match: NetB (gene:FBgn0015774 transcript:FBtr0302018)

HSP 1 Score: 225.328 bits (573), Expect = 2.659e-63
Identity = 133/412 (32.28%), Postives = 202/412 (49.03%), Query Frame = 2
Query:  929 SISDISIGGRCKCNGHANAC-------NKNPITNK-----------------------------IECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK------YIQMESA----------------------ENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIK---DLYP------GIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEK 1945
            ++SD ++GGRCKCNGHA+ C       +   ++++                             + C C+HNT G +CE+CK  Y D PW RAT N   +CK C+CN H+  C F+ +LY L  +++GGVC NCQH+T G  CHYC +GYYRD TKP +H+ VCK+C CH +G+     C+  +GQC CK GVTG  CNRCA G++Q+ S   PC+K       IQ ESA                      +  C  C +   ++   KFC +D           I+   I  D    +I   K SI+   ++Y        IF +  M  ++ S L  R    + +  + ++C C +++L ++YL++ + +    +     L   P S++L W   W  R+ RF+++  K
Sbjct:  395 AVSDFAVGGRCKCNGHASECVATVSSGSGTALSDQDDGQDEDTPSAPSLANHFGRSTQMSAKLTMTCACKHNTAGPECERCKPFYFDRPWGRATDNDANECKMCQCNGHARRCRFNLELYKLSGRVSGGVCYNCQHDTTGRYCHYCREGYYRDATKPPNHRKVCKRCDCHPVGSTG-KTCNHLSGQCPCKEGVTGLTCNRCARGYQQTRSHVAPCIKVPTNANMIQAESAGGGGGGGTGDYKDGGGSQVEEMKKYCGKCKASPKKLNLNKFCMEDYA---------ILAKVIGHDRASQDISTEKFSIERQNEIYKYEINIQTIFKRNPMSGTTSSLL-GRGNMMLLVPRKSIECQCPKIKLNKSYLILGRDS----EAAPGYLAIGPSSVVLEWKDEWSLRMKRFQRRARK 791          

HSP 2 Score: 93.9745 bits (232), Expect = 1.548e-19
Identity = 67/240 (27.92%), Postives = 108/240 (45.00%), Query Frame = 2
Query:  275 PCYAHGSAYQCMPPFTNIVENMIPKIETLCKKKE-----------------VCPIKSPRDNLITDYHLTHNQTCWKSVPLQANH---------VNITFSFAKRFEVYYISLTPC-ESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLI--DWMSASDIRITLFKFDNP----KPKKSNIF 895
            PCY  G   +C+P F N       +  ++C  ++                  C  +      +TD +   N TCW+S  +   H         V +T S  K++E+ YISL+ C  S  P+++A +KS++FG TW+P+ + ++ C   +   +    S +FN       EQ ARC   +          AFNT+      N  DSSL+  DW++A+DIR+   + + P    K K +N F
Sbjct:   33 PCYFEGKPRKCLPSFVNAAYGNPVQASSVCGAQQPERYCELLRDGNAGECRSCEQQRYGPAALTDLNNPSNVTCWRSGAVNVPHDPDSAPPDNVTLTLSLGKKYELTYISLSFCPRSPRPDSLAIFKSSDFGQTWQPFQFYSSQCQKFYGRPDRAKIS-KFN-------EQEARCINSQHDTGGAAQRFAFNTLEGRPSANDLDSSLVLQDWVTATDIRVVFHRLELPPQLLKVKNANAF 264          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn2 (netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2])

HSP 1 Score: 340.502 bits (872), Expect = 8.436e-108
Identity = 209/644 (32.45%), Postives = 322/644 (50.00%), Query Frame = 2
Query:  203 FTVYFSMFYKFVLSQLHMN-----NLTPS-PCYAH-GSAYQCMPPFTNIVENMIPKIETLCKKK-------------------EVCPIKSPRD----NLITDYHLTHNQTCWKSVPLQANHVNITF--SFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARC-------FPLKLSLTDNEPVVAFNTVLEGAYENVGDSS--LIDWMSASDIRITLFKFDNPK--PKKSNIFRFARNSPKKI----LSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQME-----SAENKCKACDS------KRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            F    SM   F  S    N      +TP+ PCY   G+A +C+P F N        + ++C +                    ++C    PR+    + +TD +  HN TCW+S  LQ++ +N+T   S  K+FE+ Y+SL  C S  P ++A YKS ++G TW P+ + ++ C  M+N       + Q         EQ A C       +PL   L      +AF+T+         DSS  L DW++ +DIR+   +  + +  P        A  +P  +     ++ D  +GGRCKCNGHA+ C +     K+ C C+HNTEG +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD  K + H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K   ++     S   +   CDS         +I  +K+C+KD     ++   E +GD+ +F V++ +++ S+             P+           R  + +W+ ++DL C C ++ +G+ + LI+ ST          L     S+++ W   W RRL +F++K++KG+CSK
Sbjct:    4 FQTLLSMLTVFQASSHSPNPFSGPQVTPTDPCYEETGAARRCIPEFINAAFGQEVSVSSVCGRPVSRSCSLVERDDRPAVRTCQICDASDPRNAHPASYLTDLNSAHNLTCWQSENLQSSPLNVTLTLSLGKKFEITYVSLQFC-SPRPESLAIYKSMDYGRTWTPYQFYSSQCRRMYNRPNKAAITKQ--------NEQEALCTDGHTDLYPLSGGL------IAFSTLDGRPSGKDFDSSPVLQDWVTVTDIRVVFSRPQHTRALPMSGRESEDALGAPGSLPTYYYAVGDFQVGGRCKCNGHASRCVREK-DGKLLCECKHNTEGPECDRCKPFHYDRPWQRATGKEANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGKAITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVIKPTAVISTTEEPADCDSYCKPLKGNLKINMKKYCKKDYAVQVSVLDMETVGDWAKFSVSLMSVYKSRG-----------DPL----------KRGDHMLWVHMKDLACKCPRIHMGKRF-LILGSTEGTANPERPGLQADKNSLVIQWRDIWTRRLRKFQRKEKKGKCSK 608          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn2 (netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2])

HSP 1 Score: 338.576 bits (867), Expect = 3.569e-107
Identity = 203/619 (32.79%), Postives = 316/619 (51.05%), Query Frame = 2
Query:  263 LTPS-PCYAH-GSAYQCMPPFTNIVENMIPKIETLCKKK-------------------EVCPIKSPRD----NLITDYHLTHNQTCWKSVPLQANHVNITF--SFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARC-------FPLKLSLTDNEPVVAFNTVLEGAYENVGDSS--LIDWMSASDIRITLFKFDNPK--PKKSNIFRFARNSPKKI----LSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQME-----SAENKCKACDS------KRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            +TP+ PCY   G+A +C+P F N        + ++C +                    ++C    PR+    + +TD +  HN TCW+S  LQ++ +N+T   S  K+FE+ Y+SL  C S  P ++A YKS ++G TW P+ + ++ C  M+N       + Q         EQ A C       +PL   L      +AF+T+         DSS  L DW++ +DIR+   +  + +  P        A  +P  +     ++ D  +GGRCKCNGHA+ C +     K+ C C+HNTEG +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD  K + H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K   ++     S   +   CDS         +I  +K+C+KD     ++   E +GD+ +F V++ +++ S+             P+           R  + +W+ ++DL C C ++ +G+ + LI+ ST          L     S+++ W   W RRL +F++K++KG+CSK
Sbjct:   20 VTPTDPCYEETGAARRCIPEFINAAFGQEVSVSSVCGRPVSRSCSLVERDDRPAVRTCQICDASDPRNAHPASYLTDLNSAHNLTCWQSENLQSSPLNVTLTLSLGKKFEITYVSLQFC-SPRPESLAIYKSMDYGRTWTPYQFYSSQCRRMYNRPNKAAITKQ--------NEQEALCTDGHTDLYPLSGGL------IAFSTLDGRPSGKDFDSSPVLQDWVTVTDIRVVFSRPQHTRALPMSGRESEDALGAPGSLPTYYYAVGDFQVGGRCKCNGHASRCVREK-DGKLLCECKHNTEGPECDRCKPFHYDRPWQRATGKEANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGKAITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVIKPTAVISTTEEPADCDSYCKPLKGNLKINMKKYCKKDYAVQVSVLDMETVGDWAKFSVSLMSVYKSRG-----------DPL----------KRGDHMLWVHMKDLACKCPRIHMGKRF-LILGSTEGTANPERPGLQADKNSLVIQWRDIWTRRLRKFQRKEKKGKCSK 599          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn1a (netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169])

HSP 1 Score: 335.495 bits (859), Expect = 4.811e-106
Identity = 206/620 (33.23%), Postives = 315/620 (50.81%), Query Frame = 2
Query:  233 FVLSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVCPIKSPRDN----LITDYHLTHNQTCWKSVP-LQ-ANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYI------------QMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            + +S        P PCY  +G   +C+P F N       +  + C K                     C    P+ N     +TD +  HN TCW+S   LQ   +V +T S  K+FEV Y+SL  C S  P ++A +KS ++G +W P+ Y +T C  M+N       + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+DI++T  +      +  +    AR+S     ++SD+ +GGRCKCNGHA+ C K+   N + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +GYYRD +KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA+G++QS S   PC+K              +    E+ CKA   K  +I  +K+C+KD      +   +  G++ +F V + +++                       +SR+  R    +W++ +D+ C C +++ G+ YLL+        Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:   25 YGMSMFAAQTSPPDPCYDENGHPRRCIPDFVNAAFGKEVRASSTCGKTPSRYCVVTEKGDERHRNCHTCDASDPKKNHPPAYLTDLNNPHNLTCWQSDNYLQYPQNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIFKSMDYGKSWVPFQYYSTQCRKMYNKPSKATITKQ--------NEQEAICTD---SHTDMHPLSGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDIKVTFSRLHTFGDENEDDSELARDS--YFYAVSDLQVGGRCKCNGHASRCVKDRDGNLV-CECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCANGYQQSRSPIAPCIKIPIAPPTTTASSTEEPSDCESYCKASKGK-LKINMKKYCKKDYAVQVHILKADKAGEWWKFTVNIISVYK--------------------QGESRI-RRGDQFLWVRAKDVACKCPKIKSGKKYLLLGNDEDSPGQSG---MVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn1a (netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169])

HSP 1 Score: 335.495 bits (859), Expect = 4.811e-106
Identity = 206/620 (33.23%), Postives = 315/620 (50.81%), Query Frame = 2
Query:  233 FVLSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVCPIKSPRDN----LITDYHLTHNQTCWKSVP-LQ-ANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYI------------QMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            + +S        P PCY  +G   +C+P F N       +  + C K                     C    P+ N     +TD +  HN TCW+S   LQ   +V +T S  K+FEV Y+SL  C S  P ++A +KS ++G +W P+ Y +T C  M+N       + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+DI++T  +      +  +    AR+S     ++SD+ +GGRCKCNGHA+ C K+   N + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +GYYRD +KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA+G++QS S   PC+K              +    E+ CKA   K  +I  +K+C+KD      +   +  G++ +F V + +++                       +SR+  R    +W++ +D+ C C +++ G+ YLL+        Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:   25 YGMSMFAAQTSPPDPCYDENGHPRRCIPDFVNAAFGKEVRASSTCGKTPSRYCVVTEKGDERHRNCHTCDASDPKKNHPPAYLTDLNNPHNLTCWQSDNYLQYPQNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIFKSMDYGKSWVPFQYYSTQCRKMYNKPSKATITKQ--------NEQEAICTD---SHTDMHPLSGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDIKVTFSRLHTFGDENEDDSELARDS--YFYAVSDLQVGGRCKCNGHASRCVKDRDGNLV-CECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCANGYQQSRSPIAPCIKIPIAPPTTTASSTEEPSDCESYCKASKGK-LKINMKKYCKKDYAVQVHILKADKAGEWWKFTVNIISVYK--------------------QGESRI-RRGDQFLWVRAKDVACKCPKIKSGKKYLLLGNDEDSPGQSG---MVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn1b (netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168])

HSP 1 Score: 322.013 bits (824), Expect = 6.487e-101
Identity = 198/618 (32.04%), Postives = 316/618 (51.13%), Query Frame = 2
Query:  233 FVLSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLC------------KKKE------VCPIKSPRDN----LITDYHLTHNQTCWKS--VPLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKY-----IQMESAENKCKACDS------KRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPR-SIILTWNPTWKRRLNRFKQKKEKGEC 1954
            + +S     +  P PCY  +G+  +C+P F N       ++ + C            K +E      +C    P+       +TD +  HN TCW+S        +V +T S  K+FEV Y+SL  C S  P ++A +KS ++G TW P+ + +T C  M+N       + Q         EQ A C     S TD +P+    +AF+T L+G   A++      L DW++A+DI++T  +      +  +    AR+S     ++SD+ +GGRCKCNGHA+ C K+   N + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +GYYRD +K + H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K          S+ +    CDS       + ++  +K+C+KD      +   +  G++ +F + + ++              + Q   R     +L       +W++ +D+ C C +++ G+ YLL+   +     +R +  + + R S+++ W   W RRL +F+Q+ ++G+C
Sbjct:   25 YGMSMFAAQSSPPDPCYDENGNPRRCIPDFVNSAFGKDVRVSSTCGSPPSRYCVVTEKGEERSRDCNICDATDPKKTHPPAYLTDLNNPHNLTCWQSENYVQYPQNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIFKSMDYGKTWVPFQFYSTQCKKMYNKPSKAAITKQ--------NEQEAICTD---SHTDMQPLTGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDIKVTFNRLHTFGDENEDDSELARDS--YFYAVSDLQVGGRCKCNGHASKCVKDREGNLV-CECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKAISHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAAPTSSYSSPDGPTDCDSHCKAPKGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISV--------------YKQGGHRIRRGDQL-------LWVRAKDVACKCPKIKPGRKYLLM--GSDEEEDSRGQSGVVADRGSLLIPWKDLWARRLRKFQQRDKRGKC 602          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: rps16 (ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-5786511])

HSP 1 Score: 320.472 bits (820), Expect = 2.651e-100
Identity = 192/616 (31.17%), Postives = 309/616 (50.16%), Query Frame = 2
Query:  197 YIFTVYFSMFYKFV---LSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKKEV--CPIKSPRDNL----ITDYHLTHNQTCWKSVPL---QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEG--AYENVGDSSLI-DWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQM------------ESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            ++   +F M         S     +  P PCY  HG   +C+P F N   N   +  + C +     C    PR +     +TD +   N TCW+S       + +V++T S  K+FEV Y+SL  C S  P ++A +KS ++G +W P+ Y ++ C  ++  K +     + N+      +     +PL   L      +AF+T L+G  + +++ +S ++ DW++A+DIR+    F  P    +     +   P    S+ +  +GGRCKCNGHA+ C K+     I C C+HNTEG +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD ++ +  +  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K   +               E  CK       +I  +K+C+KD V    +   E++G + +F V + +++  ++                     R+  R  N +W+ ++DL C C ++ L + YL++  S      +    L     S+++ W   W RRL + +++++KG+C K
Sbjct:   11 FLLVSFFPMLPHSTSSPFSGQQQQHSIPDPCYDEHGLPRRCVPEFVNAAFNKEVQASSTCGRLATRHCDTTDPRKSYPASYLTDLNTAGNMTCWRSETFPRHSSQNVSLTLSLGKKFEVTYVSLQFC-SPRPESVAIFKSMDYGKSWVPYQYYSSQCRKVYG-KPSRASVTKQNEQEALCTDGQTELYPLTGGL------IAFST-LDGRPSAQDLDNSPVLQDWLTATDIRVF---FSRPHLLGNKESEASDEGPGFYYSVGEFQVGGRCKCNGHASRCGKDKEARLI-CDCKHNTEGPECDRCKPFHYDRPWQRATAREANECMACTCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDVSRAITDRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPIAPCIKIPAVVPTPALTSTEEPADCEQYCKP-PKGNYKINLKKYCKKDFVVQVNVLEMEMVGSWAKFTVNILSVYKCRD--------------------DRI-KRGDNFLWIHIKDLSCKCPKILLSRRYLVMGSSEG---PSERPGLTADKNSMVIQWRDAWTRRLRKLQRREKKGKCLK 587          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: ntn1 (netrin 1 [Source:NCBI gene;Acc:779839])

