MANSC domain-containing protein

Overview
NameMANSC domain-containing protein
Smed IDSMED30012787
Length (bp)1911
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MANSC domain-containing protein (SMED30012787) t-SNE clustered cells

Violin plots show distribution of expression levels for MANSC domain-containing protein (SMED30012787) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MANSC domain-containing protein (SMED30012787) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MANSC domain-containing protein (SMED30012787) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012787

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30012787h1SMcG0000574 Contig48039newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012787h1SMcG0000574 Contig48039uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012787h1SMcG0000574 Contig37341uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012787h1SMcG0000574 Contig37341newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30012787h1SMcG0000574 dd_Smed_v4_5586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012787h1SMcG0000574 dd_Smed_v4_5586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012787h1SMcG0000574 dd_Smed_v4_5586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012787h1SMcG0000574 dd_Smed_v4_5586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012787h1SMcG0000574 dd_Smed_v4_5586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012787h1SMcG0000574 dd_Smed_v4_5586_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30012787h1SMcG0000574 dd_Smed_v6_5586_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012787h1SMcG0000574 dd_Smed_v4_5586_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MANSC domain-containing protein vs. Ensembl Human
Match: KIAA0319L (KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071])

HSP 1 Score: 81.2629 bits (199), Expect = 1.726e-15
Identity = 71/282 (25.18%), Postives = 127/282 (45.04%), Query Frame = 1
Query:  925 NIDVLKSSLLDKPVVVLIQGMATISNRTVSNKL-----------LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDK-QNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAF-TEHNTGFSNCSMHVMIVVAA-----CAMGIF 1716
            +++V+    ++KP +  I G   I+  T + +L           +SY W R   S AAG ++N+S +   L L+NL++G Y F L VT   G++  D   + V    D    NL++I+L INV + +E+ K  F + +  ++         GV    ++  K Q   +  T+++F+ +  N+  ++             + +     F+   +++   ++ C  +C  HG CD  T RC C   W  +    +   G SNC   V+ V+ A      A+GI 
Sbjct:  117 SVNVIVKEEINKPPIAKITGNVVITLPTSTAELDGSKSSDDKGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVK--PDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLL---------GVLDSDIIVQKIQPYTEQSTKMVFFVQ--NEPPHQIFKGHEVAAMLKSELRKQKADFLIFRALE-VNTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQLRDGDSNCEWSVLYVIIATFVIVVALGIL 384          
BLAST of MANSC domain-containing protein vs. Ensembl Human
Match: KIAA0319 (KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580])

HSP 1 Score: 79.7221 bits (195), Expect = 4.552e-15
Identity = 67/248 (27.02%), Postives = 109/248 (43.95%), Query Frame = 1
Query:  964 VVVLIQGMATI--SNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMA---HVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHN-TGFSNCSMHVMIV 1689
            V+VL     T+  S  T   +++SY W R  QS AAG +++ S +   L LTNL++G Y F L VT   G +  D   + V    D     L+++ LQ+ V + +EQ+K+   + +A   +V++         +  HS         D  T I+FY +  ++   +    +      +++       F+  + V    +  C   C GHG CD  T RC CS  W  +    +   G SNC   +  V
Sbjct:  139 VLVLPNNSITLDGSRSTDDQRIVSYLWIRDGQSPAAGDVIDGSDHSVALQLTNLVEGVYTFHLRVTDSQGASDTDTATVEVQ--PDPRKSGLVELTLQVGVGQLTEQRKDTLVRQLAVLLNVLDSDIKVQK--IRAHS---------DLSTVIVFYVQ--SRPPFKVLKAAEVARNLHMRLSKEKADFLL-FKVLRVDTAGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYIWDGESNCEWSIFYV 370          
BLAST of MANSC domain-containing protein vs. Ensembl Human
Match: KIAA0319 (KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580])

HSP 1 Score: 80.1073 bits (196), Expect = 7.911e-15
Identity = 69/262 (26.34%), Postives = 113/262 (43.13%), Query Frame = 1
Query:  964 VVVLIQGMATI--SNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMA---HVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHN-TGFSNCSMHVMIVVAACAMGIFFLVIF 1731
            V+VL     T+  S  T   +++SY W R  QS AAG +++ S +   L LTNL++G Y F L VT   G +  D   + V    D     L+++ LQ+ V + +EQ+K+   + +A   +V++         +  HS         D  T I+FY +  ++   +    +      +++       F+  + V    +  C   C GHG CD  T RC CS  W  +    +   G SNC   +  V        F L++ 
Sbjct:  719 VLVLPNNSITLDGSRSTDDQRIVSYLWIRDGQSPAAGDVIDGSDHSVALQLTNLVEGVYTFHLRVTDSQGASDTDTATVEVQ--PDPRKSGLVELTLQVGVGQLTEQRKDTLVRQLAVLLNVLDSDIKVQK--IRAHS---------DLSTVIVFYVQ--SRPPFKVLKAAEVARNLHMRLSKEKADFLL-FKVLRVDTAGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYIWDGESNCEWSIFYVTVLA----FTLIVL 960          
BLAST of MANSC domain-containing protein vs. Ensembl Human
Match: KIAA0319 (KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580])

HSP 1 Score: 80.1073 bits (196), Expect = 8.218e-15
Identity = 72/264 (27.27%), Postives = 113/264 (42.80%), Query Frame = 1
Query:  964 VVVLIQGMATI--SNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMA---HVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFY--ARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHN-TGFSNCSMHVMIVVAACAMGIFFLVIF 1731
            V+VL     T+  S  T   +++SY W R  QS AAG +++ S +   L LTNL++G Y F L VT   G +  D   + V    D     L+++ LQ+ V + +EQ+K+   + +A   +V++         +  HS         D  T I+FY  +R   K     E   +     +++       F+  + V    +  C   C GHG CD  T RC CS  W  +    +   G SNC   +  V        F L++ 
Sbjct:  728 VLVLPNNSITLDGSRSTDDQRIVSYLWIRDGQSPAAGDVIDGSDHSVALQLTNLVEGVYTFHLRVTDSQGASDTDTATVEVQ--PDPRKSGLVELTLQVGVGQLTEQRKDTLVRQLAVLLNVLDSDIKVQK--IRAHS---------DLSTVIVFYVQSRPPFKVLKAAEVARN----LHMRLSKEKADFLL-FKVLRVDTAGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYIWDGESNCEWSIFYVTVLA----FTLIVL 969          
BLAST of MANSC domain-containing protein vs. Ensembl Human
Match: KIAA0319 (KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580])