HSP 1 Score: 314.694 bits (805), Expect = 5.790e-98
Identity = 195/556 (35.07%), Postives = 279/556 (50.18%), Query Frame = 2
Query:  365 KKKEVCPIKSPRDNLITDYHL-THNQTCWKS---VPLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFN------DFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK----------YIQMESAENKCKACDS------KRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGEC 1954
            ++ ++C  K P ++    Y   T  QTCWKS   +    N V +T    +RFE+ Y SL  C S  P+++A YKS ++G TW P+ + +T+C  +++   T+  S          DF+   +       PL   L    P+    +     Y  V    L DW++A+DIR+   +  + K  K  I R           +S+I +GGRCKCNGHA+ C        + C CQHNT G +C+ CK  Y D PW RAT ++  +C  CECNLHS  C F+ +LY L  + +GGVC NC+HNTAG  CHYC  GY RD +KP+  +  CK C CH IGA     C++ TGQC CK+GVTG  CNRCA G++QS S   PCV+          Y Q   A      C S       R  +  +K+C+KD V  A L S E  G++ +F  TV  ++  +             PI           R   P+W+   DL C+C+++Q+G++YL+I          R   LI    S+ L W   W  +L RF+Q++ +G+C
Sbjct:   90 RRCQLCDQKRPENSYPPSYMTDTDAQTCWKSESGITFPQN-VTLTLPLGRRFELVYASLRFC-SPRPDSMAIYKSMDYGKTWIPFQFYSTHCRRVYDQATTSAISKPMQHEATCTDFQTGVK-------PLTKGLVAFMPLAGRPSARRFEYSPV----LQDWVTATDIRVVFNRLHHGK--KMGIRRKT-----AFYGVSEIQVGGRCKCNGHASRCTAG--KEGLMCECQHNTIGPECDACKPFYYDRPWQRATPSNAHECVACECNLHSHRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKQGYKRDLSKPITSRKACKPCQCHPIGA-VNAMCNQTTGQCQCKTGVTGPTCNRCAPGYQQSRSAHMPCVRIQEEMTTTASYPQEWKAGTNGTECQSYCKPSHSRVHMNLRKYCKKDYVLRAQLLSMEKSGEWWQFTATVLTVYRQRRV-----------PI----------RRGDQPLWVPDHDLACDCLRVQVGKSYLIIGNDEESPDPAR---LILDKNSLALPWRDVWGHKLRRFQQQERRGKC 598          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: rps16 (ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-5786511])

HSP 1 Score: 307.375 bits (786), Expect = 1.525e-95
Identity = 186/605 (30.74%), Postives = 299/605 (49.42%), Query Frame = 2
Query:  197 YIFTVYFSMFYKFV---LSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKKEV--CPIKSPRDNL----ITDYHLTHNQTCWKSVPL---QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEG--AYENVGDSSLI-DWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNS-IKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            ++   +F M         S     +  P PCY  HG   +C+P F N   N   +  + C +     C    PR +     +TD +   N TCW+S       + +V++T S  K+FEV Y+SL  C S  P ++A +KS ++G +W P+ Y ++ C  ++  K +     + N+      +     +PL   L      +AF+T L+G  + +++ +S ++ DW++A+DIR+    F  P    +     +   P    S+ +  +GGRCKCNGHA+ C K+     I C C+HNTEG +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD ++ +  +  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K   +                        + AV    +   E++G + +F V + +++  ++  IK                      R  N +W+ ++DL C C ++ L + YL++  S      +    L     S+++ W   W RRL + +++++KG+C K
Sbjct:   11 FLLVSFFPMLPHSTSSPFSGQQQQHSIPDPCYDEHGLPRRCVPEFVNAAFNKEVQASSTCGRLATRHCDTTDPRKSYPASYLTDLNTAGNMTCWRSETFPRHSSQNVSLTLSLGKKFEVTYVSLQFC-SPRPESVAIFKSMDYGKSWVPYQYYSSQCRKVYG-KPSRASVTKQNEQEALCTDGQTELYPLTGGL------IAFST-LDGRPSAQDLDNSPVLQDWLTATDIRVF---FSRPHLLGNKESEASDEGPGFYYSVGEFQVGGRCKCNGHASRCGKDKEARLI-CDCKHNTEGPECDRCKPFHYDRPWQRATAREANECMACTCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDVSRAITDRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPIAPCIKIPAVVPTPALTST--------------EEPAVVQVNVLEMEMVGSWAKFTVNILSVYKCRDDRIK----------------------RGDNFLWIHIKDLSCKCPKILLSRRYLVMGSSEG---PSERPGLTADKNSMVIQWRDAWTRRLRKLQRREKKGKCLK 562          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: utp4 (UTP4 small subunit processome component [Source:Xenbase;Acc:XB-GENE-977755])

HSP 1 Score: 196.438 bits (498), Expect = 5.015e-52
Identity = 148/442 (33.48%), Postives = 200/442 (45.25%), Query Frame = 2
Query:  230 KFVLSQLHMNNLTPS--PCYAHGSAYQCMPPFTNIVENMI--------PKIETLCKKKEVCPIKSP-------------RDNLITDYHLTHNQTCWKSVPLQA-----NHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKIL-----SISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            + VL+ L +  +  +   CY  GS  +CMP F N   N             E  C +  V  +                    +TDY+     T W+S  + A     + +N+T    K F++ Y+ L    +  P + A YK  +    W P+ Y + +C       E T         R    EQ A C       +D  P+    VAF+T LEG   AY       L +W++A+DIR+TL +         N F     S  K+L     +ISD ++GGRCKCNGHA+ C +N    KI C C+HNT G DCEKC   Y D PW R+T +SP +C  C CN  S  CYF  +LY  R    GG CT C  NT G  C  C + YYR      D+   C  C C+ +G+    +CD   G+C CK GV GE C+RC  GF
Sbjct:    1 RTVLAVLLLGTVRAAMDECYEEGSPQRCMPEFVNAAFNATVVATNTCGTPPEEYCVQTGVTGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTMLAGIQYPSTINLTLHLGKAFDITYVRLK-FHTSRPESFALYKRTHEDGPWIPYQYYSGSC-------EKTYQKFNRGFIRTGEDEQQALCTD---EFSDISPLTGGNVAFST-LEGRPSAYNFDNSPVLQEWVTATDIRVTLNRL--------NTFGDEVFSDPKVLKSYYYAISDFAVGGRCKCNGHASECVRNEF-EKIVCNCKHNTFGSDCEKCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELY--RSTGHGGHCTGCADNTDGPNCERCRENYYRQ-----DNNEPCHACQCNPVGS-LSTQCDN-YGRCSCKPGVMGEKCDRCQPGF 412          

HSP 2 Score: 85.5001 bits (210), Expect = 1.658e-16
Identity = 57/173 (32.95%), Postives = 78/173 (45.09%), Query Frame = 2
Query:  959 CKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTC-HIIGAKFPDRCDKRTGQCL-CKSGVTGEMCNRCASGFRQSNSTETPCVK 1471
            C CNGH++ C+         C CQHNT G  CE+C + Y    +  +T  S + C+ C C   SS     +   +        VCTNC   T G RC  C+DGY+ D          C+ C C + I       CD+ TG+CL C     G  C+RC  GF  +   + P +K
Sbjct:  702 CTCNGHSDTCDPESGV----CDCQHNTAGPHCERCSEGY----YGDSTTGSASDCQPCPCPGGSSCAVVPRTKEV--------VCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRPCRICECSNNIDPNAVGNCDRLTGECLKCIYNTGGFYCDRCRDGFYGNPLAQNPDLK 858          

HSP 3 Score: 57.7658 bits (138), Expect = 6.732e-8
Identity = 43/142 (30.28%), Postives = 65/142 (45.77%), Query Frame = 2
Query: 1016 ECV-CQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHS-----SNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRC 1423
            EC+ C +NT G  C++C+  +   P A+   N   +C+ C CN +      S C           Q+TG     C  +     C  C  G+Y      L     C++C CH +G+    +CD RTGQC C  G++G+ C +C
Sbjct:  826 ECLKCIYNTGGFYCDRCRDGFYGNPLAQ---NPDLKCRACSCNPYGTVKGQSGC----------NQVTGQC--ECLPHVTERDCSACEPGFYN-----LLSGRGCERCDCHSLGST-SGQCDVRTGQCECHPGISGQQCQQC 946          

HSP 4 Score: 52.373 bits (124), Expect = 2.851e-6
Identity = 48/144 (33.33%), Postives = 60/144 (41.67%), Query Frame = 2
Query: 1019 CVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIG--AKFPDRCDKRTGQCLCKS---GVTGEMCNRCASGF 1435
            C C     GQ CE+C   Y     ++    SP  C  C CN HS  C               GVC +CQHNTAG  C  C++GYY D T        C+ C C      A  P     RT + +C +   G TG+ C  C  G+
Sbjct:  668 CSCPTGYIGQFCERCAPGYRRENPSQGPY-SP--CVLCTCNGHSDTC-----------DPESGVC-DCQHNTAGPHCERCSEGYYGDST--TGSASDCQPCPCPGGSSCAVVP-----RTKEVVCTNCPLGTTGKRCELCDDGY 789          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: utp4 (UTP4 small subunit processome component [Source:Xenbase;Acc:XB-GENE-977755])

HSP 1 Score: 196.438 bits (498), Expect = 5.255e-52
Identity = 148/442 (33.48%), Postives = 200/442 (45.25%), Query Frame = 2
Query:  230 KFVLSQLHMNNLTPS--PCYAHGSAYQCMPPFTNIVENMI--------PKIETLCKKKEVCPIKSP-------------RDNLITDYHLTHNQTCWKSVPLQA-----NHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKIL-----SISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            + VL+ L +  +  +   CY  GS  +CMP F N   N             E  C +  V  +                    +TDY+     T W+S  + A     + +N+T    K F++ Y+ L    +  P + A YK  +    W P+ Y + +C       E T         R    EQ A C       +D  P+    VAF+T LEG   AY       L +W++A+DIR+TL +         N F     S  K+L     +ISD ++GGRCKCNGHA+ C +N    KI C C+HNT G DCEKC   Y D PW R+T +SP +C  C CN  S  CYF  +LY  R    GG CT C  NT G  C  C + YYR      D+   C  C C+ +G+    +CD   G+C CK GV GE C+RC  GF
Sbjct:    4 RTVLAVLLLGTVRAAMDECYEEGSPQRCMPEFVNAAFNATVVATNTCGTPPEEYCVQTGVTGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTMLAGIQYPSTINLTLHLGKAFDITYVRLK-FHTSRPESFALYKRTHEDGPWIPYQYYSGSC-------EKTYQKFNRGFIRTGEDEQQALCTD---EFSDISPLTGGNVAFST-LEGRPSAYNFDNSPVLQEWVTATDIRVTLNRL--------NTFGDEVFSDPKVLKSYYYAISDFAVGGRCKCNGHASECVRNEF-EKIVCNCKHNTFGSDCEKCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELY--RSTGHGGHCTGCADNTDGPNCERCRENYYRQ-----DNNEPCHACQCNPVGS-LSTQCDN-YGRCSCKPGVMGEKCDRCQPGF 415          

HSP 2 Score: 85.5001 bits (210), Expect = 2.145e-16
Identity = 57/173 (32.95%), Postives = 78/173 (45.09%), Query Frame = 2
Query:  959 CKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTC-HIIGAKFPDRCDKRTGQCL-CKSGVTGEMCNRCASGFRQSNSTETPCVK 1471
            C CNGH++ C+         C CQHNT G  CE+C + Y    +  +T  S + C+ C C   SS     +   +        VCTNC   T G RC  C+DGY+ D          C+ C C + I       CD+ TG+CL C     G  C+RC  GF  +   + P +K
Sbjct:  705 CTCNGHSDTCDPESGV----CDCQHNTAGPHCERCSEGY----YGDSTTGSASDCQPCPCPGGSSCAVVPRTKEV--------VCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRPCRICECSNNIDPNAVGNCDRLTGECLKCIYNTGGFYCDRCRDGFYGNPLAQNPDLK 861          

HSP 3 Score: 57.3806 bits (137), Expect = 7.651e-8
Identity = 43/142 (30.28%), Postives = 65/142 (45.77%), Query Frame = 2
Query: 1016 ECV-CQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHS-----SNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRC 1423
            EC+ C +NT G  C++C+  +   P A+   N   +C+ C CN +      S C           Q+TG     C  +     C  C  G+Y      L     C++C CH +G+    +CD RTGQC C  G++G+ C +C
Sbjct:  829 ECLKCIYNTGGFYCDRCRDGFYGNPLAQ---NPDLKCRACSCNPYGTVKGQSGC----------NQVTGQC--ECLPHVTERDCSACEPGFYN-----LLSGRGCERCDCHSLGST-SGQCDVRTGQCECHPGISGQQCQQC 949          

HSP 4 Score: 52.373 bits (124), Expect = 3.295e-6
Identity = 48/144 (33.33%), Postives = 60/144 (41.67%), Query Frame = 2
Query: 1019 CVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIG--AKFPDRCDKRTGQCLCKS---GVTGEMCNRCASGF 1435
            C C     GQ CE+C   Y     ++    SP  C  C CN HS  C               GVC +CQHNTAG  C  C++GYY D T        C+ C C      A  P     RT + +C +   G TG+ C  C  G+
Sbjct:  671 CSCPTGYIGQFCERCAPGYRRENPSQGPY-SP--CVLCTCNGHSDTC-----------DPESGVC-DCQHNTAGPHCERCSEGYYGDST--TGSASDCQPCPCPGGSSCAVVP-----RTKEVVCTNCPLGTTGKRCELCDDGY 792          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 327.405 bits (838), Expect = 7.045e-103
Identity = 205/618 (33.17%), Postives = 311/618 (50.32%), Query Frame = 2
Query:  239 LSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVC----PIKSPRDNLITDYHLTHNQTCWKSVP-LQANH-VNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK------------YIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            LS        P PC   +G   +C+P F N       ++ + C +                    +C    P K+     +TD +  HN TCW+S   LQ  H V +T S  K+FEV Y+SL  C S  P ++A YKS ++G TW P+ + +T C  M+N       + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+DIR+   +      +  +    AR+S     ++SD+ +GGRCKCNGHA  C ++   + + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD  KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K              + E  ++ CKA   K  ++  +K+CRKD      +   +  GD+ +F V + +++                        SR+  R    +W++ RD+ C C +++  + YLL+  +     Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:   28 LSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ--------NEQEAVCTD---SHTDMRPLSGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDS--YYYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGK-LKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYK--------------------QGTSRI-RRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSG---IVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 327.405 bits (838), Expect = 7.045e-103
Identity = 205/618 (33.17%), Postives = 311/618 (50.32%), Query Frame = 2
Query:  239 LSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVC----PIKSPRDNLITDYHLTHNQTCWKSVP-LQANH-VNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK------------YIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            LS        P PC   +G   +C+P F N       ++ + C +                    +C    P K+     +TD +  HN TCW+S   LQ  H V +T S  K+FEV Y+SL  C S  P ++A YKS ++G TW P+ + +T C  M+N       + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+DIR+   +      +  +    AR+S     ++SD+ +GGRCKCNGHA  C ++   + + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD  KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K              + E  ++ CKA   K  ++  +K+CRKD      +   +  GD+ +F V + +++                        SR+  R    +W++ RD+ C C +++  + YLL+  +     Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:   28 LSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ--------NEQEAVCTD---SHTDMRPLSGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDS--YYYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGK-LKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYK--------------------QGTSRI-RRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSG---IVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Ntn3 (netrin 3 [Source:MGI Symbol;Acc:MGI:1341188])

HSP 1 Score: 277.715 bits (709), Expect = 3.144e-84
Identity = 186/571 (32.57%), Postives = 272/571 (47.64%), Query Frame = 2
Query:  275 PCYAHG-SAYQCMPPFTNIVENMIPKIETLCKKK--EVC----PIKSPRDNLITDYHLTHNQTCWKSVPLQANHVNITFS--FAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVG-DSS--LIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKY-----------IQMESAENKCKACDSKRTRIRFQKFCRKD-AVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLI---IKSTTYHYQNRAELLIKSPRSIILTWNPTW 1906
            PCY        C+P   N          + C +    VC    P ++   +L+T    T +  CW+S  LQ    N+T +    K FE+ ++SL  C S  P ++A  KS + G +W P  + +++C    +      P+   +    +     A CFP   +  D   ++AF +V +G+ + +  D+S  L DW++A+DIRI L +     P      R    +     S +++ +GGRCKCNGHA+ C  +     + C CQH TEG DC +CK  Y D PW RAT      C  C CN H+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD  + L  +  C+ C CH +GA     C++ TGQC CK GVTG  CNRCA GF+QS S   PCVK            ++ +  E+ C+       RI  +KFCRKD AV  A     E  G + RF V V  ++ S                     ++R   R ++ +W+   D  C C +L  G+ YLL+     +       R + L  +  S++L W   W
Sbjct:   29 PCYDEAREPRSCIPGLVNAALGREVLASSTCGRSANRVCDSSDPQRAHSADLLTSAPGTASPLCWRSDLLQQAPFNVTLTVPLGKAFELVFVSLRFC-SAPPTSVALLKSQDHGRSWVPLGFFSSSC--TLDYGRLPAPADGPSGPGPE-----ALCFPAPQAQPDGGGLLAF-SVQDGSPQGLDLDNSPVLQDWVTATDIRIVLTR-----PAIQGDTRDGGVTVPYSYSATELQVGGRCKCNGHASRCLLD-THGHLVCDCQHGTEGPDCSRCKPFYCDRPWQRATGQEAHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRVLSDRRACRACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKTPVPGPTEESSPVEPQDCESHCRPARGS-YRISLKKFCRKDYAVQVAVGARGEARGSWTRFPVAVLAVFRSGE------------------ERAR---RGSSALWVPTLDAACGCPRLLPGRRYLLLGGGPGAAAGSTAGRGQGLSAARGSLVLPWRDAW 561          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Ntn5 (netrin 5 [Source:MGI Symbol;Acc:MGI:2685330])

HSP 1 Score: 206.068 bits (523), Expect = 1.445e-59
Identity = 122/396 (30.81%), Postives = 189/396 (47.73%), Query Frame = 2
Query:  860 FDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQ----------MESAENKCKA-CDSKRTRIR--FQKFCRKDAVFSATL-----QSQEIIG-DFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAE--LLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKF--QNRSP 1978
            F +P PK   +  + R        +    + GRC+C+GHA  C          C C+H+T G  CE C+ ++ D PW  AT   P  C  C CN H+  C F+ +L+ L    +GGVC  C+H+TAG  CHYC  G++RD ++P+     C+ C CH IGA     C++ +GQC CK GVTG  CNRC  G++QS S   PC +  +             ++ +C+  C+   + +    Q++C++D V  A +     Q  E +G ++ R  V V  ++  +           + P+ R   ++          W+   DL C C++L+ G  YLL+ ++   H  +  +   LI +   + L W P W R L R +QK+  G C       RSP
Sbjct:    8 FSSPGPKTRIVASYLRVEFGGKAGLVTTGVRGRCQCHGHAARCATR--AQPPRCRCRHHTTGPGCESCRPSHRDWPWRPATPQHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPITSHKACRACQCHPIGATG-GMCNQTSGQCSCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTPATTPVASRSDPQCQGYCNVSVSSVHMSLQRYCQQDYVLHAQVSASSSQPSEAVGPEWWRLAVHVLAVFKQR-----------AWPVRRGGQEA----------WVPRADLICGCLRLRPGADYLLLGRAAQTHDDDNYDPARLILNRHGLALPWRPRWARPLRRLQQKERGGACRGLLPPTRSP 379          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Lamc1 (laminin, gamma 1 [Source:MGI Symbol;Acc:MGI:99914])

HSP 1 Score: 192.971 bits (489), Expect = 6.087e-51
Identity = 130/363 (35.81%), Postives = 181/363 (49.86%), Query Frame = 2
Query:  407 LITDYHLTHNQTCWKSVPLQA-----NHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFK--------FDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
             +TDY+   + T W+S  + A     N +N+T    K F++ Y+ L    +  P + A YK       W P+ Y + +C       E T         R    EQ A C       +D  P+    VAF+T LEG   AY       L +W++A+DIR+TL +        F++PK  KS  +           +ISD ++GGRCKCNGHA+ C KN   +K+ C C+HNT G DCEKC   + D PW RAT  S ++C  C+CN  S  CYF  +LY  R    GG CTNC+ NT G +C  C + ++R     L +   C  C C  +G+    +CD   G+C CK GV G+ C+RC  GF
Sbjct:  103 FLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKAFDITYVRLK-FHTSRPESFAIYKRTREDGPWIPYQYYSGSC-------ENTYSKANRGFIRTGGDEQQALCTD---EFSDISPLTGGNVAFST-LEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYY-----------AISDFAVGGRCKCNGHASECVKNEF-DKLMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELY--RSTGHGGHCTNCRDNTDGAKCERCRENFFR-----LGNTEACSPCHCSPVGS-LSTQCDS-YGRCSCKPGVMGDKCDRCQPGF 432          

HSP 2 Score: 79.7221 bits (195), Expect = 8.996e-15
Identity = 60/187 (32.09%), Postives = 83/187 (44.39%), Query Frame = 2
Query:  959 CKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHI-IGAKFPDRCDKRTGQCL-CKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKAC 1513
            C CNGH+  C+  P T    C C+ NT G  CEKC   Y    +  +T+ + + C+ C C   SS     +   +        VCT+C   TAG RC  C+DGY+ D         +C+ C C+  I       C++ TG+CL C     G  C+RC  GF  +     P           +KCKAC
Sbjct:  722 CTCNGHSETCD--PETGV--CDCRDNTAGPHCEKCSDGY----YGDSTLGTSSDCQPCPCPGGSSCAIVPKTKEV--------VCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPA----------DKCKAC 882          

HSP 3 Score: 68.5514 bits (166), Expect = 2.147e-11
Identity = 52/163 (31.90%), Postives = 80/163 (49.08%), Query Frame = 2
Query:  959 CKCNGHAN---ACNKNPITNKIECV-CQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQ--HNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCAS 1429
            C+CN + +     N N +T   EC+ C +NT G  C++CK+ +   P A    N   +CK C CN + +         + ++     V   CQ   + +G  C  C+ GYY      L     C++C CH +G+    +CD RTGQC C+ G+TG+ C RC +
Sbjct:  826 CQCNDNIDPNAVGNCNRLTG--ECLKCIYNTAGFYCDRCKEGFFGNPLA---PNPADKCKACACNPYGT---------VQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYN-----LQSGQGCERCDCHALGSTN-GQCDIRTGQCECQPGITGQHCERCET 968          

HSP 4 Score: 59.6918 bits (143), Expect = 1.287e-8
Identity = 51/167 (30.54%), Postives = 73/167 (43.71%), Query Frame = 2
Query:  959 CKCNGHANACNKNPITNKIECV-CQHNTEGQDCEKCKKNYLDLPWARATVNSPAQ-CKKCECNLH-----SSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIG-AKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            C C G  ++C   P T ++ C  C   T G+ CE C   Y   P      N P + C+ C+CN +       NC           ++TG  C  C +NTAG  C  C +G++ +   P +    CK C C+  G  +    C+  TGQC C   V+G  C  C  G+
Sbjct:  771 CPCPG-GSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGS---NGPVRLCRPCQCNDNIDPNAVGNC----------NRLTG-ECLKCIYNTAGFYCDRCKEGFFGNPLAP-NPADKCKACACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGY 921          
BLAST of Netrin 1 vs. UniProt/SwissProt
Match: sp|Q90922|NET1_CHICK (Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 2.181e-103
Identity = 206/618 (33.33%), Postives = 314/618 (50.81%), Query Frame = 2
Query:  239 LSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVCPIKSPR----DNLITDYHLTHNQTCWKSVP-LQANH-VNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYI------------QMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            L+   +    P PCY  HG   +C+P F N       K+ + C K                    +C    P+     + +TD +  HN TCW+S   +Q  H V +T S  K+FEV Y+SL  C S  P ++A YKS ++G TW P+ + +T C  M+N       + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+DI++T  +      +  +    AR+S     ++SD+ +GGRCKCNGHA+ C ++   N + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD +KP+ H+  CK+C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K              +    ++ CKA   K  +I  +K+C+KD      +   E   D+ +F V + +++                        +RL  R    +W+  +D+ C C +++  + YLL+  +     Q+    +I    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:   30 LNMFAVQTAQPDPCYDEHGLPRRCIPDFVNSAFGKEVKVSSTCGKPPSRYCVVTEKGEEQVRSCHLCNASDPKRAHPPSFLTDLNNPHNLTCWQSDSYVQYPHNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIYKSMDYGKTWVPFQFYSTQCRKMYNKPSRAAITKQ--------NEQEAICTD---SHTDVRPLSGGLIAFST-LDGRPTAHDFDNSPVLQDWVTATDIKVTFSRLHTFGDENEDDSELARDS--YFYAVSDLQVGGRCKCNGHASRCVRDRDDNLV-CDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKECDCHPVGAAG-QTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPAAPPPTAASSTEEPADCDSYCKASKGK-LKINMKKYCKKDYAVQIHILKAEKNADWWKFTVNIISVYK--------------------QGSNRL-RRGDQTLWVHAKDIACKCPKVKPMKKYLLLGSTEDSPDQSG---IIADKSSLVIQWRDTWARRLRKFQQREKKGKCRK 605          
BLAST of Netrin 1 vs. UniProt/SwissProt
Match: sp|O95631|NET1_HUMAN (Netrin-1 OS=Homo sapiens OX=9606 GN=NTN1 PE=1 SV=2)

HSP 1 Score: 328.561 bits (841), Expect = 1.567e-102
Identity = 205/618 (33.17%), Postives = 310/618 (50.16%), Query Frame = 2
Query:  239 LSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVCPIKSPRDN----LITDYHLTHNQTCWKSVP-LQANH-VNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK------------YIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            LS        P PC   +G   +C+P F N       ++ + C +                    +C    P+       +TD +  HN TCW+S   LQ  H V +T S  K+FEV Y+SL  C S  P ++A YKS ++G TW P+ + +T C  M+N       + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+DIR+   +      +  +    AR+S     ++SD+ +GGRCKCNGHA  C ++   + + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +GYYRD  KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K              + E  ++ CKA   K  +I  +K+C+KD      +   +  GD+ +F V + +++                        SR+  R    +W++ RD+ C C +++  + YLL+  +     Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:   28 LSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ--------NEQEAVCTD---SHTDMRPLSGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDS--YFYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGK-LKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYK--------------------QGTSRI-RRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSG---IVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. UniProt/SwissProt
Match: sp|O09118|NET1_MOUSE (Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=3)

HSP 1 Score: 327.405 bits (838), Expect = 4.928e-102
Identity = 205/618 (33.17%), Postives = 311/618 (50.32%), Query Frame = 2
Query:  239 LSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVC----PIKSPRDNLITDYHLTHNQTCWKSVP-LQANH-VNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK------------YIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            LS        P PC   +G   +C+P F N       ++ + C +                    +C    P K+     +TD +  HN TCW+S   LQ  H V +T S  K+FEV Y+SL  C S  P ++A YKS ++G TW P+ + +T C  M+N       + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+DIR+   +      +  +    AR+S     ++SD+ +GGRCKCNGHA  C ++   + + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD  KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K              + E  ++ CKA   K  ++  +K+CRKD      +   +  GD+ +F V + +++                        SR+  R    +W++ RD+ C C +++  + YLL+  +     Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:   28 LSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ--------NEQEAVCTD---SHTDMRPLSGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDS--YYYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGK-LKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVYK--------------------QGTSRI-RRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSG---IVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. UniProt/SwissProt
Match: sp|Q90923|NET3_CHICK (Netrin-3 (Fragment) OS=Gallus gallus OX=9031 GN=NTN3 PE=2 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 3.021e-100
Identity = 193/593 (32.55%), Postives = 302/593 (50.93%), Query Frame = 2
Query:  269 PSPCYAH-GSAYQCMPPFTNIVENMIPKIETLCKKKEV--CPIKSPR----DNLITDYHLTHNQTCWKSVPLQ--ANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEGAYENVGDSS--LIDWMSASDIRITLFK---FDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKY-----IQMESAENKCKACDS------KRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            P PCY   G+  +C+P F N       +  + C K     C    PR       +TD +   N TCW+S  L    ++V +T S  K+FEV Y+SL  C S  P + A +KS ++G TW P+ Y ++ C  ++        + Q         EQ A C      LTD  P+    +AF+T+         DSS  L DW++A+DIR+   +   F     +++        +     S+ ++ +GGRCKCNGHA+ C K+    K+ C C+HNTEG +C++CK  + D PW RA+     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD +K +  +  CK C CH +GA     C++ TGQC CK GVTG  CNRCA GF+QS S   PC+K        + ++      CDS         +I  +K+C+KD V    +   E + ++ +F + + +++  ++                     R+  R  N +W+ L+DL C C ++Q+ + YL++    + +  +R  L+     S+++ W   W RRL + +++++KG+C K
Sbjct:   26 PDPCYDESGAPRRCIPEFVNAAFGKEVQASSTCGKPPTRHCDASDPRRAHPPAYLTDLNTAANMTCWRSETLHHLPHNVTLTLSLGKKFEVVYVSLQFC-SPRPESTAIFKSMDYGKTWVPYQYYSSQCRKIYGKPSKATVTKQ--------NEQEALCTD---GLTDLYPLTGGLIAFSTLDGRPSAQDFDSSPVLQDWVTATDIRVVFSRPHLFRELGGREAGEEDGGAGATPYYYSVGELQVGGRCKCNGHASRCVKDK-EQKLVCDCKHNTEGPECDRCKPFHYDRPWQRASAREANECLACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKSITDRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGLTCNRCAKGFQQSRSPVAPCIKIPAINPTSLVTSTEAPADCDSYCKPAKGNYKINMKKYCKKDYVVQVNILEMETVANWAKFTINILSVYKCRD--------------------ERV-KRGDNFLWIHLKDLSCKCPKIQISKKYLVM--GISENSTDRPGLMADK-NSLVIQWRDAWTRRLRKLQRREKKGKCVK 580          
BLAST of Netrin 1 vs. UniProt/SwissProt
Match: sp|Q2HXW4|NET1_PIG (Netrin-1 OS=Sus scrofa OX=9823 GN=NTN1 PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.427e-99
Identity = 201/613 (32.79%), Postives = 306/613 (49.92%), Query Frame = 2
Query:  239 LSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVCPIKSPRDN----LITDYHLTHNQTCWKSVP-LQANH-VNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK------------YIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEK 1945
            LS        P PC   +G   +C+P F N       ++ + C +                    +C    P+       +TD +  HN TCW+S   LQ  H V +T S  K+FEV Y+SL  C S  P ++A YKS ++G TW P+ + +T C  M+N       + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+DIR+   +      +  +    AR+S     ++SD+ +GGRCKCNGHA  C ++   + + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +GY+RD  KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K              + E  ++ CKA   K  +I  +K+C+KD      +   +  GD+ +F V + +++                        SR+     N +W++ RD+ C C +++  + YLL+  +     Q+    ++    S+++ W  TW RRL +F+Q+++K
Sbjct:   28 LSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQFPHNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ--------NEQEAVCTD---SHTDMRPLSGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDIRVAFSRLHTFGDENEDDSELARDS--YFYAVSDLQVGGRCKCNGHAARCVRD-RDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYFRDLGKPITHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGVTCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGK-LKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYK--------------------QGASRIRRGDQN-LWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSG---IVADKSSLVIQWRDTWARRLRKFQQREKK 598          
BLAST of Netrin 1 vs. TrEMBL
Match: A0A4D6FZK5 (Netrin-3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=netrin-3 PE=2 SV=1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 298/300 (99.33%), Postives = 298/300 (99.33%), Query Frame = 2
Query:  305 CMPPFTNIVENMIPKIETLCKKKEVCPIKSPRDNLITDYHLTHNQTCWKSVPLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITG 1204
            CMPPFTNIVENMIPKIETLCKKKEVCPIKSPRDNLITDYHLT NQTCWKSVPLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNC FSQDLYILRKQITG
Sbjct:    1 CMPPFTNIVENMIPKIETLCKKKEVCPIKSPRDNLITDYHLTRNQTCWKSVPLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCCFSQDLYILRKQITG 300          
BLAST of Netrin 1 vs. TrEMBL
Match: Q49BF9 (Netrin 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 4.467e-145
Identity = 253/639 (39.59%), Postives = 362/639 (56.65%), Query Frame = 2
Query:  242 SQLHMNNLTPSPCYAHGSAYQCMPPFTNIVENMIP-KIETLC---KKKEVCP--------IKSPRD-NLITDYHLTHNQTCWKSVPL-QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPL---KLSLTDNEP-VVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFK-------------------------------FDNPKPKKSNIFRFARNSPKKI-----LSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQM------ESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNS-IKDLYPGIFSQPIMRPSSKSRLNNR---PTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKFQ 1966
            +Q  ++  + S CY+ G A++C+PPFTNI+ENMIP +I + C   KK+ +C         +K     N +TD HL +N T W S  +   ++VNITFSF K FE+YYISL       P++I   KS + G +W  WHY + +C   F ++         +       +Q+  C  +   KL    N P V+AF T     + +  D     WMSA++IRITL K                               + +  P    + +  RNSP  +      +++DISIGGRC+C GHA  C KNP+ N   C CQHNT G+DCE C++ ++D  W+ ATVNS A+CK+C CNLHS  C F++ LYI+  + +GGVC +C+HNT G  CH CN GY+RDW+KPL H  VC KC CH IG+ +PD CD+R  QC CK+GV G  CNRC  GF+Q+ S  TPCV  I +      ++ EN+C+ C++KR RIRF+K+CRKDAV   T+QS+E  G+  RF++ V+ ++    S   +++P   +      S    ++N+    T P+W+K  DLKC C  LQLG TYL+I+K     Y  R+ELL+   +S+ L W  TW+RR+ +F  K+ +G C K++
Sbjct:   23 AQHWLHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQWICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ-YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVDCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLA------SMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQ-KSVALPWQKTWERRMKKFSNKEHQGLCEKWK 653          
BLAST of Netrin 1 vs. TrEMBL
Match: A0A3Q0KPX7 (Putative netrin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 434.106 bits (1115), Expect = 8.103e-138
Identity = 248/684 (36.26%), Postives = 353/684 (51.61%), Query Frame = 2
Query:  266 TPSPCYAHGSAYQCMPPFTNIVENMIPKIETLC----KKKEVCPIKSPRD-------------NLITDYHLTHNQTCWKSVP-LQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFP-LKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFD---------------NPK-PKKSNIFR---------FARN------------------------SPKKI----LSISDISIGGRCKCNGHANACNKNPITNK----------------IECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENK---------------------CKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKL-------RDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKFQN 1969
            T S CY  G A +C PPFTNI E++  K  + C    + +E+C      +             +L+TD H  +N+TCW S   L  + VN+T S  KRFEVYYISL PC   +P++IA YKS++FG+TWKPW Y +T+C   F++  +   + Q +   IQ     A   P +  +   +  V+AF+T +         S+LIDWM+ +D+RI+L +F                NP   K +N+FR         F  N                        +PK       S SD+SIGGRCKCNGHAN C ++ I                   + C CQHNTEG DCE+C   YLD PWAR T  S   CK+C+CNLHS++C FS  LY++  +++GGVC +CQHNT G +CH C  GYYRDWTKP+ H  VC +C CH IG+     CD++TGQC CK GV G+ CNRC  G++Q+   + PC+K ++  +   K                     C  C+  + RIRF+KFCR +AVF   ++S+ I GD +R +V + N W    + + L P            K+   N P   +WL++       R  +C C  LQ+GQ+YL I +S    Y +R ELL+ +  S++L W  +W+RRL++F ++  +  C   +N
Sbjct:   50 TRSVCYTKGQAIECSPPFTNIAESVDIKATSTCGQFDQSEEICRYVMGHEKCETCGKGEKFGTHLLTDRHQMNNETCWVSGSVLPGDTVNLTLSLGKRFEVYYISLQPC-GQLPDSIALYKSSDFGVTWKPWQYFSTDCYRAFHLPTSNEHNAQISLANIQEVLCVALKSPDVHGNSGQSSNVIAFSTTIGRPSMQPWSSALIDWMTMTDLRISLMRFPEYRDEVQYDSNGLFLNPSFLKPTNVFRVSGSPSIGGFGTNPVLSEAGTLDMSQHLYQSDMHYSKTPKSKTPVHFSFSDLSIGGRCKCNGHANRCIRDRIVGTGITTDNNGQTKSQWGPLRCDCQHNTEGADCERCSPGYLDRPWARGTSESANDCKRCDCNLHSNSCVFSNQLYLMSMKVSGGVCQDCQHNTVGRKCHNCVTGYYRDWTKPVSHDQVCLECRCHPIGSIANQHCDRKTGQCPCKPGVVGQACNRCQEGYKQTRLPDAPCIKAMEHYAHRRKENDQTSHSTKSQLSKPETNIDCPPCERSKKRIRFKKFCRNEAVFRGIVKSRTIHGDLMRLEVGIQNTWRITGAAEHLLP------------KTASPNLPAYRVWLRIKNNSADKRHSRCLCPNLQVGQSYLFITRSHQVPYGDRMELLLDT-HSVVLKWRESWRRRLSKFVRRAARESCDSEKN 719          
BLAST of Netrin 1 vs. TrEMBL
Match: A0A4Z2D9H4 (Netrin-A OS=Schistosoma japonicum OX=6182 GN=EWB00_003107 PE=4 SV=1)