HSP 1 Score: 80.1073 bits (196), Expect = 8.218e-15
Identity = 72/264 (27.27%), Postives = 113/264 (42.80%), Query Frame = 1
Query:  964 VVVLIQGMATI--SNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMA---HVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFY--ARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHN-TGFSNCSMHVMIVVAACAMGIFFLVIF 1731
            V+VL     T+  S  T   +++SY W R  QS AAG +++ S +   L LTNL++G Y F L VT   G +  D   + V    D     L+++ LQ+ V + +EQ+K+   + +A   +V++         +  HS         D  T I+FY  +R   K     E   +     +++       F+  + V    +  C   C GHG CD  T RC CS  W  +    +   G SNC   +  V        F L++ 
Sbjct:  728 VLVLPNNSITLDGSRSTDDQRIVSYLWIRDGQSPAAGDVIDGSDHSVALQLTNLVEGVYTFHLRVTDSQGASDTDTATVEVQ--PDPRKSGLVELTLQVGVGQLTEQRKDTLVRQLAVLLNVLDSDIKVQK--IRAHS---------DLSTVIVFYVQSRPPFKVLKAAEVARN----LHMRLSKEKADFLL-FKVLRVDTAGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYIWDGESNCEWSIFYVTVLA----FTLIVL 969          
BLAST of MANSC domain-containing protein vs. Ensembl Fly
Match: CG7565 (gene:FBgn0035833 transcript:FBtr0076738)

HSP 1 Score: 73.9442 bits (180), Expect = 2.530e-13
Identity = 59/240 (24.58%), Postives = 103/240 (42.92%), Query Frame = 1
Query: 1021 LLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVI--EKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNCSMHVMIVVAACAMGIFFLVIFF 1734
            ++ Y W R   S+AAG IV ++  +  ++LTNL+QG+Y F LTV+   G T+ D V +NV    D    NL+++ L + +    + + ++  + +  ++  E          ++H+            T ++FY         + + +    +ER L+ +L     I        ++  C  DC GHG C+  T  C C   W   A    N   +NC   ++ V     +G   L   F
Sbjct:  746 VVKYLWTRDEHSLAAGVIVADTDKEPVMILTNLVQGRYVFTLTVSDDQGLTSSDTVSVNVR--RDPKLLNLVQMTLPMGISVLVQSELDSVVQKLQLLLGDENKIQVRELKYDLHT----------DATVLVFYVND-----GQGKALDGLQVERQLRTQLQKDASILGAFAVDIRTSVCQSDCSGHGSCNPITRACICEAFWMPSAGYFFNNQEANCDWSILYVFVGVIVGCLLLSGVF 968          
BLAST of MANSC domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-193k19.1 (si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503-110])

HSP 1 Score: 86.6557 bits (213), Expect = 4.393e-17
Identity = 72/276 (26.09%), Postives = 126/276 (45.65%), Query Frame = 1
Query:  958 KPVVVLIQGMATISNRTVSNK-LLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFH-----------YSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVM-------IVVAACAMGIFFLV 1725
             P+ + ++      +R+  +K  +SY W R   S AAG ++N+S +++ L L NL++G+Y F LTVT   G T+ D   ++V    D  +R+L++++L++ V + S ++K+ + +               GV +  VL       DS   I   +  FN+ + R  ++ SG   R           + +           +  +   ++ C  +C GHG CD  T RC C L W  + F+ +     SNC   V+       ++V A A  I+ LV
Sbjct:  617 PPITLPVRTAVLDGSRSSDDKGSISYLWTREENSPAAGDVLNHSDHQAVLFLGNLVEGKYSFTLTVTDSKGKTSSDSGVVDVR--PDVYERDLVELILEVAVAQVSRRQKDMYIR-------------QVGV-LLGVL-------DSDITIREIS-AFNEHSTRLVFLVSGGPGRPPLTGHSVAMELRNKFRKQKNEFLIFKARRVDTVICQLNCSGHGECDSFTRRCVCHLFWMENLFSTYFGDAESNCEWSVLYVTIASFMIVVAIATVIWGLV 868          
BLAST of MANSC domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-193k19.1 (si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503-110])

HSP 1 Score: 83.5741 bits (205), Expect = 3.626e-16
Identity = 68/276 (24.64%), Postives = 127/276 (46.01%), Query Frame = 1
Query:  958 KPVVVLIQGMATISNRTVSNK-LLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFH-----------YSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNC--SMHVM----IVVAACAMGIFFLVI 1728
             P+ + ++      +R+  +K  +SY W R   S AAG ++N+S +++ L L NL++G+Y F LTVT   G T+ D   ++V    D  +R+L++++L++ V + S ++K+ + + +  ++         GV             DS   I   +  FN+ + R  ++ SG   R           + +           +  +   ++ C  +C GHG CD  T RC C L W  + F+ +     SNC  S++V+     +V    +  F +V+
Sbjct:  468 PPITLPVRTAVLDGSRSSDDKGSISYLWTREENSPAAGDVLNHSDHQAVLFLGNLVEGKYSFTLTVTDSKGKTSSDSGVVDVR--PDVYERDLVELILEVAVAQVSRRQKDMYIRQVGVLL---------GV------------LDSDITIREIS-AFNEHSTRLVFLVSGGPGRPPLTGHSVAMELRNKFRKQKNEFLIFKARRVDTVICQLNCSGHGECDSFTRRCVCHLFWMENLFSTYFGDAESNCEGSLYVLFDDPFIVLYVTIASFMIVV 719          
BLAST of MANSC domain-containing protein vs. Ensembl Zebrafish
Match: si:ch73-215d9.1 (si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-40])

HSP 1 Score: 70.4774 bits (171), Expect = 4.496e-12
Identity = 62/252 (24.60%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  988 ATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMA---HVIEKHFSYS--HTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVMIVVAACAMGIFFLV 1725
             ++SN   +N  +S+ W R  QS AAG ++  S ++++L L NL++G Y F+L VT   G ++     + V    D  +R  +++ LQ++V + S+Q+++   + +A   HV++   +    H   +I +V        D        AR       R +                   F+  + V    ++ C   C G G CD  T  C C   W  +      + G SNC   V+ V  +C + I F++
Sbjct:  713 GSVSNSGPAN--VSFLWVRDEQSPAAGDVLYGSDHEASLYLANLVEGTYLFQLRVTDVQGRSSTATATVEVR--PDPREREEVELELQVSVAQVSQQQRDTVIRQLAALLHVLDSDIALKALHGQSDISTVFRFSVQGPDGLIPGPKLARLLRNQLLREK-----------------SDFLL-FRVLRVDTVMCLLLCSGRGQCDPITKSCSCDPLWMENPIRLFIDDGESNCDWSVLYVTISCFVTIIFIL 942          
BLAST of MANSC domain-containing protein vs. Ensembl Zebrafish
Match: si:ch73-215d9.1 (si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-40])