HSP 1 Score: 430.254 bits (1105), Expect = 2.314e-136
Identity = 247/679 (36.38%), Postives = 351/679 (51.69%), Query Frame = 2
Query:  266 TPSPCYAHGSAYQCMPPFTNIVENMIPKIETLC----KKKEVCP-IKSPRD------------NLITDYHLTHNQTCWKSVP-LQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFP-LKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKP----------------KKSNIFRFAR------------------------------------NSPKKI-LSISDISIGGRCKCNGHANACNKNPITNK----------------IECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYI-------------------QMESAE--NKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLK-------CNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGEC 1954
            T S CY  G A +C PPFTNI E++  K  + C    + +E+C  +   R             +L+TD H  +N+TCW S   L  + VN+T S  KRFEVYYISL PC   +P++IA YKS++FGITWKPW Y +T+C   F +  +   + Q +   IQ     A   P +  ++  +  ++AF+T +         S+LIDWM+ +D+RI+L +F   +                 K S +FR +                                     NS   +  S SD+SIGGRCKCNGHAN C ++ I +                 + C CQHNTEG DCE+C   YLD PWAR T  S  +CK+C+CNLHS++C FS  LY++  +++GGVC +CQHNT G RCH C  GYYRDWTKP+ H  VC +C CH IG+     CD++TGQC CK GV G+ CNRC  G++Q+   + PC+K +                   QM   E    C  C+  + RIRF+KFCR +AVF   ++S+ I GD +R +V + N W    + + L P            K+   N P   +WL++++         C C  L +GQ+YL I +S    Y +R ELL+ S +S+IL W  +W+RRL++F ++  +  C
Sbjct:   50 TRSVCYTKGQAIECSPPFTNIAESIDIKATSTCGQFGQSEEICRYVLGQRKCDICDSSEKFGTHLLTDRHQMNNETCWISGSVLPGDTVNLTLSLGKRFEVYYISLQPC-GQLPDSIALYKSSDFGITWKPWQYFSTDCYRAFRLPTSNEHNAQISLANIQEVLCVALKSPDIHDAIGKSSNIIAFSTTIGRPSTQPWSSALIDWMTMTDLRISLMRFPEHREEVQHDSNGLFLNPGLLKPSKVFRVSGSPNIGGFGINPALSETGALDMSQHLYQSDMHYAKTPNSKSPVHFSFSDLSIGGRCKCNGHANRCVRDRIVSTSSTKENDGLAKSQWGPLRCDCQHNTEGTDCERCSSGYLDRPWARGTSESANECKRCDCNLHSNSCIFSNQLYLMSMKVSGGVCQDCQHNTVGRRCHNCATGYYRDWTKPVSHDQVCLECRCHPIGSIANQHCDRKTGQCPCKPGVIGQACNRCQDGYKQTRLPDAPCIKAMEHYAHRRKENDQTSHPTKSQMSRLEPDTNCPPCERSKKRIRFKKFCRCEAVFRGIIKSRTIHGDLMRLEVGIQNTWRITGAAEHLLP------------KTASPNLPAYRVWLRIKNNSADKRHSFCLCPNLLVGQSYLFITRSHQVPYGDRMELLLDS-QSVILRWRESWRRRLSKFVRRAARESC 714          
BLAST of Netrin 1 vs. TrEMBL
Match: G4VPQ4 (Putative netrin OS=Schistosoma mansoni OX=6183 GN=Smp_146840 PE=4 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 2.107e-131
Identity = 241/628 (38.38%), Postives = 340/628 (54.14%), Query Frame = 2
Query:  272 SPCYAHGSAYQCMPPFTNIVENMIPKIETLCKKKE------------VCPIKSPR----DNLITDYHLTHNQTCWKSVPLQ-ANHVNITFSFAKRFEVYYISLTPCESG-IPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLT------DNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFA-RNSPK----------------KILS------ISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTN----------------PIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKFQ 1966
            S C +   ++QC PPF +I   +     + C + +            +C + S +       +TD H   NQTCW S  ++    VN+T S  KRFEVYYISL PC  G IP++IA YKS++FG TW+PWHY +T+C   F +  +     + N        Q   C  L+   +       ++ V+AF+T L          +LIDWM+ +D+RI+L  F      +  I R A RNS                  KILS       +DI+IGGRCKCNGHA+ C       K+ C C+H+T G+DCE CK  Y+D PW RAT      CKKC+CNLHS+ C FS  LY+L  +I+GG+C NCQHNT G  CH C +GYYRDWTKP+ H+ VC  C CH IG+     CD+R+GQC CK GV G  C+RC  G+ Q+ S   PC K       +  C  C + + RI+ +KFCRKDAVF A+ +S+E+  +  RF++ +  IW      K+ + G  S  I  P+SKS ++    N                P+W++L +LKC C  ++LG +YL++    ++  + R ELL  S ++ IL W  +WKRRL RF++++ +G C KF+
Sbjct:   72 SLCQSGSQSFQCAPPFKDISRGVSVYSTSTCGEHQPQNLCRSNTNCQLCSVNSTKWKFSSEYLTDRHDVENQTCWASGYIRPGEAVNLTISLGKRFEVYYISLQPCSIGSIPHSIAIYKSSDFGRTWRPWHYFSTDCYRAFGLPTSN----EHNSHITSANLQEVLCVALQPRESYYSHQVPSDWVIAFSTTLGRPATRPWSPALIDWMTMTDVRISLMSFHQSNEPEYRIKRNAYRNSQTDLKVNIRKSVNVTIDPKILSEIDFYAFADIAIGGRCKCNGHASECILGS-NGKLICACEHHTSGEDCEYCKPGYMDRPWDRATTQDANVCKKCDCNLHSNECRFSNSLYLLSNRISGGICENCQHNTIGRNCHQCAEGYYRDWTKPISHENVCLPCRCHPIGSIVRHDCDRRSGQCRCKQGVAGLTCDRCQDGYHQTRSPLNPCTK------GDINCPPCSTNKERIKLKKFCRKDAVFEASFKSRELHENMARFEMHITQIWRIN---KEFFKG--SSSIYWPASKSFIDFEQHNQGEHEEEIRRKSNELVPVWVRLNELKCKCPYIELGVSYLIVTDFESFTNKIRNELLF-STKTAILPWRSSWKRRLIRFRRRENRGACEKFR 682          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 339.347 bits (869), Expect = 1.295e-107
Identity = 204/611 (33.39%), Postives = 312/611 (51.06%), Query Frame = 2
Query:  266 TPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVCPIKSPR----DNLITDYHLTHNQTCWKSV----PLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNP-KPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKY-----IQMESAENKCKACDS------KRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            +P PCY  HG+A +C+P F N       +  + C  K                    C    P+     + +TD +  HN TCW+S      LQ N V +T S  K+FEV Y+S+  C S  P+++A +KS ++G TW P+ + +T C  +FN       + Q         EQ A C     +  D  P+    VAF+T L+G   A++      L DW++A+D+R+T  +   P +P +     F         ++SD+ +GGRCKCNGHA+ C K   T  + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +GYYRD +KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K          S+  +   CDS       + +I  +K+C+KD      +   +  G++ +F V + +++                       +SR+  R    +W++ +D+ C C +++ G+ YLL+        Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:   33 SPDPCYDEHGAARRCIPDFVNAAFGKEVRASSTCGLKGPSRYCAQDKGEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQALQGN-VTLTLSLGKKFEVTYVSVQFC-SKRPDSMAIFKSMDYGKTWVPFQFYSTQCRKVFNRPNRAAITKQ--------NEQEAVCTD---AHADGRPLSGGLVAFST-LDGRPSAHDFDNSPVLQDWVTATDVRVTFSRLTAPGEPDEDEDSLF--------YAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTTASSPEEPADCDSYCKASKGKLKINMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVYK--------------------QGESRI-RRGDQLLWVRAKDVACKCPKIKTGKKYLLLGNDEDSPGQSG---VVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 596          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 340.117 bits (871), Expect = 5.416e-106
Identity = 204/611 (33.39%), Postives = 312/611 (51.06%), Query Frame = 2
Query:  266 TPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVCPIKSPR----DNLITDYHLTHNQTCWKSV----PLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNP-KPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKY-----IQMESAENKCKACDS------KRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            +P PCY  HG+A +C+P F N       +  + C  K                    C    P+     + +TD +  HN TCW+S      LQ N V +T S  K+FEV Y+S+  C S  P+++A +KS ++G TW P+ + +T C  +FN       + Q         EQ A C     +  D  P+    VAF+T L+G   A++      L DW++A+D+R+T  +   P +P +     F         ++SD+ +GGRCKCNGHA+ C K   T  + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +GYYRD +KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K          S+  +   CDS       + +I  +K+C+KD      +   +  G++ +F V + +++                       +SR+  R    +W++ +D+ C C +++ G+ YLL+        Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:  210 SPDPCYDEHGAARRCIPDFVNAAFGKEVRASSTCGLKGPSRYCAQDKGEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQALQGN-VTLTLSLGKKFEVTYVSVQFC-SKRPDSMAIFKSMDYGKTWVPFQFYSTQCRKVFNRPNRAAITKQ--------NEQEAVCTD---AHADGRPLSGGLVAFST-LDGRPSAHDFDNSPVLQDWVTATDVRVTFSRLTAPGEPDEDEDSLF--------YAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTTASSPEEPADCDSYCKASKGKLKINMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVYK--------------------QGESRI-RRGDQLLWVRAKDVACKCPKIKTGKKYLLLGNDEDSPGQSG---VVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 773          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: ntn1b (netrin-1-like [Source:NCBI gene;Acc:111191060])

HSP 1 Score: 327.02 bits (837), Expect = 1.353e-102
Identity = 197/609 (32.35%), Postives = 305/609 (50.08%), Query Frame = 2
Query:  269 PSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKKEVC-----------------------PIKSPRDNLITDYHLTHNQTCWKSVPL--QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK---------YIQMESA---ENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIW-HSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAEL-LIKSPRSIILTWNPTWKRRLNRFKQKKEKGEC 1954
            P PCY  +G   +C+P F N       +  + C  +                          P K+     +TD +  HN TCW+S        +V +T S  K+FEV Y+SL  C S  P ++A YKS ++G TW P+ + +T C  MFN       + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+D+R+T  +      +  +    AR+S     ++SD+ +GGRCKCNGHA+ C K+     + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +GYYRD TK + H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K         Y   E     ++ CKA   K  ++  +K+C+KD      +   +  G++ +F + + +++   ++ I+                      R    +W++ +D+ C C +++ G+ YLL+         +R +  ++    S+++ W   W RRL +F+Q+ ++G+C
Sbjct:   54 PDPCYDENGQPRRCIPDFVNAAFGKEVRASSTCGAQTAARYCVVTERGEERSRECHTCDAADPKKAHPAAYLTDLNNPHNLTCWQSESYVQHPQNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIYKSMDYGKTWVPFQFYSTQCKKMFNRPSRAAITKQ--------NEQEAVCTD---SHTDMRPLAGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDVRVTFSRLHTFGDENEDDSELARDS--YFYAVSDLQVGGRCKCNGHASKCVKDRDGGGLVCECKHNTAGAECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKAISHRRACKACDCHPVGAA-GKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVASPTATYTSAEEPTDCDSHCKASKGK-MKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGEHRIR----------------------RGDQLLWVRAKDVACKCPKIKPGKKYLLLGSDDD---DSRGQSGVVADKGSLLIPWKDLWARRLRKFQQRDKRGKC 620          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 275.018 bits (702), Expect = 7.126e-82
Identity = 180/600 (30.00%), Postives = 284/600 (47.33%), Query Frame = 2
Query:  266 TPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK------------------EVCPIKSPR----DNLITDYHLTHNQTCWKSV----PLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNP-KPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            +P PCY  HG+A +C+P F N       +  + C  K                    C    P+     + +TD +  HN TCW+S      LQ N V +T S  K+FEV Y+S+  C S  P+++A +KS ++G TW P+ + +T C  +FN       + Q         EQ A C     +  D  P+    VAF+T L+G   A++      L DW++A+D+R+T  +   P +P +     F         ++SD+ +GGRCKCNGHA+ C K   T  + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +GYYRD +KP+ H+  CK+                                   A     ++S E P          ++ CKA   K  +I  +K+C+KD      +   +  G++ +F V + +++                       +SR+  R    +W++ +D+ C C +++ G+ YLL+        Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:  210 SPDPCYDEHGAARRCIPDFVNAAFGKEVRASSTCGLKGPSRYCAQDKGEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQALQGN-VTLTLSLGKKFEVTYVSVQFC-SKRPDSMAIFKSMDYGKTWVPFQFYSTQCRKVFNRPNRAAITKQ--------NEQEAVCTD---AHADGRPLSGGLVAFST-LDGRPSAHDFDNSPVLQDWVTATDVRVTFSRLTAPGEPDEDEDSLF--------YAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKEIP--------------------------------VAPPTTTASSPEEP-------ADCDSYCKASKGK-LKINMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVYK--------------------QGESRI-RRGDQLLWVRAKDVACKCPKIKTGKKYLLLGNDEDSPGQSG---VVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 723          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: ntn1b (netrin-1-like [Source:NCBI gene;Acc:111191060])