HSP 1 Score: 70.0922 bits (170), Expect = 5.281e-12
Identity = 62/252 (24.60%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  988 ATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMA---HVIEKHFSYS--HTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVMIVVAACAMGIFFLV 1725
             ++SN   +N  +S+ W R  QS AAG ++  S ++++L L NL++G Y F+L VT   G ++     + V    D  +R  +++ LQ++V + S+Q+++   + +A   HV++   +    H   +I +V        D        AR       R +                   F+  + V    ++ C   C G G CD  T  C C   W  +      + G SNC   V+ V  +C + I F++
Sbjct:  713 GSVSNSGPAN--VSFLWVRDEQSPAAGDVLYGSDHEASLYLANLVEGTYLFQLRVTDVQGRSSTATATVEVR--PDPREREEVELELQVSVAQVSQQQRDTVIRQLAALLHVLDSDIALKALHGQSDISTVFRFSVQGPDGLIPGPKLARLLRNQLLREK-----------------SDFLL-FRVLRVDTVMCLLLCSGRGQCDPITKSCSCDPLWMENPIRLFIDDGESNCDWSVLYVTISCFVTIIFIL 942          
BLAST of MANSC domain-containing protein vs. Ensembl Zebrafish
Match: si:ch73-215d9.1 (si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-40])

HSP 1 Score: 70.0922 bits (170), Expect = 5.400e-12
Identity = 62/252 (24.60%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  988 ATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMA---HVIEKHFSYS--HTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVMIVVAACAMGIFFLV 1725
             ++SN   +N  +S+ W R  QS AAG ++  S ++++L L NL++G Y F+L VT   G ++     + V    D  +R  +++ LQ++V + S+Q+++   + +A   HV++   +    H   +I +V        D        AR       R +                   F+  + V    ++ C   C G G CD  T  C C   W  +      + G SNC   V+ V  +C + I F++
Sbjct:  680 GSVSNSGPAN--VSFLWVRDEQSPAAGDVLYGSDHEASLYLANLVEGTYLFQLRVTDVQGRSSTATATVEVR--PDPREREEVELELQVSVAQVSQQQRDTVIRQLAALLHVLDSDIALKALHGQSDISTVFRFSVQGPDGLIPGPKLARLLRNQLLREK-----------------SDFLL-FRVLRVDTVMCLLLCSGRGQCDPITKSCSCDPLWMENPIRLFIDDGESNCDWSVLYVTISCFVTIIFIL 909          
BLAST of MANSC domain-containing protein vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 80.8777 bits (198), Expect = 3.773e-15
Identity = 71/284 (25.00%), Postives = 124/284 (43.66%), Query Frame = 1
Query:  928 IDVLKSSLLDKPVVVLIQGMATISNRTVSNKL-----------LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDK-QNKWDSFTQIMFYA--RKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVMIVVAA-----CAMGIFF 1719
            + V+    ++KP V  I G   I+  + + +L           +SY W+R   S AAG ++N S   S L L+NL++G Y F L VT   G+T  D   + V    D +  NL++++L +NV   +E++K  F + +  ++         GV    ++  K Q   +  T+++FY   +  ++T   Y+  S+       +       F+  +      +  C  +C  HG C+  T RC C   W  +        G SNC   V+ V+ +      A+G+  
Sbjct:  575 VSVIVREEINKPPVAKIAGNVVITLPSNTAELDGTKSFDDKGIVSYQWERDEGSPAAGEVLNGSDCHSVLFLSNLVEGIYSFHLKVTDAKGETDSDRATVEVK--PDPMKNNLVEMILDVNVSHLTERQKGMFMRQIGVLL---------GVLDSDIIVQKIQQYTEQSTKVVFYVQNQPPHQTLKGYQVAST----LRNELHKQQSDFLI-FKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFGDGESNCDWSVLYVIISSFVFVVALGLLI 842          
BLAST of MANSC domain-containing protein vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 80.4925 bits (197), Expect = 4.813e-15
Identity = 71/284 (25.00%), Postives = 124/284 (43.66%), Query Frame = 1
Query:  928 IDVLKSSLLDKPVVVLIQGMATISNRTVSNKL-----------LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDK-QNKWDSFTQIMFYA--RKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVMIVVAA-----CAMGIFF 1719
            + V+    ++KP V  I G   I+  + + +L           +SY W+R   S AAG ++N S   S L L+NL++G Y F L VT   G+T  D   + V    D +  NL++++L +NV   +E++K  F + +  ++         GV    ++  K Q   +  T+++FY   +  ++T   Y+  S+       +       F+  +      +  C  +C  HG C+  T RC C   W  +        G SNC   V+ V+ +      A+G+  
Sbjct:  548 VSVIVREEINKPPVAKIAGNVVITLPSNTAELDGTKSFDDKGIVSYQWERDEGSPAAGEVLNGSDCHSVLFLSNLVEGIYSFHLKVTDAKGETDSDRATVEVK--PDPMKNNLVEMILDVNVSHLTERQKGMFMRQIGVLL---------GVLDSDIIVQKIQQYTEQSTKVVFYVQNQPPHQTLKGYQVAST----LRNELHKQQSDFLI-FKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFGDGESNCDWSVLYVIISSFVFVVALGLLI 815          
BLAST of MANSC domain-containing protein vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 80.4925 bits (197), Expect = 5.084e-15
Identity = 71/284 (25.00%), Postives = 124/284 (43.66%), Query Frame = 1
Query:  928 IDVLKSSLLDKPVVVLIQGMATISNRTVSNKL-----------LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDK-QNKWDSFTQIMFYA--RKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVMIVVAA-----CAMGIFF 1719
            + V+    ++KP V  I G   I+  + + +L           +SY W+R   S AAG ++N S   S L L+NL++G Y F L VT   G+T  D   + V    D +  NL++++L +NV   +E++K  F + +  ++         GV    ++  K Q   +  T+++FY   +  ++T   Y+  S+       +       F+  +      +  C  +C  HG C+  T RC C   W  +        G SNC   V+ V+ +      A+G+  
Sbjct:  618 VSVIVREEINKPPVAKIAGNVVITLPSNTAELDGTKSFDDKGIVSYQWERDEGSPAAGEVLNGSDCHSVLFLSNLVEGIYSFHLKVTDAKGETDSDRATVEVK--PDPMKNNLVEMILDVNVSHLTERQKGMFMRQIGVLL---------GVLDSDIIVQKIQQYTEQSTKVVFYVQNQPPHQTLKGYQVAST----LRNELHKQQSDFLI-FKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFGDGESNCDWSVLYVIISSFVFVVALGLLI 885          
BLAST of MANSC domain-containing protein vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 80.4925 bits (197), Expect = 5.191e-15
Identity = 71/284 (25.00%), Postives = 124/284 (43.66%), Query Frame = 1
Query:  928 IDVLKSSLLDKPVVVLIQGMATISNRTVSNKL-----------LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDK-QNKWDSFTQIMFYA--RKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVMIVVAA-----CAMGIFF 1719
            + V+    ++KP V  I G   I+  + + +L           +SY W+R   S AAG ++N S   S L L+NL++G Y F L VT   G+T  D   + V    D +  NL++++L +NV   +E++K  F + +  ++         GV    ++  K Q   +  T+++FY   +  ++T   Y+  S+       +       F+  +      +  C  +C  HG C+  T RC C   W  +        G SNC   V+ V+ +      A+G+  
Sbjct:  586 VSVIVREEINKPPVAKIAGNVVITLPSNTAELDGTKSFDDKGIVSYQWERDEGSPAAGEVLNGSDCHSVLFLSNLVEGIYSFHLKVTDAKGETDSDRATVEVK--PDPMKNNLVEMILDVNVSHLTERQKGMFMRQIGVLL---------GVLDSDIIVQKIQQYTEQSTKVVFYVQNQPPHQTLKGYQVAST----LRNELHKQQSDFLI-FKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFGDGESNCDWSVLYVIISSFVFVVALGLLI 853          
BLAST of MANSC domain-containing protein vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 80.4925 bits (197), Expect = 5.257e-15
Identity = 71/284 (25.00%), Postives = 124/284 (43.66%), Query Frame = 1
Query:  928 IDVLKSSLLDKPVVVLIQGMATISNRTVSNKL-----------LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDK-QNKWDSFTQIMFYA--RKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVMIVVAA-----CAMGIFF 1719
            + V+    ++KP V  I G   I+  + + +L           +SY W+R   S AAG ++N S   S L L+NL++G Y F L VT   G+T  D   + V    D +  NL++++L +NV   +E++K  F + +  ++         GV    ++  K Q   +  T+++FY   +  ++T   Y+  S+       +       F+  +      +  C  +C  HG C+  T RC C   W  +        G SNC   V+ V+ +      A+G+  
Sbjct:  582 VSVIVREEINKPPVAKIAGNVVITLPSNTAELDGTKSFDDKGIVSYQWERDEGSPAAGEVLNGSDCHSVLFLSNLVEGIYSFHLKVTDAKGETDSDRATVEVK--PDPMKNNLVEMILDVNVSHLTERQKGMFMRQIGVLL---------GVLDSDIIVQKIQQYTEQSTKVVFYVQNQPPHQTLKGYQVAST----LRNELHKQQSDFLI-FKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFGDGESNCDWSVLYVIISSFVFVVALGLLI 849          
BLAST of MANSC domain-containing protein vs. Ensembl Mouse
Match: D130043K22Rik (RIKEN cDNA D130043K22 gene [Source:MGI Symbol;Acc:MGI:3036268])