HSP 1 Score: 263.077 bits (671), Expect = 6.988e-79
Identity = 173/597 (28.98%), Postives = 276/597 (46.23%), Query Frame = 2
Query:  269 PSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKKEVC-----------------------PIKSPRDNLITDYHLTHNQTCWKSVPL--QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIW-HSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAEL-LIKSPRSIILTWNPTWKRRLNRFKQKKEKGEC 1954
            P PCY  +G   +C+P F N       +  + C  +                          P K+     +TD +  HN TCW+S        +V +T S  K+FEV Y+SL  C S  P ++A YKS ++G TW P+ + +T C  MFN       + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+D+R+T  +      +  +    AR+S     ++SD+ +GGRCKCNGHA+ C K+     + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +GYYRD TK + H+  CK         + P                        AS      S E P          ++ CKA   K  ++  +K+C+KD      +   +  G++ +F + + +++   ++ I+                      R    +W++ +D+ C C +++ G+ YLL+         +R +  ++    S+++ W   W RRL +F+Q+ ++G+C
Sbjct:   54 PDPCYDENGQPRRCIPDFVNAAFGKEVRASSTCGAQTAARYCVVTERGEERSRECHTCDAADPKKAHPAAYLTDLNNPHNLTCWQSESYVQHPQNVTLTLSLGKKFEVTYVSLQFC-SPRPESMAIYKSMDYGKTWVPFQFYSTQCKKMFNRPSRAAITKQ--------NEQEAVCTD---SHTDMRPLAGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDVRVTFSRLHTFGDENEDDSELARDS--YFYAVSDLQVGGRCKCNGHASKCVKDRDGGGLVCECKHNTAGAECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKAISHRRACK---------EIP-----------------------VASPTATYTSAEEP-------TDCDSHCKASKGK-MKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGEHRIR----------------------RGDQLLWVRAKDVACKCPKIKPGKKYLLLGSDDD---DSRGQSGVVADKGSLLIPWKDLWARRLRKFQQRDKRGKC 570          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009682.1 (pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 gene:ENSPMAG00000008750.1 transcript:ENSPMAT00000009682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.933 bits (424), Expect = 6.857e-47
Identity = 110/319 (34.48%), Postives = 160/319 (50.16%), Query Frame = 2
Query:  497 AKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFN---TVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
             K F++ Y+ L    +  P + A YK  +    W P+ Y + +C   +  +            R    EQ   C       +D  P+   N   + LEG   AY       L DW+++++IR+TL + +    +  N  +  R+      +ISD ++GGRCKCNGHA+ C KN +   + C C+HNT G DCEKC   Y D PW RAT  S  +C  C+CN  +  CYF  +LY  R    GG CTNC+ NT G  C  C + +YR      +H   C  C C+ +G+ +  +CD++ G+C CK GV GE C++C  GF
Sbjct:    1 GKAFDITYVRLKF-HTSRPESFAIYKRASMDGPWTPYQYYSGSCEPTYGKRNRGF-------LRSGDDEQTPLCTD---EFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQDWVTSTEIRVTLNRLNTFGDEVFNDHKVLRS---YYYAISDFAVGGRCKCNGHASECVKNEL-GALACKCRHNTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDPELY--RATGHGGHCTNCRDNTDGKTCERCLENFYR--RSASEH---CLPCNCNPVGS-YSRQCDEQ-GRCSCKQGVMGERCDQCLPGF 295          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008925.1 (pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 gene:ENSPMAG00000008054.1 transcript:ENSPMAT00000008925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.28 bits (360), Expect = 1.473e-35
Identity = 104/369 (28.18%), Postives = 169/369 (45.80%), Query Frame = 2
Query:  506 FEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLA---TNCLSMFNMKETTIPSLQFNDFRIQRREQAARC---FPLKLSLTDNEPVVAFNTVLEGAYENVGDSS--LIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKI---------LSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQIT-------GGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGA-----------KFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCK 1507
            F+V Y+ +    S  P      +S + G T+ PW Y +   + CL+ + +  T           + RR+    C   + + L L   +     +T L     +  D S  L+D+ SA  IR+ L +    +   +++   +   P+++          SI DIS+GG C C+GHA+ C  N  T K+EC C+HNT G++C+ C   Y    W   T+N+   C+KC C+  + +CY+  ++    + ++       GGVC NC  NTAG  C  C DG+YR      +  + C+ C C   G+             P++ D   GQCLC+ G  GE C RCA  +R     + PC+  +   + ++ C 
Sbjct:    3 FQVAYVIVKAANSPRPGNWILERSLD-GATYHPWQYYSVSDSECLTRYGITPTV-------GNPVYRRDDEVICTSYYVVLLMLARGK----IHTSLINGRPSADDPSPKLLDFTSARYIRLRLQRI---RTLNADLMTLSHRDPREVDPIVTRRYYYSIKDISVGGMCICSGHASTCPWNEDTQKMECQCEHNTCGENCQHCCPGYNQRRWRPGTINNGNTCEKCNCHGKTEDCYYDAEVDRTNRSLSVHGRFSGGGVCVNCSANTAGTNCETCRDGFYRPTGVLPNDPYPCRLCQCDPQGSLSQVCIKDEKHADPEK-DLSPGQCLCRPGFAGERCERCAFAYRGYPDCK-PCLCSMAGGTNDDPCS 354          

HSP 2 Score: 69.707 bits (169), Expect = 1.460e-12
Identity = 64/218 (29.36%), Postives = 93/218 (42.66%), Query Frame = 2
Query:  950 GGRC---KCNGHANACNK------NPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDR--CDKRTGQCL-CKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACDSKRTRIRFQKFCRKDAV 1567
            GGRC   +C+GHA+ C+        P++      C+HNT G  CE C+  +    +  AT  +   C  C C L  ++  FS   +   + +    C  C     G+RC  C D ++ + + P      C++C C+     +     CD RTGQCL C+    G  C RCA GF   ++T T   +  Q          CD    RI  Q  CR   V
Sbjct:  619 GGRCEPCRCHGHADDCDDLSGDCMLPLSG-----CRHNTMGPHCELCRPGF----YGNATRGTADDCLPCTCPLSIASNNFSPTCHQDPRGVL--TCDQCLPGYIGLRCERCADDFFGEPSSP---GGSCRRCECNGNEEAWGGGRVCDARTGQCLRCRERTAGFHCERCADGF-YGDATGTGGCQPCQCHPEGATAPQCD----RINGQCPCRPSVV 817          

HSP 3 Score: 69.3218 bits (168), Expect = 2.316e-12
Identity = 49/144 (34.03%), Postives = 67/144 (46.53%), Query Frame = 2
Query: 1043 GQDCEKCKKNYLDLPWARATVNSPA-QCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFR--QSNSTETPC 1465
            G  CE+C  ++   P      +SP   C++CECN +    +    +   R     G C  C+  TAG  C  C DG+Y D T        C+ C CH  GA  P +CD+  GQC C+  V G  C +CA GF    S +  +PC
Sbjct:  713 GLRCERCADDFFGEP------SSPGGSCRRCECNGNEEA-WGGGRVCDART----GQCLRCRERTAGFHCERCADGFYGDATG----TGGCQPCQCHPEGATAP-QCDRINGQCPCRPSVVGRTCEQCAIGFYGLSSGAGCSPC 840          

HSP 4 Score: 52.7582 bits (125), Expect = 2.798e-7
Identity = 44/142 (30.99%), Postives = 59/142 (41.55%), Query Frame = 2
Query: 1025 CQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSS---NCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGY--YRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            C  NT G +CE C+  +          N P  C+ C+C+   S    C   +      K ++ G C  C+   AG RC  C   Y  Y D          CK C C + G    D C +    C+CK  V GE C+RC +GF
Sbjct:  250 CSANTAGTNCETCRDGFYRP--TGVLPNDPYPCRLCQCDPQGSLSQVCIKDEKHADPEKDLSPGQCL-CRPGFAGERCERCAFAYRGYPD----------CKPCLCSMAGGTNDDPCSE---PCVCKERVEGEHCDRCRAGF 375          

HSP 5 Score: 51.2174 bits (121), Expect = 7.912e-7
Identity = 46/148 (31.08%), Postives = 56/148 (37.84%), Query Frame = 2
Query: 1019 CVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPD----------RCDKRTGQCLCKSGVTGEMCNRCASG 1432
            C+C  NTEG  C +C    +D  W    VN  A C+ C C+   S           R     G C+ C     G  C  C  G    W  P      C+ C CH  G +              CD+RTGQC CK  V G  C+ C  G
Sbjct:  903 CLCPPNTEGTRCHRC----IDDHWG---VNPHAGCRACNCSAAHSR--------GARCDEASGQCS-CLDGYGGRTCGECAQGR---WGYP-----ACRPCECHPEGTRANTCPAPPTGSLCGCDERTGQCACKENVGGTRCDACLPG 1026          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004614.1 (pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 gene:ENSPMAG00000004198.1 transcript:ENSPMAT00000004614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 4.035e-24
Identity = 65/212 (30.66%), Postives = 108/212 (50.94%), Query Frame = 2
Query:  506 FEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEGAYENVG--DSSLIDWMSASDIRITLFK--------FDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARA 1099
            F++ Y+ L    +  P + A YK  +    W+P+ + +  C   F +     PS  F   R    E+ A C       +D  P+    VAF+T LEG + + G   S+  +W++A+D+R++L +        F +PK  +S  +           ++SD+++GGRCKC+GHA+ C +     ++ C CQHNT G DCE+C  ++   PWA+A
Sbjct:    1 FQITYVRLR-FHTSRPESFAIYKRTSPASPWQPYQFYSGTCERTFGL-----PSRGF--LRAGDEERTALC---SDEFSDISPLTGGNVAFST-LEGLFHSTGPLSSATQEWVTATDVRVSLRRLNTFGDEVFGDPKVLRSYYY-----------AVSDLAVGGRCKCHGHASECGRGS-DGRLVCRCQHNTTGDDCERCLPSHNSRPWAQA 188          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004606.1 (pep scaffold:Pmarinus_7.0:GL477874:5526:15188:-1 gene:ENSPMAG00000004198.1 transcript:ENSPMAT00000004606.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 7.713e-24
Identity = 65/219 (29.68%), Postives = 109/219 (49.77%), Query Frame = 2
Query:  497 AKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTV--LEGAYENVGDSSLI-DWMSASDIRITLFK--------FDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVN 1108
             K F++ Y+ L    +  P + A YK  +    W+P+ + +  C   F +     PS  F   R    E+ A C       +D  P+    VAF+T+    GA    G+  L  +W++A+D+R++L +        F +PK  +S  +           ++SD+++GGRCKC+GHA+ C +     ++ C CQHNT G DCE+C  ++   PWA+A+ +
Sbjct:    3 GKAFQITYVRLR-FHTSRPESFAIYKRTSPASPWQPYQFYSGTCERTFGL-----PSRGF--LRAGDEERTALC---SDEFSDISPLTGGNVAFSTLEGRPGALAFDGNDKLQQEWVTATDVRVSLRRLNTFGDEVFGDPKVLRSYYY-----------AVSDLAVGGRCKCHGHASECGRGS-DGRLVCRCQHNTTGDDCERCLPSHNSRPWAQASSD 198          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003212.1 (pep scaffold:Pmarinus_7.0:GL478430:191288:204969:1 gene:ENSPMAG00000002937.1 transcript:ENSPMAT00000003212.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 9.991e-20
Identity = 67/235 (28.51%), Postives = 103/235 (43.83%), Query Frame = 2
Query:  440 TCWKSVPLQAN----HVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSL-QFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEG-AYENV--------GDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARAT 1102
            T W+SV  + +     VNIT S+ K  E+    +   ES  P+A+   KS ++G TW    Y A +C  +F  +      L Q +  ++   E+ +R F  K   T    V+    +  G    NV        GD  L  + + +D+R  L +     P   + F    N  K   ++S++ + GRC CN HA  C       ++ C C+HNT G DC KCK+ +    W   T
Sbjct:   59 TYWQSVSWRRHPEPLRVNITMSWGKTIELTDDVVITFESRRPSAMVLDKSLDYGRTWSAVQYYADDCHELFRREARRALDLTQASATQVICTEEYSRSFVAKQDRTVRFEVLNRTALFAGVGLRNVASLYARLDGDGELRRFFTLTDLRARLLQ-----PATGDTFIDKENLKKYYYAVSNVQVRGRCTCNLHAKECKFE--KGQLLCECEHNTTGSDCGKCKRGFRGRLWKAGT 286          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO36836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI5])

HSP 1 Score: 267.7 bits (683), Expect = 2.292e-81
Identity = 171/588 (29.08%), Postives = 285/588 (48.47%), Query Frame = 2
Query:  296 AYQCMPPFTNIVENMIPKIETLC--KKKEVCPIKSPRD------------------NLITDYHLTHNQTCWKSVPLQA-NHVNITFSFAKRFEVYYISLTPCESGI-PNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLI--DWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVK----YIQMESA-----ENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQE--IIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGEC 1954
            A  C P F ++  N    +   C  K +  CP  S R                     +TD H  +N TCW++ P+Q+  +V +  SF K +++ Y+SL  C  GI P+++  YKS ++G +W+ + + ++ C  M+        S +         EQ A C    L        +AF+T+      +  D S +  +W+ A+DI++            + I R AR       ++S+ ++GGRC CNGHA+ C  +    ++ C C+HNT G DC  C+  + D PW  AT +S  +CK C CNLH+  C FS +L+ L    +GGVC  C+HNTAG  CHYC +G+Y+D  K + H  VC++C CH  G++    C++ TGQC CK GV G  C++CA G++ + S   PC++     +  ES+     +  C  C  +R  ++ ++FCRKD     T+   E  +   ++R  V ++ ++    + +      +                    +W+K RD +C C +L+ G++Y +   +     Q+R   ++ + RS++L WN    +R+ RF + +    C
Sbjct:   12 AQLCQPAFHDLAYNKDVYVSHTCGEKSRRFCPPMSVRGRTACGFCDERNAKTSHPAKYLTDVHNENNVTCWQADPVQSRENVTLILSFGKTYDITYVSLQFC--GIRPDSMGIYKSMDYGKSWQAYQFYSSRCEKMYGRVTNGEISPE--------NEQVALCTDGHLLRPLYGGRIAFSTLEGRPSASKMDYSAVMQEWVMATDIKVEF----------NMISRSARPRDSLYYAVSEFNVGGRCHCNGHASECVSDRNGRQV-CDCKHNTVGVDCGACRPFFNDRPWRPATHHSANECKMCNCNLHARTCVFSMELFKLSGGRSGGVCVKCRHNTAGRYCHYCREGFYKDPNKHITHIKVCRQCNCHPHGSR-GRVCNQSTGQCPCKEGVVGRSCDKCAPGYKSTKSNIVPCIETPNVVMSQESSTPRSRDQGCSQC--RRVPLKVKRFCRKDFALKVTVVRVEKKLPNSWVRATVNINTLFKRSRTRRVRRGDGY--------------------VWIKKRDFRCRCPKLKPGRSYFI---AGNLRGQSRKRSIVLNGRSVVLPWNEKLLKRIYRFIKLQRNNNC 552          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO36523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF3])

HSP 1 Score: 173.326 bits (438), Expect = 5.162e-45
Identity = 137/427 (32.08%), Postives = 201/427 (47.07%), Query Frame = 2
Query:  278 CY-AHGSAYQCMPPFTN------IVENMI----PK-------IETLCKKKEVCPIKSPRDN----LITDYHLTHNQTCWKSVPLQANH---VNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLE--GAYENVGDSSLIDWMSASDIRITLFK---FDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPI---TNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWT-KPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCAS---GFRQSN 1447
            CY + G A +CMP F N      ++ N      PK       +  + K+ E+C    P        ITD     N+T W+S  L  N    V +T    K ++V YI +    S  P ++A YK       W P+ Y +  C   + +    I      D R Q+       F     LT     VAF+T+ +   AY      +L +W++A  +RI L +   F +      N+ R          +I D+SIGGRCKCNGHA+ C +  +     +++C CQH+TEG DCE+CK  Y D PWARA+  +  +C +C CN  + +C F + LY  R+   GG C NC+ NT G  C  C + +YR  + +P      C  C C+ +G+    +C+   GQC CK GVTG  C++C +   GF Q+ 
Sbjct:   21 CYDSQGRAQRCMPQFGNAAFGKRVISNNTCGDPPKKFCVQTGVLEVRKECEMCNSSDPALEHPALKITDIKDDTNRTWWQSETLLENPDKPVTLTLDLGKSYDVSYIRIR-FRSPRPESMAIYKKTTPSSKWIPYQYFSATCEKTYGVTTNGIV-----DPRNQQVALCTDAFSTITPLTGGN--VAFSTLEDRPDAYNFDNSPALQEWVTAVAVRIHLRRMNTFGDEVFGDPNVLR------SYYYAIIDLSIGGRCKCNGHASECEETRLWDGQTRLQCKCQHDTEGVDCERCKPLYNDRPWARASSRNANECVRCNCNGLAESCVFDEALY--RQTGHGGRCQNCKQNTDGPNCERCKENFYRKTSLEP------CVACGCNPVGS-VSLQCNSE-GQCRCKPGVTGIKCDKCQANYFGFSQTG 423          

HSP 2 Score: 76.2554 bits (186), Expect = 2.704e-14
Identity = 77/291 (26.46%), Postives = 119/291 (40.89%), Query Frame = 2
Query:  662 PSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHI-IGAKFPDRCDKRTGQCL-----CKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACD 1516
            PSL  +DF  QR   + +   ++++  D    +      E A  +    + ++W+         +K +N +  K    R A ++ +    +        C+C GH++ C+  P+T K  C C+HNT G  C+KC   Y   P    T  +P  CKKC C   +       ++          VCT+C     G  C  C DGYY D          C+KC C   I       CD+ TG CL      ++G   + C  CA G+   N+T  P          + +CKAC+
Sbjct:  615 PSLTSHDF--QRLLTSIKSIKIRMNYADQGTGMLDGMFFESAVYDPTSPNQVNWVEQCSC-PKEYKGNNCEQCKDGYTRQAGSTDRYAQCVP-------CQCYGHSDTCD--PVTGK--CNCKHNTTGIRCDKCIDGYYGNP----TQGTPDDCKKCPCKFGTRCIQIGANV----------VCTDCPEGHVGNLCDMCQDGYYGDPMGKRGAPTTCQKCNCSGNIDPNAIGSCDRLTGDCLKCIHNTRNGPISQ-CELCAIGY-YGNATHYP----------KPQCKACE 865          