HSP 1 Score: 85.1149 bits (209), Expect = 1.569e-16
Identity = 70/233 (30.04%), Postives = 113/233 (48.50%), Query Frame = 1
Query:  997 SNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFH-YSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHN-TGFSNCSMHVMIV 1689
            S  T    ++SY W R  QS AAG ++  S +++ L LTNL++G Y F L VT   G +  D   + V  + D     L++++LQ+ V + +EQ+KE   + +A ++    +   + V++  +    Q   D  T I+FY     ++ + ++ + +  + RNL K+L   K  F  + V    +  C   C GHG CD  T RC CS  W  +    +   G SNC   V  V
Sbjct:  750 SRSTDDRGIVSYLWIRDGQSPAAGDVIGGSDHRAALQLTNLVEGVYTFHLLVTDSQGASDSDAATVEV--LPDPKKDGLVELILQVGVEQLTEQQKETLVRQLAVLL----NVLDSDVKVLKI----QAHTDVSTVIVFYV----QSGSPFKVLRAAAVARNLHKRLSKEKEAFLLFKVLRVDTAGCLLKCSGHGHCDPITKRCICSQLWMENLIQRYMWDGESNCEWSVFYV 968          
BLAST of MANSC domain-containing protein vs. Ensembl Mouse
Match: AU040320 (expressed sequence AU040320 [Source:MGI Symbol;Acc:MGI:2140475])

HSP 1 Score: 78.5666 bits (192), Expect = 1.345e-14
Identity = 75/315 (23.81%), Postives = 140/315 (44.44%), Query Frame = 1
Query:  925 NIDVLKSSLLDKPVVVLIQGMATISNRTVSNKL-----------LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDK-QNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAF-TEHNTGFSNCSMHVMIVVAACAMGIFFLVIFFIXXXXXXXXXXXXSKYG--KKILQYRLLDDTD 1824
            +++V+    ++KP V  I G   ++  T + +L           +SY W R   S AAG ++N+S +   L L+NL++G Y F L VT   G++  D   + V    D    NL++I+L +NV + +E+ K    + +  ++         GV    ++  K Q   +  T+++F+ +  N   ++             + +     F+   +++   ++ C  +C  HG CD  T RC C   W  +    +   G SNC   V+ V+ A      F+++  +        C  + + G  K+  +Y++LD TD
Sbjct:  679 SVNVIVKEEINKPPVAKIAGNVVVTLPTSTAELDGSRSSDDKGIVSYLWTRDETSPAAGEVLNHSDHHPVLFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVK--PDPRKSNLVEIILDVNVSQLTERLKGMLIRQIGVLL---------GVLDSDIIVQKIQPYTEQSTKMLFFVQ--NDPPHQLFKGHEVAAMLKSELQKQKADFLIFRALE-ISTVTCQLNCSDHGHCDSFTKRCVCDPFWMENFIKVQLRDGDSNCEWSVLYVIIAS-----FVIVVALGILSWTTICCCKRQKGKPKRKSRYKILDATD 974          
BLAST of MANSC domain-containing protein vs. Ensembl Mouse
Match: AU040320 (expressed sequence AU040320 [Source:MGI Symbol;Acc:MGI:2140475])

HSP 1 Score: 78.5666 bits (192), Expect = 1.437e-14
Identity = 76/313 (24.28%), Postives = 139/313 (44.41%), Query Frame = 1
Query:  925 NIDVLKSSLLDKPVVVLIQGMATISNRTVSNKL-----------LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDK-QNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAF-TEHNTGFSNCSMHVMIVVAACAMGIFFLVIFFIXXXXXXXXXXXXSKYGKKILQYRLLDDTD 1824
            +++V+    ++KP V  I G   ++  T + +L           +SY W R   S AAG ++N+S +   L L+NL++G Y F L VT   G++  D   + V    D    NL++I+L +NV + +E+ K    + +  ++         GV    ++  K Q   +  T+++F+ +  N   ++             + +     F+   +++   ++ C  +C  HG CD  T RC C   W  +    +   G SNC   V+ V+ A       +V   IL    +  C+ +    K+  +Y++LD TD
Sbjct:  679 SVNVIVKEEINKPPVAKIAGNVVVTLPTSTAELDGSRSSDDKGIVSYLWTRDETSPAAGEVLNHSDHHPVLFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVK--PDPRKSNLVEIILDVNVSQLTERLKGMLIRQIGVLL---------GVLDSDIIVQKIQPYTEQSTKMLFFVQ--NDPPHQLFKGHEVAAMLKSELQKQKADFLIFRALE-ISTVTCQLNCSDHGHCDSFTKRCVCDPFWMENFIKVQLRDGDSNCEWSVLYVIIA---SFVIVVALGILSWTTICCCKRQKGKPKRKSRYKILDATD 974          
BLAST of MANSC domain-containing protein vs. Ensembl Mouse
Match: AU040320 (expressed sequence AU040320 [Source:MGI Symbol;Acc:MGI:2140475])

HSP 1 Score: 78.5666 bits (192), Expect = 1.437e-14
Identity = 76/313 (24.28%), Postives = 139/313 (44.41%), Query Frame = 1
Query:  925 NIDVLKSSLLDKPVVVLIQGMATISNRTVSNKL-----------LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDK-QNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAF-TEHNTGFSNCSMHVMIVVAACAMGIFFLVIFFIXXXXXXXXXXXXSKYGKKILQYRLLDDTD 1824
            +++V+    ++KP V  I G   ++  T + +L           +SY W R   S AAG ++N+S +   L L+NL++G Y F L VT   G++  D   + V    D    NL++I+L +NV + +E+ K    + +  ++         GV    ++  K Q   +  T+++F+ +  N   ++             + +     F+   +++   ++ C  +C  HG CD  T RC C   W  +    +   G SNC   V+ V+ A       +V   IL    +  C+ +    K+  +Y++LD TD
Sbjct:  679 SVNVIVKEEINKPPVAKIAGNVVVTLPTSTAELDGSRSSDDKGIVSYLWTRDETSPAAGEVLNHSDHHPVLFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVK--PDPRKSNLVEIILDVNVSQLTERLKGMLIRQIGVLL---------GVLDSDIIVQKIQPYTEQSTKMLFFVQ--NDPPHQLFKGHEVAAMLKSELQKQKADFLIFRALE-ISTVTCQLNCSDHGHCDSFTKRCVCDPFWMENFIKVQLRDGDSNCEWSVLYVIIA---SFVIVVALGILSWTTICCCKRQKGKPKRKSRYKILDATD 974          
BLAST of MANSC domain-containing protein vs. UniProt/SwissProt
Match: sp|P0CI71|K0319_RAT (Dyslexia-associated protein KIAA0319 homolog OS=Rattus norvegicus OX=10116 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.663e-16
Identity = 72/252 (28.57%), Postives = 112/252 (44.44%), Query Frame = 1
Query:  997 SNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYA---------RKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHN-TGFSNCSMHVMIVVAACAMGIFFL 1722
            S  T    ++SY W R  QS AAG I+ +S N + L LTNL++G Y F L VT   G +  D   + V  + D     +++++LQ+ V + +EQ+KE   + +A ++    +   + V++  +    Q   D  T I+FY          R  +   N ++ +S                F+  + V    +  C   C GHG CD  T RC CS  W  +    +   G SNC   V   VAA A+ +  L
Sbjct:  750 SRSTDDRGIVSYLWIRDGQSPAAGDIIGSSDNGAALQLTNLVEGVYTFHLLVTDSQGASDSDTAIVEV--LPDPKKDGMVELILQVGVEQLTEQQKETLVRQLAVLL----NVLDSDVKVLKI----QAHTDVSTVIVFYVQSGSPFKVLRAADVARNLHKRLS-----------KEKGAFLL-FKVLRIDTAGCLLKCSGHGHCDPITKRCICSQLWMENLLQRYMWDGESNCEWSV-FYVAALALTLTVL 978          
BLAST of MANSC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5SZV5|K0319_MOUSE (Dyslexia-associated protein KIAA0319 homolog OS=Mus musculus OX=10090 GN=Kiaa0319 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.097e-15
Identity = 70/233 (30.04%), Postives = 113/233 (48.50%), Query Frame = 1
Query:  997 SNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFH-YSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHN-TGFSNCSMHVMIV 1689
            S  T    ++SY W R  QS AAG ++  S +++ L LTNL++G Y F L VT   G +  D   + V  + D     L++++LQ+ V + +EQ+KE   + +A ++    +   + V++  +    Q   D  T I+FY     ++ + ++ + +  + RNL K+L   K  F  + V    +  C   C GHG CD  T RC CS  W  +    +   G SNC   V  V
Sbjct:  750 SRSTDDRGIVSYLWIRDGQSPAAGDVIGGSDHRAALQLTNLVEGVYTFHLLVTDSQGASDSDAATVEV--LPDPKKDGLVELILQVGVEQLTEQQKETLVRQLAVLL----NVLDSDVKVLKI----QAHTDVSTVIVFYV----QSGSPFKVLRAAAVARNLHKRLSKEKEAFLLFKVLRVDTAGCLLKCSGHGHCDPITKRCICSQLWMENLIQRYMWDGESNCEWSVFYV 968          
BLAST of MANSC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5RFR6|K319L_PONAB (Dyslexia-associated protein KIAA0319-like protein OS=Pongo abelii OX=9601 GN=Kiaa0319l PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.876e-14
Identity = 71/287 (24.74%), Postives = 128/287 (44.60%), Query Frame = 1
Query:  925 NIDVLKSSLLDKPVVVLIQGMATISNRTVSNKL-----------LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDK-QNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAF-TEHNTGFSNCSMHVMIVVAA-----CAMGIFFLVIF 1731
            +++V+    ++KP +  I G   I+  T + +L           +SY W R   S AAG ++N+S +   L L+NL++G Y F L VT   G++  D   + V    D    NL++I+L INV + +E+ K  F + +  ++         GV    ++  K Q   +  T+++F+ +  N+  ++             + +     F+   +++   ++ C  +C  HG CD  T RC C   W  +    +   G SNC   V+ V+ A      A+GI    + 
Sbjct:  680 SVNVIVKEEINKPPIAKITGNVVITLPTSTAELDGSKSSDDKGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVK--PDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLL---------GVLDSDIIVQKIQPYTEQSTKMVFFVQ--NEPPHQIFKGHEVAAMLKSELRKQKADFLIFRALE-INTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQLRDGESNCEWSVLYVIIATFVIVVALGILSWTVI 952          
BLAST of MANSC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5VV43|K0319_HUMAN (Dyslexia-associated protein KIAA0319 OS=Homo sapiens OX=9606 GN=KIAA0319 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.947e-14
Identity = 72/264 (27.27%), Postives = 113/264 (42.80%), Query Frame = 1
Query:  964 VVVLIQGMATI--SNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMA---HVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFY--ARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHN-TGFSNCSMHVMIVVAACAMGIFFLVIF 1731
            V+VL     T+  S  T   +++SY W R  QS AAG +++ S +   L LTNL++G Y F L VT   G +  D   + V    D     L+++ LQ+ V + +EQ+K+   + +A   +V++         +  HS         D  T I+FY  +R   K     E   +     +++       F+  + V    +  C   C GHG CD  T RC CS  W  +    +   G SNC   +  V        F L++ 
Sbjct:  728 VLVLPNNSITLDGSRSTDDQRIVSYLWIRDGQSPAAGDVIDGSDHSVALQLTNLVEGVYTFHLRVTDSQGASDTDTATVEVQ--PDPRKSGLVELTLQVGVGQLTEQRKDTLVRQLAVLLNVLDSDIKVQK--IRAHS---------DLSTVIVFYVQSRPPFKVLKAAEVARN----LHMRLSKEKADFLL-FKVLRVDTAGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYIWDGESNCEWSIFYVTVLA----FTLIVL 969          
BLAST of MANSC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IZA0|K319L_HUMAN (Dyslexia-associated protein KIAA0319-like protein OS=Homo sapiens OX=9606 GN=KIAA0319L PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 5.518e-14
Identity = 71/287 (24.74%), Postives = 128/287 (44.60%), Query Frame = 1
Query:  925 NIDVLKSSLLDKPVVVLIQGMATISNRTVSNKL-----------LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDK-QNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAF-TEHNTGFSNCSMHVMIVVAA-----CAMGIFFLVIF 1731
            +++V+    ++KP +  I G   I+  T + +L           +SY W R   S AAG ++N+S +   L L+NL++G Y F L VT   G++  D   + V    D    NL++I+L INV + +E+ K  F + +  ++         GV    ++  K Q   +  T+++F+ +  N+  ++             + +     F+   +++   ++ C  +C  HG CD  T RC C   W  +    +   G SNC   V+ V+ A      A+GI    + 
Sbjct:  680 SVNVIVKEEINKPPIAKITGNVVITLPTSTAELDGSKSSDDKGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVK--PDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLL---------GVLDSDIIVQKIQPYTEQSTKMVFFVQ--NEPPHQIFKGHEVAAMLKSELRKQKADFLIFRALE-VNTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQLRDGDSNCEWSVLYVIIATFVIVVALGILSWTVI 952          
BLAST of MANSC domain-containing protein vs. TrEMBL
Match: A0A0P5VSC9 (Dyslexia-associated protein OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 8.916e-18
Identity = 67/233 (28.76%), Postives = 118/233 (50.64%), Query Frame = 1
Query:  970 VLIQGMATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNC 1668
            +++ G A+  +  +     S+ W R P+S+AAG I+ NS   ++LMLTNL+ G+Y F LTVT   G +  D+  L +     E+D  ++ I L+ +   F++ +     + +A ++ +  S  +  + I  V+ + ++ + + T + F+     K+ + +  +    +   LKKKL N   +  Y V    +  C ++C GHGVCDQ T RC C   W  + F+  N    NC
Sbjct:  617 IILNGSASTDDLGIQ----SWLWTREPESLAAGAIIANSDRTNSLMLTNLVPGKYVFRLTVTDAQGLSDHDIATLIIHSNPRELD--VVTITLKSDPRSFTDSELSTIREQIALLLHQQGSI-NININIDDVMVEPKSGY-TRTVLQFFTTV--KSESGWRTLPGTEVAALLKKKLRNDINLLAYPVLEVDTFICQNNCSGHGVCDQVTRRCNCQTFWMENPFSVSNGADYNC 839          
BLAST of MANSC domain-containing protein vs. TrEMBL
Match: A0A1L8FSG5 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18033512mg PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 9.790e-18
Identity = 72/242 (29.75%), Postives = 116/242 (47.93%), Query Frame = 1
Query: 1018 KLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVM-IVVAACAMGIFFLVIFFI 1737
            +++SY WKR  QS AAG I+++S ++S L LTNL+ G Y F LTVT   G+T  D   + V    D   +NL++++LQ+ V K +EQ+K+   + +A ++    +   T +++  +        D  T I+FY +  N    R +  +        +       F F Y V    +  C   C GHG CD  T  C C   W  +    + + G SNC   V+ I +   A+  F + I ++
Sbjct:  726 EIISYLWKRDGQSPAAGDIMHSSDHESVLQLTNLVDGIYIFHLTVTDAKGETDVDTATVEVR--PDPRKQNLVELILQVGVGKLTEQQKDTLVRQLALLL----NVLDTDIKVQKIAAHS----DLSTVILFYVQ--NGHPLRVQKAAEVAQTLQDQLLKEKADF-FPYKVLRVDTAACLLKCSGHGHCDPITKSCLCYAFWMENLIQRYISEGESNCDWSVLYIAILTFAVVAFIMAIVWL 954          
BLAST of MANSC domain-containing protein vs. TrEMBL
Match: A0A0P4ZUD5 (Dyslexia-associated protein OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 9.813e-18
Identity = 65/214 (30.37%), Postives = 110/214 (51.40%), Query Frame = 1
Query: 1027 SYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNC 1668
            S+ W R P+S+AAG I+ NS   ++LMLTNL+ G+Y F LTVT   G +  D+  L +     E+D  ++ I L+ +   F++ +     + +A ++ +  S  +  + I  V+ + ++ + + T + F+     K+ + +  +    +   LKKKL N   +  Y V    +  C ++C GHGVCDQ T RC C   W  + F+  N    NC
Sbjct:  632 SWLWTREPESLAAGAIIANSDRTNSLMLTNLVPGKYVFRLTVTDAQGLSDHDIATLIIHSNPRELD--VVTITLKSDPRSFTDSELSTIREQIALLLHQQGSI-NININIDDVMVEPKSGY-TRTVLQFFTTV--KSESGWRTLPGTEVAALLKKKLRNDINLLAYPVLEVDTFICQNNCSGHGVCDQVTRRCNCQTFWMENPFSVSNGADYNC 839          
BLAST of MANSC domain-containing protein vs. TrEMBL
Match: A0A0P5SKK3 (Dyslexia-associated protein OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 9.898e-18
Identity = 65/214 (30.37%), Postives = 110/214 (51.40%), Query Frame = 1
Query: 1027 SYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNC 1668
            S+ W R P+S+AAG I+ NS   ++LMLTNL+ G+Y F LTVT   G +  D+  L +     E+D  ++ I L+ +   F++ +     + +A ++ +  S  +  + I  V+ + ++ + + T + F+     K+ + +  +    +   LKKKL N   +  Y V    +  C ++C GHGVCDQ T RC C   W  + F+  N    NC
Sbjct:  632 SWLWTREPESLAAGAIIANSDRTNSLMLTNLVPGKYVFRLTVTDAQGLSDHDIATLIIHSNPRELD--VVTITLKSDPRSFTDSELSTIREQIALLLHQQGSI-NININIDDVMVEPKSGY-TRTVLQFFTTV--KSESGWRTLPGTEVAALLKKKLRNDINLLAYPVLEVDTFICQNNCSGHGVCDQVTRRCNCQTFWMENPFSVSNGADYNC 839          
BLAST of MANSC domain-containing protein vs. TrEMBL
Match: A0A0P5BGQ9 (Dyslexia-associated protein OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 9.985e-18
Identity = 65/214 (30.37%), Postives = 110/214 (51.40%), Query Frame = 1
Query: 1027 SYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNC 1668
            S+ W R P+S+AAG I+ NS   ++LMLTNL+ G+Y F LTVT   G +  D+  L +     E+D  ++ I L+ +   F++ +     + +A ++ +  S  +  + I  V+ + ++ + + T + F+     K+ + +  +    +   LKKKL N   +  Y V    +  C ++C GHGVCDQ T RC C   W  + F+  N    NC
Sbjct:  632 SWLWTREPESLAAGAIIANSDRTNSLMLTNLVPGKYVFRLTVTDAQGLSDHDIATLIIHSNPRELD--VVTITLKSDPRSFTDSELSTIREQIALLLHQQGSI-NININIDDVMVEPKSGY-TRTVLQFFTTV--KSESGWRTLPGTEVAALLKKKLRNDINLLAYPVLEVDTFICQNNCSGHGVCDQVTRRCNCQTFWMENPFSVSNGADYNC 839          
BLAST of MANSC domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-193k19.1 (KIAA0319 like [Source:NCBI gene;Acc:103041131])