HSP 3 Score: 50.8322 bits (120), Expect = 1.988e-6
Identity = 43/137 (31.39%), Postives = 58/137 (42.34%), Query Frame = 2
Query: 1025 CQHNTEG---QDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCA 1426
            C HNT       CE C   Y    +  AT     QCK CEC +  +      D  +       G CT C  N +G +C  C   Y+      +     C+ C C   G+ + + C   TGQC CK GVTG  C++C+
Sbjct:  830 CIHNTRNGPISQCELCAIGY----YGNATHYPKPQCKACECYVQGTVSPPGHDPTLPFPCDDKGRCT-CLPNVSGDKCDTCRPEYWN-----VASGKGCEPCNCDTTGS-WNNTCSVTTGQCHCKPGVTGRRCDQCS 955          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO36500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF5])

HSP 1 Score: 160.229 bits (404), Expect = 9.897e-41
Identity = 122/401 (30.42%), Postives = 191/401 (47.63%), Query Frame = 2
Query:  269 PSPCY---AHGSAYQCMPPFTNIVENMIPKIETLCKKKEVCPIKSPRDNLITDYHLTHNQTCWKSVPLQANH------VNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYE--NVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKIL-SISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCD-KRTGQCLCKSGVTGEMCNRCASG 1432
            P PCY   A+ S      P TN+V+N +           V P  + +      Y    +QT W++  L  +       VNIT SF KR+++         S  P A+ F KSN+FG TW+     A  C   +NM+  + P    N F++   E+ +   P KL       +V F  +    YE  +  +  + D++S +D+R+   + + P      +      +  K+  +IS++ + GRC CNGHA  C+  PI ++  C C+HNT G DCE C+  + + PW RA      +C++C CN H+++C +++ L         G+C  CQHNT G  C  C   +YRD +KP++H   C   T +  G+      D ++ GQC CK  V G  C++C  G
Sbjct:   75 PEPCYYCDANSSNSNEQHPVTNLVDNEL-----------VLPFYAQK------YTWWQSQTWWETNQLGLSSIENPPKVNITLSFGKRYQLSGHIKATFYSKRPKAMCFDKSNDFGHTWETLLCYAWRCDRFYNMEPQSNPD-PANPFKLYCTEEYSGHEPRKLG------IVEF--IASKRYEICDYFNPEVQDYLSVTDVRL---RLEYPASDGMELLYQDEQTLNKLYYAISNVEVTGRCSCNGHAMGCS-GPIMSR-RCECEHNTMGTDCEMCEPLFNNRPWMRANQTHGNECQECNCNNHATSCVYNETLGY-------GLCKGCQHNTQGDHCQNCTAKHYRDLSKPINHVNACLGITNN--GSCLTQATDTEQIGQCSCKPNVYGRRCDQCIPG 435          

HSP 2 Score: 58.5362 bits (140), Expect = 9.425e-9
Identity = 54/192 (28.12%), Postives = 79/192 (41.15%), Query Frame = 2
Query:  971 GHANACNKNPITNKIE-CVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYY---------RDWTKPLDHKFVCKKCTCHIIGAKFPDR--CDKRTGQCLCKSG--VTGEMCNRC-ASGFRQSNST----ETP-CVKYIQME 1486
            G A A     +   +E   C  N  G  CE C + Y   P      +   +C  C CN  S  C+              GVCT+C+  T G RC  C +            + W    D    CK C C++ G  + +   CD+ TGQC C +   + G++C+RC  + + +S+S     E P C  YIQ +
Sbjct: 1057 GSAKARGGGEVAGFVERAECHRNYTGLSCEVCAEGYTRQPMGGTPFD---RCVLCSCNDRSRFCHPET-----------GVCTDCKIGTHGYRCELCTNNVQGPECVRCKPQYWGLSKDG---CKACDCNLPGTLYSNTSVCDQTTGQCSCNATLHIGGQLCDRCEENAYNKSDSLFDCHECPSCYAYIQTD 1231          

HSP 3 Score: 49.6766 bits (117), Expect = 4.851e-6
Identity = 29/77 (37.66%), Postives = 40/77 (51.95%), Query Frame = 2
Query: 1202 GGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASG 1432
            GG C  C+   AG++C++C  GYY   +        CKKC C + G+  P  CD   G+C CK+ V G  C+ C  G
Sbjct:  780 GGQCP-CKPGVAGLKCNHCLPGYYALSSSG------CKKCECSMSGSITP-VCDNADGKCQCKANVEGAKCDACKYG 848          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO36501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF6])

HSP 1 Score: 157.147 bits (396), Expect = 9.388e-40
Identity = 99/321 (30.84%), Postives = 156/321 (48.60%), Query Frame = 2
Query:  476 VNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNS-PAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            VN++ SF K +++    +   ES  P+     KS + G TW P  Y + NC   F M+ T     +F DF  +  E+ +   P +         V F+ +      +  D+ +  ++SA+D+R+   + + P      + +      +   ++SD+ +  RCKC+GHA  C+    T K  C C HNT G DCE+C   + +  W  AT  + P  C++CEC+ H+ +C +SQ       Q   G C +C HNT G  C  C D +YR+ +  L+H  +C  C C   G      C++ TGQC C++ VTG  C+ CA  F
Sbjct:  117 VNVSISFNKTYDITGHIMFTFESPRPSKAILEKSFDKGQTWDPLQYYSFNCRKDFGMENTDPTENRFGDFSAKCTEKYSSSSPQQ------NGKVTFDFLRRYNKASFFDTQVQQYLSATDLRL---RMEYPGTDGLEVAKDEVTLKQYYYAVSDLEVIARCKCHGHARWCDFPHETGK-NCDCLHNTTGDDCERCLPLFNNKTWMPATSETEPNPCERCECHSHADSCTYSQ-------QEGYGTCDDCYHNTEGHFCERCKDKFYRNMSLSLNHPEICPDCNCFPQGITNNGTCNQTTGQCECRANVTGRQCDSCADTF 420          

HSP 2 Score: 64.6994 bits (156), Expect = 1.158e-10
Identity = 70/276 (25.36%), Postives = 102/276 (36.96%), Query Frame = 2
Query:  956 RCKCNGHANACNKNPITNKIECV-CQHNTEGQDCEKCK-KNYLDLPWARATVNSPAQCKKCEC----NLHSSNCYFSQDLYILRKQITG------------------GVCT-----------------------NCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIW 1642
            RC+C+ HA++C  +       C  C HNTEG  CE+CK K Y ++  +   +N P  C  C C      ++  C  +      R  +TG                  G CT                       +C+ N     C  C  GY+ D+ K LD    CK+C C   G      C K TG C+C++ + G  C    +G+       TP   Y+  E+ E       +    ++       D  FS T   +   G +I F   VD  W
Sbjct:  325 RCECHSHADSCTYSQQEGYGTCDDCYHNTEGHFCERCKDKFYRNMSLS---LNHPEICPDCNCFPQGITNNGTCNQTTGQCECRANVTGRQCDSCADTFWGYTLEPIGYCTECLCVGNGTVNASFNCDQYNGQCSCKPNVHTRTCQECKHGYW-DFPKTLDTD--CKRCDCDY-GGSVLQICSKTTGSCMCRTNIIGTRCTDVTTGYF------TPSFSYLTFEAEE-------ATGDYMQASNTLDLDMFFSGTGYGRITPGQYINFQARVDVNW 580          

HSP 3 Score: 49.2914 bits (116), Expect = 6.173e-6
Identity = 42/154 (27.27%), Postives = 67/154 (43.51%), Query Frame = 2
Query: 1016 ECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTE----TPC 1465
            +C C+     + C +C  ++           + + C +C CN+  S      D+         G CT C+++T G +C  C  G+Y ++T        C+ C CH  G++   +C+ +TG C CKS   GE C  C  G   S+       TPC
Sbjct:  801 QCPCKPGVITRTCSRCNDSFYGY-------TTGSGCVECRCNMSGSADAQCDDVT--------GNCT-CKNSTDGAKCAECRFGFY-NFTSA-----GCQACNCHEGGSQ-SQQCNLQTGICTCKSNALGEKCESCRPGTYHSDPNNPDGCTPC 931          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO39502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9X8])

HSP 1 Score: 135.961 bits (341), Expect = 6.918e-33
Identity = 101/406 (24.88%), Postives = 167/406 (41.13%), Query Frame = 2
Query:  299 YQCMPPFTNIVENMIPKIETLCKKKEVCPIKSPRDN------LITDYHLTHNQTCWKSVPLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFD-------NPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANAC---NKNPITNKI---ECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKR--------TGQCLCKSGVTGEMCNRCASGF 1435
            YQ  P F+++ + M+   +   KK E    ++ R+N      L +++H TH                       RF  +           P  +   +S ++G  W+ + Y + +C  +F       P    +D     +          +  + N  V+      +   +N   S + + +  ++IRI   K         +P+P+    + +A         + D+ I G C C GHA  C      P T  +    C C HNT G++CE+C+  Y D+PW  A  ++P +C+KC CN H+  C F   +Y     ++GGVC +C+HNT G  C  C   +Y+D +K       C  C C   G      C+ +         G+C+CK  V G  C+RC +GF
Sbjct:   72 YQTNPQFSHVPKYMLSSFDGR-KKDEWWQSENGRENVYLQLDLESEFHFTH--------------------LIMRFRTFR----------PAGMVIERSWDYGKKWQIYRYFSADCDKIFPGIPKGEPK-DIDDVICTNKYST-------VEPSTNGEVIFRALKSQIPIKNAYSSKVQNLLKITNIRINFTKLHTLGDDLLDPRPEIKRKYYYA---------VYDLVIRGSCSCYGHAEQCLPEPGQPTTPGMVYGRCNCTHNTTGKNCERCQDGYFDVPWRPADADNPNECRKCNCNGHAVKCRFDPAVYQASGNVSGGVCQDCEHNTVGRNCERCKPLHYQDPSKKFSDPDACIACNCDPTGGVNGGECEAKNDPAAGLVAGRCICKRNVGGVRCDRCKAGF 429          

HSP 2 Score: 85.5001 bits (210), Expect = 4.435e-17
Identity = 62/163 (38.04%), Postives = 80/163 (49.08%), Query Frame = 2
Query:  959 CKCNGHANACNKNPITNKIECV-CQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGV-CTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTC-HIIGAKFPDRCDKRTGQCL-CKSGVTGEMCNRCASGF 1435
            C+C GHA++C  NP T    CV CQHNT G++CE C   +    +  AT  +P  CK+C+C   SS   FS+  Y+        V C  CQ    G +C  C DGYY +   PL     CK C+C + I       CD+ TG CL C     G  C RC  G+
Sbjct:  850 CRCYGHASSC--NPKTGV--CVDCQHNTVGKNCEACAVGF----YGIATKGTPNDCKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDKCQVGYTGRQCEECADGYYGN---PLVPGGSCKPCSCNNNIDPTVSGNCDRLTGSCLQCLYNTAGFNCERCKPGY 1001          

HSP 3 Score: 69.707 bits (169), Expect = 2.762e-12
Identity = 52/179 (29.05%), Postives = 75/179 (41.90%), Query Frame = 2
Query:  914 PKKILSISDISIGGRCKCNGHANA----CNKNPITNKI--ECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASG 1432
            P K  S  D  I   C   G  N        +P    +   C+C+ N  G  C++CK  + +L     T ++P  CK C CN   +    + D          G CT C+    G  C  C   Y+   + P      C  C C + G  + ++CDK+TGQC C+ G+TG  C R  +G
Sbjct:  370 PSKKFSDPDACIACNCDPTGGVNGGECEAKNDPAAGLVAGRCICKRNVGGVRCDRCKAGFFNL-----TTDNPDGCKACGCNPLGTIGECNPDT---------GRCT-CKRYVEGEDCDRCASEYWGLSSTPAG----CSNCACDV-GGSYDNQCDKQTGQCRCRKGITGRQCERVKTG 528          

HSP 4 Score: 62.003 bits (149), Expect = 7.483e-10
Identity = 42/138 (30.43%), Postives = 66/138 (47.83%), Query Frame = 2
Query: 1016 ECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCAS 1429
            +C C  + EG+ C++C + + +L   +        C++C+C +  S       L  +  QITG     C+    G RC  C D +   W  P D    C  C C+  G+    +CD+ TG+CLCK G  G+ C+ CA+
Sbjct: 1034 QCNCLPDVEGKQCDRCAEGFWNLSSGKG-------CQQCDCCIEGS-------LRSMCNQITGQC--QCKAGFGGPRCCECEDNF---WGSPPDG---CSACNCNPAGSVHL-QCDRDTGKCLCKVGHIGDKCDMCAA 1148          

HSP 5 Score: 56.6102 bits (135), Expect = 3.366e-8
Identity = 45/149 (30.20%), Postives = 59/149 (39.60%), Query Frame = 2
Query: 1016 ECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTC--HIIGAKFPDRCDKRTGQC-------LCKSGVTGEMCNRCASGF 1435
            +C C++   G+ C  C  N    P           C+ C C  H+S+C               GVC +CQHNT G  C  C  G+Y   TK   +   CK+C C     G KF + C   T           C+ G TG  C  CA G+
Sbjct:  822 QCQCRNWASGRQCSLCPPNMWGFPL----------CRPCRCYGHASSC-----------NPKTGVCVDCQHNTVGKNCEACAVGFYGIATKGTPND--CKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDKCQVGYTGRQCEECADGY 947          

HSP 6 Score: 53.1434 bits (126), Expect = 3.524e-7
Identity = 43/137 (31.39%), Postives = 60/137 (43.80%), Query Frame = 2
Query: 1025 CQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGF 1435
            C +NT G +CE+CK  Y     AR        C  C C+   +N  F    Y    +   G C NC  +  G +C  C +G++      L     C++C C I G+     C++ TGQC CK+G  G  C  C   F
Sbjct:  985 CLYNTAGFNCERCKPGYFGDAIAR-------NCTSCVCDKKGTNPGFH---YSCNHKT--GQC-NCLPDVEGKQCDRCAEGFWN-----LSSGKGCQQCDCCIEGS-LRSMCNQITGQCQCKAGFGGPRCCECEDNF 1102          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: NTN1 (netrin-1 [Source:NCBI gene;Acc:101155405])

HSP 1 Score: 340.117 bits (871), Expect = 4.394e-108
Identity = 203/607 (33.44%), Postives = 312/607 (51.40%), Query Frame = 2
Query:  218 SMFYKFVLSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKKEVCPIKSPRD----NLITDYHLTHNQTCWKSVPL--QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYI------------QMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            S F  + +         P PCY  HG+  +C+P F N       K+ + C K   C    P+       +TD +  HN TCW+S        +V +T S  K+FEV Y+SL  C S  P ++  YKS + G TW P+ + +T C  M+N     + + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+DI++   +      +  +    AR+S     ++SD+ +GGRCKCNGHA+ C K+     + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD +KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K              +    E+ CKA   K  +I  +K+C+KD      +   + +G++ +F V + +++                       +SR+  R    +W++ +D+ C C +++ G+ YLL+        Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:   18 SAFGGYGIGLFAAQTSPPDPCYDEHGNPRRCIPDFVNAAFGKEVKVSSTCGK--TCDASDPKKYHPPAYLTDLNNPHNLTCWQSENFIQYPQNVTLTLSLGKKFEVTYVSLQFC-SPRPESMVIYKSMDNGKTWVPFQFYSTQCRKMYNKPNRAVITKQ--------NEQEAVCTD---SHTDMYPLTGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDIKVVFSRLHTFGDENEDDSELARDS--YFYAVSDLQVGGRCKCNGHASRCVKD-RDGSLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVSPPTTPASSTEEASDCESYCKASKGK-LKINMKKYCKKDYAVQVHILKADKMGEWWKFTVNIISVYK--------------------QGESRI-RRGDQFLWVRAKDVACKCPKIKPGKKYLLLGNDEVSPSQSG---VVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 580          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: NTN1 (netrin-1 [Source:NCBI gene;Acc:101155405])

HSP 1 Score: 332.028 bits (850), Expect = 1.056e-104
Identity = 203/627 (32.38%), Postives = 312/627 (49.76%), Query Frame = 2
Query:  218 SMFYKFVLSQLHMNNLTPSPCY-AHGSAYQCMPPFTNIVENMIPKIETLCKKK--------------------EVCPIKSPRD----NLITDYHLTHNQTCWKSVPL--QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPV----VAFNTVLEG---AYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYI------------QMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            S F  + +         P PCY  HG+  +C+P F N       K+ + C K                       C    P+       +TD +  HN TCW+S        +V +T S  K+FEV Y+SL  C S  P ++  YKS + G TW P+ + +T C  M+N     + + Q         EQ A C     S TD  P+    +AF+T L+G   A++      L DW++A+DI++   +      +  +    AR+S     ++SD+ +GGRCKCNGHA+ C K+     + C C+HNT G +C++CK  + D PW RAT     +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD +KP+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K              +    E+ CKA   K  +I  +K+C+KD      +   + +G++ +F V + +++                       +SR+  R    +W++ +D+ C C +++ G+ YLL+        Q+    ++    S+++ W  TW RRL +F+Q+++KG+C K
Sbjct:   18 SAFGGYGIGLFAAQTSPPDPCYDEHGNPRRCIPDFVNAAFGKEVKVSSTCGKTPSRYCVVTSAEKGEERTRNCHSCDASDPKKYHPPAYLTDLNNPHNLTCWQSENFIQYPQNVTLTLSLGKKFEVTYVSLQFC-SPRPESMVIYKSMDNGKTWVPFQFYSTQCRKMYNKPNRAVITKQ--------NEQEAVCTD---SHTDMYPLTGGLIAFST-LDGRPSAHDFDNSPVLQDWVTATDIKVVFSRLHTFGDENEDDSELARDS--YFYAVSDLQVGGRCKCNGHASRCVKD-RDGSLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVSPPTTPASSTEEASDCESYCKASKGK-LKINMKKYCKKDYAVQVHILKADKMGEWWKFTVNIISVYK--------------------QGESRI-RRGDQFLWVRAKDVACKCPKIKPGKKYLLLGNDEVSPSQSG---VVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: ntn2 (netrin-3 [Source:NCBI gene;Acc:101160359])

HSP 1 Score: 327.405 bits (838), Expect = 9.890e-103
Identity = 197/635 (31.02%), Postives = 310/635 (48.82%), Query Frame = 2
Query:  275 PCYAH-GSAYQCMPPFTNIVENMIPKIETLCKKK--------------------EVCPIKSPR----DNLITDYHLTHNQTCWKSVPLQA--NHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARC-------FPLKLSLTDNEPVVAFNTVLEGAYENVGDSS--LIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKK--------------ILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKY-----IQMESAENKCKACDS------KRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAEL------------LIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            PCY   G+A +C+P F N        + ++C +                     ++C    PR     + +TD +  HN TCW+S  L    ++V +T S  K+FE+ Y+SL  C S  P ++A YKS ++G TW P+ + ++ C  M+N       + Q         EQ A C       +PL   L      +AF+T+         D+S  L DW++ +DIR+    F  P+  +  +     N+  +                ++ D  +GGRCKCNGHA+ C K+    K+ C C+HNTEG +C++CK  + D PW RA      +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD  +P+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K        + S+  +   C+S         +I  +K+C+KD      +   E +GD+ +F V++ +++ S+            +P+           R  N +W+ ++DL C C ++Q+ + +L++  S                       L+    S+++ W   W RRL +F++K++KG+CSK
Sbjct:   36 PCYDETGTARRCIPEFINAAFGKEVMVSSVCGRPPSRSCSVVERGDERPSVRTCQICDAADPRRAHPASYLTDLNSAHNLTCWQSENLNTSPHNVTLTLSLGKKFEITYVSLQFC-SPRPESLAIYKSMDYGKTWMPYQFYSSQCRRMYNKPNKATITKQ--------NEQEALCTDGHTDLYPLSGGL------IAFSTLDGRPSSKDFDNSPVLQDWVTVTDIRVV---FGRPQLSREFVLGAGSNNGGRDDDPVAVTSTLSTYFYAVGDFQVGGRCKCNGHASRCLKDK-EGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANAREANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGRPITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVVNPTAVVSSTEEPADCESYCKPVKGNLKINMKKYCKKDYAVQVNVLDMETVGDWAKFSVSLVSVYKSRG-----------EPL----------KRGDNILWVHMKDLACKCPKIQMSKKFLVMGGSEGGTGPAAGPGVGATSPGAERVGLVADKNSLVIQWRDVWSRRLRKFQRKEKKGKCSK 629          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: ntn2 (netrin-3 [Source:NCBI gene;Acc:101160359])

HSP 1 Score: 327.405 bits (838), Expect = 9.890e-103
Identity = 197/635 (31.02%), Postives = 310/635 (48.82%), Query Frame = 2
Query:  275 PCYAH-GSAYQCMPPFTNIVENMIPKIETLCKKK--------------------EVCPIKSPR----DNLITDYHLTHNQTCWKSVPLQA--NHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARC-------FPLKLSLTDNEPVVAFNTVLEGAYENVGDSS--LIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKK--------------ILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKY-----IQMESAENKCKACDS------KRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAEL------------LIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            PCY   G+A +C+P F N        + ++C +                     ++C    PR     + +TD +  HN TCW+S  L    ++V +T S  K+FE+ Y+SL  C S  P ++A YKS ++G TW P+ + ++ C  M+N       + Q         EQ A C       +PL   L      +AF+T+         D+S  L DW++ +DIR+    F  P+  +  +     N+  +                ++ D  +GGRCKCNGHA+ C K+    K+ C C+HNTEG +C++CK  + D PW RA      +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD  +P+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K        + S+  +   C+S         +I  +K+C+KD      +   E +GD+ +F V++ +++ S+            +P+           R  N +W+ ++DL C C ++Q+ + +L++  S                       L+    S+++ W   W RRL +F++K++KG+CSK
Sbjct:   36 PCYDETGTARRCIPEFINAAFGKEVMVSSVCGRPPSRSCSVVERGDERPSVRTCQICDAADPRRAHPASYLTDLNSAHNLTCWQSENLNTSPHNVTLTLSLGKKFEITYVSLQFC-SPRPESLAIYKSMDYGKTWMPYQFYSSQCRRMYNKPNKATITKQ--------NEQEALCTDGHTDLYPLSGGL------IAFSTLDGRPSSKDFDNSPVLQDWVTVTDIRVV---FGRPQLSREFVLGAGSNNGGRDDDPVAVTSTLSTYFYAVGDFQVGGRCKCNGHASRCLKDK-EGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANAREANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGRPITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVVNPTAVVSSTEEPADCESYCKPVKGNLKINMKKYCKKDYAVQVNVLDMETVGDWAKFSVSLVSVYKSRG-----------EPL----------KRGDNILWVHMKDLACKCPKIQMSKKFLVMGGSEGGTGPAAGPGVGATSPGAERVGLVADKNSLVIQWRDVWSRRLRKFQRKEKKGKCSK 629          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: ntn2 (netrin-3 [Source:NCBI gene;Acc:101160359])

HSP 1 Score: 327.405 bits (838), Expect = 9.890e-103
Identity = 197/635 (31.02%), Postives = 310/635 (48.82%), Query Frame = 2
Query:  275 PCYAH-GSAYQCMPPFTNIVENMIPKIETLCKKK--------------------EVCPIKSPR----DNLITDYHLTHNQTCWKSVPLQA--NHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARC-------FPLKLSLTDNEPVVAFNTVLEGAYENVGDSS--LIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKK--------------ILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKY-----IQMESAENKCKACDS------KRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAEL------------LIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSK 1960
            PCY   G+A +C+P F N        + ++C +                     ++C    PR     + +TD +  HN TCW+S  L    ++V +T S  K+FE+ Y+SL  C S  P ++A YKS ++G TW P+ + ++ C  M+N       + Q         EQ A C       +PL   L      +AF+T+         D+S  L DW++ +DIR+    F  P+  +  +     N+  +                ++ D  +GGRCKCNGHA+ C K+    K+ C C+HNTEG +C++CK  + D PW RA      +C  C CNLH+  C F+ +LY L  + +GGVC NC+HNTAG  CHYC +G+YRD  +P+ H+  CK C CH +GA     C++ TGQC CK GVTG  CNRCA G++QS S   PC+K        + S+  +   C+S         +I  +K+C+KD      +   E +GD+ +F V++ +++ S+            +P+           R  N +W+ ++DL C C ++Q+ + +L++  S                       L+    S+++ W   W RRL +F++K++KG+CSK
Sbjct:   36 PCYDETGTARRCIPEFINAAFGKEVMVSSVCGRPPSRSCSVVERGDERPSVRTCQICDAADPRRAHPASYLTDLNSAHNLTCWQSENLNTSPHNVTLTLSLGKKFEITYVSLQFC-SPRPESLAIYKSMDYGKTWMPYQFYSSQCRRMYNKPNKATITKQ--------NEQEALCTDGHTDLYPLSGGL------IAFSTLDGRPSSKDFDNSPVLQDWVTVTDIRVV---FGRPQLSREFVLGAGSNNGGRDDDPVAVTSTLSTYFYAVGDFQVGGRCKCNGHASRCLKDK-EGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANAREANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGRPITHRRACKACDCHPVGAAG-KTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVVNPTAVVSSTEEPADCESYCKPVKGNLKINMKKYCKKDYAVQVNVLDMETVGDWAKFSVSLVSVYKSRG-----------EPL----------KRGDNILWVHMKDLACKCPKIQMSKKFLVMGGSEGGTGPAAGPGVGATSPGAERVGLVADKNSLVIQWRDVWSRRLRKFQRKEKKGKCSK 629          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000069610.1 (SMESG000069610.1)

HSP 1 Score: 1222.99 bits (3163), Expect = 0.000e+0
Identity = 587/594 (98.82%), Postives = 589/594 (99.16%), Query Frame = 2
Query:  254 MNNLTPSPCYAHGSAYQCMPPFTNIVENMIPKIETLCKKKEVCPIKSPRDNLITDYHLTHNQTCWKSVPLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKFQNRSPFRKPVNWSTPNYRTDSNNL 2035
            MNNLTPSPCYAHGSAYQCMPPFTNIVENMIPKIETLCKKKEVCPIKSPRDNLITDYHLTHNQTCWKSVPLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACDSKRTRIRF+KFCRKDAVFS TLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIF + IMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYL IIKSTTYHYQNRAELLIKSPRSIIL WNPTWKRRLNRFKQKKEKGECSKFQNRSPFRKPVNWSTPNYRTDSNNL
Sbjct:    1 MNNLTPSPCYAHGSAYQCMPPFTNIVENMIPKIETLCKKKEVCPIKSPRDNLITDYHLTHNQTCWKSVPLQANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACDSKRTRIRFRKFCRKDAVFSVTLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFIESIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLFIIKSTTYHYQNRAELLIKSPRSIILIWNPTWKRRLNRFKQKKEKGECSKFQNRSPFRKPVNWSTPNYRTDSNNL 594          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000006806.1 (SMESG000006806.1)

HSP 1 Score: 448.358 bits (1152), Expect = 5.140e-149
Identity = 253/639 (39.59%), Postives = 361/639 (56.49%), Query Frame = 2
Query:  242 SQLHMNNLTPSPCYAHGSAYQCMPPFTNIVENMIP-KIETLC---KKKEVCP--------IKSPRD-NLITDYHLTHNQTCWKSVPL-QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPL---KLSLTDNEP-VVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFK-------------------------------FDNPKPKKSNIFRFARNSPKKI-----LSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQM------ESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNS-IKDLYPGIFSQPIMRPSSKSRLNNR---PTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKFQ 1966
            +Q  ++  + S CY+ G A++C+PPFTNI+ENMIP +I + C   KK+ +C         +K     N +TD HL +N T W S  +   ++VNITFSF K FE+YYISL       P++I   KS + G +W  WHY + +C   F ++         +       +Q+  C  +   KL    N P V+AF T     + +  D     WMSA++IRITL K                               + +  P    + +  RNSP  +      +++DISIGGRC+C GHA  C KNP+ N   C CQHNT G+DCE C++ ++D  W+ ATVNS A+CK+C CNLHS  C F++ LYI+  + +GGVC  C+HNT G  CH CN GY+RDW+KPL H  VC KC CH IG+ +PD CD+R  QC CK+GV G  CNRC  GF+Q+ S  TPCV  I +      ++ EN+C+ C++KR RIRF+K+CRKDAV   T+QS+E  G+  RF++ V+ ++    S   +++P   +      S    ++N+    T P+W+K  DLKC C  LQLG TYL+I+K     Y  R+ELL+   +S+ L W  TW+RR+ +F  K+ +G C K++
Sbjct:   23 AQHWLHGGSNSLCYSEGKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVDHINCHSCMKDTHSINYLTDQHLNNNITFWASDFVNHGDNVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMDFNHYSDSKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHASDQ-YNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVGCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLA------SMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQ-KSVALPWQKTWERRMKKFSNKEHQGLCEKWK 653          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000050895.1 (SMESG000050895.1)

HSP 1 Score: 446.047 bits (1146), Expect = 6.293e-148
Identity = 238/618 (38.51%), Postives = 346/618 (55.99%), Query Frame = 2
Query:  272 SPCYAHGSAYQCMPPFTNIVENMIPKIETLC------------------KKKEVCPI-----KSPRDNLITDYHLTHNQTCWKSVPLQAN----HVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDN-----EPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFA-------------------RNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENK---CKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKF 1963
            SPCY +G   QC+P FTNI+EN+  +  + C                  + ++ C I     +S   + ITD H+  NQTCW S PLQ N     VNIT S  K FEVYYI+L  C + +P++IA YKS +FG++WKPW + + +C   F M  T   + Q     I        C  LK     N     E V+ F+T+            L++WM+ +D+RI+L +F    P+KS  +R                     +  P     +SD+++GGRCKCNGHAN C  +   ++I+C C HNTEGQ+CE+CK NYLD PW RAT  +   CK C+CNLHS  CYF+  +Y+      GGVC NC+H+T G  C  C +G++R+WTKP +H+  C  C CH IG+   + CDK+TGQC C+ GVTG+ C+RC  G++QSNST  PC+    M    N    CK C+ KR RI F+KFCR+ +VF AT  S+EI G+ IR+++ +D IW    ++ +  P     P M            T   W+   D++CNC +++LGQ+YL++ ++  Y Y    EL I S RS++L W+ +W+RRL +F++++++G+C ++
Sbjct:   28 SPCYLNGRPQQCLPSFTNIIENVKAETTSTCGTNGPEQICRNWYDKTTAEARQYCSICDAKHRSYPPSHITDRHIPKNQTCWFSGPLQENPGQNEVNITVSLKKSFEVYYIALQICGT-LPDSIAIYKSLDFGVSWKPWQFFSQDCYRAFKMPTTNEQNSQITPANIHE----VLCVELKAPERYNDYGQAETVLPFSTIYGRPSGPPWSQDLVEWMTMTDLRISLMRF---TPEKSTPYRLKELYYHTESLPQAPPNLVNHKTEPIVHFGLSDLAVGGRCKCNGHANRCLIDD-NDEIKCDCHHNTEGQECERCKSNYLDRPWQRATRQNANVCKYCDCNLHSYRCYFNSQIYVRNNYTNGGVCINCRHHTTGNNCENCENGFFRNWTKPQEHRAACTSCKCHTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDGYKQSNSTVRPCIPSSGMADMANTSPVCKKCNEKRKRIVFKKFCRRKSVFRATALSKEIHGNMIRYELKIDEIWRVDKNVWEFLPR--ETPAMH-----------TYRAWINSEDVRCNCPKVELGQSYLILTRAKYYLYLRNKELYIDS-RSVMLPWHNSWERRLQKFQKREKRGKCEQY 622          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000076695.1 (SMESG000076695.1)

HSP 1 Score: 429.483 bits (1103), Expect = 1.530e-141
Identity = 241/662 (36.40%), Postives = 360/662 (54.38%), Query Frame = 2
Query:  200 IFTVYFSMFYKFVLSQLHMNNLTPSPCYAHGSAYQCMPPFTNIVENMIPKIETLCKK---KEVCP---------------IKSPRDNLI------TDYHLTHNQTCWKSVPL----QANHVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQ---AARCFPLKLSLTDN-----EPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNP-------------KPKKS----NIFRFARNS---PKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCV------------------KYIQMESAENKCKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKF 1963
            I  + FS ++   +S L+ N  T   C  HG  Y C PPF NI +     + + C +    ++CP                 + R N I      TD     N TCW S P+      NHVNI+ +F K FEV+Y++L  C S +P++I  YKS++ G  W PW Y + NC   FN+  T        +F IQ   +   +  CF L     D      E ++ F++ +        + +LI W++ +D+RITL +FD+              K ++     N+  F+ N     K    +SD+S+GGRC+C GH+N C  N   N I C C+HNTEG DC+KCK+ + DL W RA+  +P  CK+C+CNLHS +C F +++Y+   Q +GGVC  CQHNTAG +CH+C++GYYRDWTKPL H   CKKC CH +G+   + CDK+ GQC CK GV G  C++C  G+ Q+ S   PCV                  KY+ M + E++CK CD KR RIRF+KFCR+D+VF   ++S+E+ G  +RF++ +  +W           G  SQ I   S +     +   P+W+   +++C+C  + LG++YL+++K   YH+++R ELL+ S R+++L W P+W+RRL +F+ K  + +C KF
Sbjct:    9 ILLLGFSFYFSVAISVLYENKQTT--CEFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFC-SELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPT-------QEFPIQEGLEYSLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKM----NDTLIKWITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGN-IVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEKRKRIRFKKFCRRDSVFMGVIESKEVHGKMVRFELQIKEVWR--------VSGKISQFISEISQE-----QYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDS-RTVMLQWRPSWERRLQKFQTKANEEKCEKF 641          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000050895.1 (SMESG000050895.1)