HSP 1 Score: 86.2705 bits (212), Expect = 5.126e-17
Identity = 75/307 (24.43%), Postives = 138/307 (44.95%), Query Frame = 1
Query:  952 LDKPVVVLIQGMATIS----------NRTVSNK-LLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEI-DRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSF-TQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAF-TEHNTGFSNCSMHVMIVVAACAMGIFFLVIFFIXXXXXXXXXXXXSKYGK--KILQYRLLDDTD 1824
            +D+P V  +Q   +I+          +R+  +K  +SY W R   S AAG ++NNS +++ L L NL++G+Y F LTVT   G +  D       E+  +I +R+L+++VL++ V + S ++++   + +  ++         GV    ++  +   ++   T+++F     +    R      G+      K   +    F +  +   ++ C  +C GHG CD  T RC C   W  +   T+     SNC   V+ V  A      F+++  I        C    + GK  +  +Y++LD  D
Sbjct:  618 VDQPPVARVQSSPSITLPVRTAVLDGSRSSDDKGSISYVWTRDGSSPAAGDVLNNSDHQAVLFLGNLVEGKYTFTLTVTDSKGQSHAD---TGTVEVRPDIWERDLVELVLEVTVSQVSHRQRDMLLRQVGVLL---------GVLDSDIIVREIGAFNEHSTRLVFL---VSGGPGRPPLSGHGVATSLRNKLHKSKNEFFIFKAQRVDTVICQLNCSGHGECDSFTRRCVCHPFWMENFIRTQLQDAESNCEWSVLYVTIAS-----FMIVVAIAAVIWGMVCCCNRRKGKVRRKSRYKMLDGDD 904          
BLAST of MANSC domain-containing protein vs. Ensembl Cavefish
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 [Source:NCBI gene;Acc:103036464])