HSP 1 Score: 427.943 bits (1099), Expect = 7.328e-141
Identity = 236/618 (38.19%), Postives = 338/618 (54.69%), Query Frame = 2
Query:  272 SPCYAHGSAYQCMPPFTNIVENMIPKIETLC------------------KKKEVCPI-----KSPRDNLITDYHLTHNQTCWKSVPLQAN----HVNITFSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSMFNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDN-----EPVVAFNTVLEGAYENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFA-------------------RNSPKKILSISDISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLPWARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTAGVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLCKSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENK---CKACDSKRTRIRFQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFSQPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYHYQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKF 1963
            SPCY +G   QC+P FTNI+EN+  +  + C                  + ++ C I     +S   + ITD H+  NQTCW S PLQ N     VNIT S  K FEVYYI+L  C + +P++IA YKS +FG++WKPW + + +C   F M  T   + Q     I        C  LK     N     E V+ F+T+            L++WM+ +D+RI+L +F    P+KS  +R                     +  P     +SD+++GGRCKCNGHAN C  +   ++I+C C HNTEGQ+CE+CK NYLD PW RAT  +   CK C+C  HS  C FS  +Y   +   GGVC  C+HNT G  C  C   +YRD TKP+ H   C  C CH IG+   + CDK+TGQC C+ GVTG+ C+RC  G++QSNST  PC+    M    N    CK C+ KR RI F+KFCR+ +VF AT  S+EI G+ IR+++ +D IW    ++ +  P     P M            T   W+   D++CNC +++LGQ+YL++ ++  Y Y    EL I S RS++L W+ +W+RRL +F++++++G+C ++
Sbjct:   28 SPCYLNGRPQQCLPSFTNIIENVKAETTSTCGTNGPEQICRNWYDKTTAEARQYCSICDAKHRSYPPSHITDRHIPKNQTCWFSGPLQENPGQNEVNITVSLKKSFEVYYIALQICGT-LPDSIAIYKSLDFGVSWKPWQFFSQDCYRAFKMPTTNEQNSQITPANIHE----VLCVELKAPERYNDYGQAETVLPFSTIYGRPSGPPWSQDLVEWMTMTDLRISLMRF---TPEKSTPYRLKELYYHTESLPQAPPNLVNHKTEPIVHFGLSDLAVGGRCKCNGHANRCLIDD-NDEIKCDCHHNTEGQECERCKSNYLDRPWQRATRQNANVCKLCQCYNHSDKCMFSMGMYKQTRGQHGGVCLECKHNTEGHACDECAAFHYRDITKPVTHPQACTSCKCHTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDGYKQSNSTVRPCIPSSGMADMANTSPVCKKCNEKRKRIVFKKFCRRKSVFRATALSKEIHGNMIRYELKIDEIWRVDKNVWEFLPR--ETPAMH-----------TYRAWINSEDVRCNCPKVELGQSYLILTRAKYYLYLRNKELYIDS-RSVMLPWHNSWERRLQKFQKREKRGKCEQY 622          
The following BLAST results are available for this feature:
BLAST of Netrin 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN13.264e-10333.17netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
NTN38.670e-8332.28netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030][more]
NTN52.039e-5729.88netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208][more]
LAMC14.625e-5133.33laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
LAMA57.179e-5032.76laminin subunit alpha 5 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-64.913e-9729.95Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
unc-64.913e-9729.95Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
lam-21.757e-4528.95Laminin-like protein lam-2 [Source:UniProtKB/Swis... [more]
lam-35.068e-4030.56LAMinin related. See also lmb; Laminin alpha chain... [more]
lam-11.510e-3527.88LAMinin related. See also lmb [Source:UniProtKB/T... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NetA4.371e-8627.52gene:FBgn0015773 transcript:FBtr0073942[more]
NetA4.371e-8627.52gene:FBgn0015773 transcript:FBtr0346088[more]
NetA3.258e-8133.61gene:FBgn0015773 transcript:FBtr0308337[more]
NetB2.659e-6332.28gene:FBgn0015774 transcript:FBtr0304875[more]
NetB2.659e-6332.28gene:FBgn0015774 transcript:FBtr0302018[more]
back to top
BLAST of Netrin 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ntn28.436e-10832.45netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2][more]
ntn23.569e-10732.79netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2][more]
ntn1a4.811e-10633.23netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169][more]
ntn1a4.811e-10633.23netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169][more]
ntn1b6.487e-10132.04netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168][more]
back to top
BLAST of Netrin 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps162.651e-10031.17ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-... [more]
ntn15.790e-9835.07netrin 1 [Source:NCBI gene;Acc:779839][more]
rps161.525e-9530.74ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-... [more]
utp45.015e-5233.48UTP4 small subunit processome component [Source:Xe... [more]
utp45.255e-5233.48UTP4 small subunit processome component [Source:Xe... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ntn17.045e-10333.17netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Ntn17.045e-10333.17netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Ntn33.144e-8432.57netrin 3 [Source:MGI Symbol;Acc:MGI:1341188][more]
Ntn51.445e-5930.81netrin 5 [Source:MGI Symbol;Acc:MGI:2685330][more]
Lamc16.087e-5135.81laminin, gamma 1 [Source:MGI Symbol;Acc:MGI:99914][more]
back to top
BLAST of Netrin 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90922|NET1_CHICK2.181e-10333.33Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=... [more]
sp|O95631|NET1_HUMAN1.567e-10233.17Netrin-1 OS=Homo sapiens OX=9606 GN=NTN1 PE=1 SV=2[more]
sp|O09118|NET1_MOUSE4.928e-10233.17Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=... [more]
sp|Q90923|NET3_CHICK3.021e-10032.55Netrin-3 (Fragment) OS=Gallus gallus OX=9031 GN=NT... [more]
sp|Q2HXW4|NET1_PIG1.427e-9932.79Netrin-1 OS=Sus scrofa OX=9823 GN=NTN1 PE=2 SV=1[more]
back to top
BLAST of Netrin 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6FZK50.000e+099.33Netrin-3 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
Q49BF94.467e-14539.59Netrin 1 OS=Schmidtea mediterranea OX=79327 PE=2 S... [more]
A0A3Q0KPX78.103e-13836.26Putative netrin OS=Schistosoma mansoni OX=6183 PE=... [more]
A0A4Z2D9H42.314e-13636.38Netrin-A OS=Schistosoma japonicum OX=6182 GN=EWB00... [more]
G4VPQ42.107e-13138.38Putative netrin OS=Schistosoma mansoni OX=6183 GN=... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN11.295e-10733.39netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
NTN15.416e-10633.39netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
ntn1b1.353e-10232.35netrin-1-like [Source:NCBI gene;Acc:111191060][more]
NTN17.126e-8230.00netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
ntn1b6.988e-7928.98netrin-1-like [Source:NCBI gene;Acc:111191060][more]
back to top
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009682.16.857e-4734.48pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 ge... [more]
ENSPMAT00000008925.11.473e-3528.18pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 ... [more]
ENSPMAT00000004614.14.035e-2430.66pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 g... [more]
ENSPMAT00000004606.17.713e-2429.68pep scaffold:Pmarinus_7.0:GL477874:5526:15188:-1 g... [more]
ENSPMAT00000003212.19.991e-2028.51pep scaffold:Pmarinus_7.0:GL478430:191288:204969:1... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Netrin 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368362.292e-8129.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365235.162e-4532.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365009.897e-4130.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365019.388e-4030.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395026.918e-3324.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN14.394e-10833.44netrin-1 [Source:NCBI gene;Acc:101155405][more]
NTN11.056e-10432.38netrin-1 [Source:NCBI gene;Acc:101155405][more]
ntn29.890e-10331.02netrin-3 [Source:NCBI gene;Acc:101160359][more]
ntn29.890e-10331.02netrin-3 [Source:NCBI gene;Acc:101160359][more]
ntn29.890e-10331.02netrin-3 [Source:NCBI gene;Acc:101160359][more]
back to top
BLAST of Netrin 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069610.10.000e+098.82SMESG000069610.1[more]
SMESG000006806.15.140e-14939.59SMESG000006806.1[more]
SMESG000050895.16.293e-14838.51SMESG000050895.1[more]
SMESG000076695.11.530e-14136.40SMESG000076695.1[more]
SMESG000050895.17.328e-14138.19SMESG000050895.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012792 ID=SMED30012792|Name=Netrin 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2046bp
CATCTGCGTGCGAGATCGAGTGCTGACTGATTTGAAGAATACCATTTTTG
CAATACAAAAAAACACATGAAAATTCTTTCTCCGCCACAATATACAACGG
ACACAAAATAAAGATTCACTTTTTTAATTCATATCAAAAAGAAAAAATCA
ATATCAAAACAAACGAAGTGAAAACCCCACAAGAAAAATGTGCAGATATA
TTTTCACAGTTTATTTTTCAATGTTTTACAAATTTGTGCTATCGCAGTTA
CACATGAATAATTTGACTCCCAGTCCATGCTACGCTCACGGATCCGCATA
TCAGTGCATGCCTCCATTCACAAACATTGTAGAGAATATGATTCCAAAGA
TCGAAACCCTATGTAAAAAGAAGGAAGTCTGTCCTATAAAATCTCCAAGG
GATAATTTAATCACAGATTATCACTTGACTCACAATCAAACATGCTGGAA
GTCAGTTCCGCTACAAGCTAATCATGTAAATATTACGTTTTCATTTGCTA
AGAGATTTGAAGTTTATTACATCTCTTTGACACCATGCGAATCAGGAATT
CCCAACGCCATCGCCTTTTATAAAAGCAACAACTTTGGAATCACTTGGAA
ACCTTGGCATTATCTTGCAACAAACTGTTTATCCATGTTCAATATGAAAG
AAACGACAATTCCCAGTCTACAGTTCAATGATTTTCGAATTCAACGTAGA
GAACAAGCTGCTAGATGTTTTCCATTAAAATTGTCGCTAACCGACAACGA
GCCAGTTGTGGCTTTCAATACAGTTTTAGAAGGCGCCTATGAAAACGTTG
GGGATTCCAGCTTGATTGACTGGATGAGTGCGTCTGATATTCGGATTACA
TTGTTCAAATTTGACAATCCTAAACCGAAAAAGTCGAATATTTTCCGATT
CGCTAGAAATTCTCCGAAGAAAATTTTGTCAATTTCCGACATTTCAATAG
GTGGACGATGCAAATGCAATGGTCATGCAAATGCTTGCAATAAAAATCCT
ATAACGAATAAAATTGAATGCGTTTGTCAGCATAACACTGAAGGACAAGA
TTGCGAAAAATGCAAAAAAAACTATTTGGATCTTCCTTGGGCAAGAGCCA
CAGTAAACTCTCCAGCTCAGTGTAAAAAATGTGAATGCAATTTGCACTCT
TCAAACTGCTATTTCAGTCAAGATCTTTACATTCTTCGAAAGCAAATCAC
TGGAGGCGTATGTACAAACTGTCAACACAATACAGCGGGAGTAAGATGCC
ATTATTGCAATGATGGATACTACAGAGATTGGACAAAGCCATTAGATCAT
AAATTCGTTTGTAAAAAGTGTACTTGCCATATCATTGGGGCTAAATTTCC
GGATAGATGTGATAAAAGAACAGGACAGTGCTTGTGTAAAAGTGGTGTAA
CGGGAGAAATGTGTAATAGATGCGCATCAGGATTTAGACAAAGTAACTCA
ACAGAAACCCCATGCGTAAAATATATTCAAATGGAGTCAGCTGAAAACAA
ATGCAAAGCGTGTGATTCGAAAAGAACTAGAATTAGATTTCAAAAATTCT
GTCGCAAAGACGCAGTGTTTTCTGCGACTTTACAATCTCAAGAAATCATT
GGGGATTTTATTCGGTTTGATGTCACAGTTGATAATATCTGGCATAGTAA
AAATTCAATCAAAGATTTATATCCTGGAATATTTAGCCAGCCCATAATGC
GCCCTTCAAGCAAGTCCAGACTAAATAACAGGCCTACAAATCCGATATGG
CTGAAATTGAGGGACCTGAAATGCAACTGTGTCCAGTTGCAACTGGGGCA
AACCTATTTATTAATTATCAAATCAACGACTTATCACTATCAAAATCGTG
CGGAGCTTCTCATCAAATCTCCTCGAAGCATCATTTTAACATGGAATCCG
ACATGGAAACGACGACTCAATAGATTTAAACAAAAAAAAGAAAAAGGCGA
ATGCTCAAAATTTCAAAATCGTTCTCCGTTTCGAAAACCGGTGAACTGGT
CAACGCCGAATTACAGAACTGACTCAAATAATTTGTAAAGTTTCTC
back to top

protein sequence of SMED30012792-orf-1

>SMED30012792-orf-1 ID=SMED30012792-orf-1|Name=SMED30012792-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=617bp
MCRYIFTVYFSMFYKFVLSQLHMNNLTPSPCYAHGSAYQCMPPFTNIVEN
MIPKIETLCKKKEVCPIKSPRDNLITDYHLTHNQTCWKSVPLQANHVNIT
FSFAKRFEVYYISLTPCESGIPNAIAFYKSNNFGITWKPWHYLATNCLSM
FNMKETTIPSLQFNDFRIQRREQAARCFPLKLSLTDNEPVVAFNTVLEGA
YENVGDSSLIDWMSASDIRITLFKFDNPKPKKSNIFRFARNSPKKILSIS
DISIGGRCKCNGHANACNKNPITNKIECVCQHNTEGQDCEKCKKNYLDLP
WARATVNSPAQCKKCECNLHSSNCYFSQDLYILRKQITGGVCTNCQHNTA
GVRCHYCNDGYYRDWTKPLDHKFVCKKCTCHIIGAKFPDRCDKRTGQCLC
KSGVTGEMCNRCASGFRQSNSTETPCVKYIQMESAENKCKACDSKRTRIR
FQKFCRKDAVFSATLQSQEIIGDFIRFDVTVDNIWHSKNSIKDLYPGIFS
QPIMRPSSKSRLNNRPTNPIWLKLRDLKCNCVQLQLGQTYLLIIKSTTYH
YQNRAELLIKSPRSIILTWNPTWKRRLNRFKQKKEKGECSKFQNRSPFRK
PVNWSTPNYRTDSNNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR038684Laminin_N_sf
IPR018933Netrin_module_non-TIMP
IPR002049Laminin_EGF
IPR008211Laminin_N
IPR001134Netrin_domain
IPR008993TIMP-like_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002049Laminin EGF domainSMARTSM00180lamegf_3coord: 258..312
e-value: 9.8E-7
score: 38.4
coord: 315..375
e-value: 6.6E-7
score: 38.9
coord: 378..426
e-value: 1.7E-11
score: 54.2
IPR002049Laminin EGF domainPFAMPF00053Laminin_EGFcoord: 258..312
e-value: 3.3E-8
score: 33.5
coord: 378..426
e-value: 8.2E-9
score: 35.5
coord: 315..365
e-value: 4.3E-7
score: 30.0
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 398..426
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 315..377
score: 7.932
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 378..428
score: 17.757
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 258..314
score: 12.254
IPR018933Netrin module, non-TIMP typeSMARTSM00643c345ccoord: 451..583
e-value: 0.0079
score: 22.5
IPR018933Netrin module, non-TIMP typePFAMPF01759NTRcoord: 453..582
e-value: 5.0E-9
score: 35.9
IPR008211Laminin, N-terminalSMARTSM00136LamNT_2coord: 34..256
e-value: 8.2E-13
score: 14.3
IPR008211Laminin, N-terminalPFAMPF00055Laminin_Ncoord: 69..256
e-value: 1.0E-25
score: 90.7
IPR008211Laminin, N-terminalPROSITEPS51117LAMININ_NTERcoord: 36..257
score: 22.615
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 282..379
e-value: 1.3E-21
score: 78.3
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 380..427
e-value: 1.5E-8
score: 36.4
NoneNo IPR availablePANTHERPTHR10574:SF292NETRIN-3coord: 24..591
NoneNo IPR availablePANTHERPTHR10574NETRIN/LAMININ-RELATEDcoord: 24..591
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 378..427
e-value: 5.39784E-10
score: 53.127
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 315..372
e-value: 5.99116E-5
score: 38.8746
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 257..303
e-value: 6.71149E-7
score: 44.2674
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.456
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 315..368
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 258..317
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 378..420
IPR038684Laminin, N-terminal domain superfamilyGENE3DG3DSA:2.60.120.1490coord: 25..280
e-value: 1.6E-44
score: 154.3
IPR001134Netrin domainPROSITEPS50189NTRcoord: 439..589
score: 13.007
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldSUPERFAMILYSSF50242TIMP-likecoord: 436..586