HSP 1 Score: 66.6254 bits (161), Expect = 6.540e-11
Identity = 70/279 (25.09%), Postives = 114/279 (40.86%), Query Frame = 1
Query: 1024 LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMA---HVIEKHFSYS--HTGVEIHSVL------PDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVMIVVAACAMGIFFLVIFFIXXXXXXXXXXXXSKYGKKILQYRLLDDTD 1824
            +SY W R  QS AAG ++  S +++ L L NL++G Y F L V    G ++     + V    D  +R  +++ LQ+ V + S+Q+K+   + +A   HV++   +    H   +I +V       PD         +I+ +     KT                        F+  + V    ++ C   C G G CD  +  C C   W  + F    +   SNC   V+ V   C      +VIF +       K   R+K  KK  +Y +LD+ D
Sbjct:  735 VSYLWVRDEQSPAAGDVLYGSDHEAFLYLANLVEGTYLFRLRVADSQGRSSSATATVEVR--PDLREREEVELELQVAVAQVSQQQKDTVVRQLAALLHVMDTDIALKGLHGQSDISTVFRFSVQGPDGTIPGPKLARILRFQLLKEKT-----------------------DFLL-FKVLRVDTVMCLLLCSGRGQCDPVSRSCSCDPLWMENPFRRFLDDNESNCDWSVLYVTICC----LVVVIFLVSTSWAWCKRGRRTKVRKKT-KYTILDNMD 982          
BLAST of MANSC domain-containing protein vs. Ensembl Cavefish
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 [Source:NCBI gene;Acc:103036464])

HSP 1 Score: 66.6254 bits (161), Expect = 6.540e-11
Identity = 70/279 (25.09%), Postives = 114/279 (40.86%), Query Frame = 1
Query: 1024 LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMA---HVIEKHFSYS--HTGVEIHSVL------PDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEH-NTGFSNCSMHVMIVVAACAMGIFFLVIFFIXXXXXXXXXXXXSKYGKKILQYRLLDDTD 1824
            +SY W R  QS AAG ++  S +++ L L NL++G Y F L V    G ++     + V    D  +R  +++ LQ+ V + S+Q+K+   + +A   HV++   +    H   +I +V       PD         +I+ +     KT                        F+  + V    ++ C   C G G CD  +  C C   W  + F    +   SNC   V+ V   C      +VIF +       K   R+K  KK  +Y +LD+ D
Sbjct:  735 VSYLWVRDEQSPAAGDVLYGSDHEAFLYLANLVEGTYLFRLRVADSQGRSSSATATVEVR--PDLREREEVELELQVAVAQVSQQQKDTVVRQLAALLHVMDTDIALKGLHGQSDISTVFRFSVQGPDGTIPGPKLARILRFQLLKEKT-----------------------DFLL-FKVLRVDTVMCLLLCSGRGQCDPVSRSCSCDPLWMENPFRRFLDDNESNCDWSVLYVTICC----LVVVIFLVSTSWAWCKRGRRTKVRKKT-KYTILDNMD 982          
BLAST of MANSC domain-containing protein vs. Ensembl Sea Lamprey
Match: si:ch211-193k19.1 (si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503-110])

HSP 1 Score: 75.0998 bits (183), Expect = 2.139e-14
Identity = 65/242 (26.86%), Postives = 107/242 (44.21%), Query Frame = 1
Query: 1024 LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAF-TEHNTGFSNCS---MHVMIVVAACAMGIFFLVIFFI 1737
            LSY W R   S AAG ++N S++   L LTNL++G Y F L VT   G++++D+  + V    D     L+++VL + V +  +Q+KE   + ++ ++    S      +IH  +   Q    S TQ++FY     +  N   Y    +     +        +  +      +  C   C GHG CD  T RC C   W  +   T+   G SNC    ++V +   A A+ +  L    +
Sbjct:  421 LSYEWTRDGSSPAAGVVLNGSEHHPVLWLTNLVEGTYVFRLRVTDNKGESSQDMATVEVK--PDPKSSQLVELVLDVPVSQLQQQQKELLIRQLSVLLSVQDS------DIH--VQRLQAYTQSSTQLVFYV--LTEQPNMI-YKGVDVARMLRRLLQREKTNLLAFRTLRVDTFVCQLACSGHGRCDSFTKRCTCFPFWMENVIRTQLGDGESNCDWSVLYVTLTTFAVAVTVGLLAWLTV 649          
BLAST of MANSC domain-containing protein vs. Ensembl Nematostella
Match: EDO42871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0H0])

HSP 1 Score: 89.3521 bits (220), Expect = 1.191e-18
Identity = 73/291 (25.09%), Postives = 135/291 (46.39%), Query Frame = 1
Query:  892 QQLIASAGPDLNIDVL-KSSLLDKPVVVLIQGMATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIE--------KHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAF-TEHNTGFSNCS---MHVMIVVAACAMGIFFLV 1725
            Q  +A AGPD+ + +  +++ LD             S  +  + +  Y W R  +S AAG ++N+S +++ L L+NL++G Y F+LTV    G  + D   L V E  DE   +L+++ L +++ KF+E+ K    + +A +++        +H   + TG   HS++            +MFY +      +      +      LK+K+ N +  F + +   +   C ++C  HG CD++T  C C   W  D F +      SNC    ++V +++    M I  ++
Sbjct:  388 QAPVARAGPDVVVHLPNRAAELDG------------SKSSDDHGIAQYLWTRDAKSPAAGDVINSSNHQAILRLSNLVEGMYKFKLTVLDAKGLKSSDEALLTVKE--DEHSAHLVELFLDVDITKFTEENKGQLIRKLAVILDVQDEEIVVEHLKEAGTG---HSMM------------VMFYVKAVGGAKDGQAVAET------LKEKIENEEGFFEFRMLKVEPYICRNNCSFHGYCDRSTKLCVCESFWMQDIFKSSFGAKESNCDWSILYVTVIIFGIVMAIGGII 643          
BLAST of MANSC domain-containing protein vs. Ensembl Medaka
Match: si:ch211-193k19.1 (KIAA0319 like [Source:NCBI gene;Acc:101168634])

HSP 1 Score: 76.2554 bits (186), Expect = 5.338e-14
Identity = 58/240 (24.17%), Postives = 105/240 (43.75%), Query Frame = 1
Query: 1024 LSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFH-----------YSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAF-TEHNTGFSNCSMHVMIVVAACAM 1707
            LSY W R   S AAG ++NNS +++ L L NL++G+Y F+LTVT   G ++ D   + V    D  +++L+++VL++ V +  +++++   + +  ++         GV    +             I+     FN+ + R  ++ S    R           + +           +  +   ++ C  +C GHG CD  + RC C   W  + F  +     SNC   V+ V  A  M
Sbjct:  634 LSYLWTRDDSSPAAGEVLNNSDHQAVLFLGNLVEGKYRFKLTVTDSKGQSSSDSGTVEVK--ADPWEKDLVELVLEVPVSQVFQRQRDLLLRQVEVLL---------GVLDGDI-------------IVREITAFNEHSTRLVFLVSAGPGRPPLSGRSVALGLRNKLRKQKNDFLIFKARRVDTIVCQLNCSGHGECDPFSRRCVCHPFWMENFFRVQLEDAESNCEWSVLYVTIASFM 849          
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Match: SMESG000015184.1 (SMESG000015184.1)

HSP 1 Score: 1003.05 bits (2592), Expect = 0.000e+0
Identity = 538/564 (95.39%), Postives = 547/564 (96.99%), Query Frame = 1
Query:  136 SNKKEICNDINSSDDVYSQIVLLNHLPFGFVNKTNIIHKIVKLDEWDECIKYCCDYKQCDAVLFNTTHCKIIHCKNPSLCQPVKEKTEELFSLFLNISVNSGKHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKFKSSLKYKIEIDEGISSCELGIASSCKENQICQQIQEDRRSGVCLCDAGYIRNGDDCVYGEHKKRFNQTKMKTTKIVPIKTSRASTTNISRTFSSTIKMITTEFKRAKETNTESQQLIASAGPDLNIDVLKSSLLDKPVVVLIQGMATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNCSMHVMIVVAACAMGIFFLVIFFIXXXXXXXXXXXXSKYGKKILQYRLLDDTDS 1827
            SNKKEICNDINSSDDVYSQIVLLNHLPFGFVNKTNIIHKIVKLDEWDECIKYCCDYKQCDAVLFNTTHCKIIHCKNPSLCQPVKEKTEELFSLFLNISVNSGKHERKEEEE+ + +D+   EE++  E+D   +  GKFKSSLKYKIEIDEGISSCELGIASSCKENQICQQIQEDRRSGVCLCDAGYIRNGDDCVYGEHKKRFNQTKMKTTKIVPIKTSRASTTNISRTFSSTIKMITTEFKRAKETNTESQQLIA+AGPDLNIDVLKSSLLDKPVVVLIQGMATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQN     TQIMFYARKFNKTTNRYEYISSGLLERNLKKKLLNHKFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNCSMHVMIVVAACAMGIFFLVIFFILCKKLLRKCRLRSKYGKKILQYRLLDDTDS
Sbjct:   17 SNKKEICNDINSSDDVYSQIVLLNHLPFGFVNKTNIIHKIVKLDEWDECIKYCCDYKQCDAVLFNTTHCKIIHCKNPSLCQPVKEKTEELFSLFLNISVNSGKHERKEEEEKDENDDNENEEEKEMEEDDENRKN-GKFKSSLKYKIEIDEGISSCELGIASSCKENQICQQIQEDRRSGVCLCDAGYIRNGDDCVYGEHKKRFNQTKMKTTKIVPIKTSRASTTNISRTFSSTIKMITTEFKRAKETNTESQQLIANAGPDLNIDVLKSSLLDKPVVVLIQGMATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNN----TQIMFYARKFNKTTNRYEYISSGLLERNLKKKLLNHKFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNCSMHVMIVVAACAMGIFFLVIFFILCKKLLRKCRLRSKYGKKILQYRLLDDTDS 575          
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Match: SMESG000015184.1 (SMESG000015184.1)

HSP 1 Score: 980.319 bits (2533), Expect = 0.000e+0
Identity = 516/564 (91.49%), Postives = 518/564 (91.84%), Query Frame = 1
Query:  136 SNKKEICNDINSSDDVYSQIVLLNHLPFGFVNKTNIIHKIVKLDEWDECIKYCCDYKQCDAVLFNTTHCKIIHCKNPSLCQPVKEKTEELFSLFLNISVNSGKHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKFKSSLKYKIEIDEGISSCELGIASSCKENQICQQIQEDRRSGVCLCDAGYIRNGDDCVYGEHKKRFNQTKMKTTKIVPIKTSRASTTNISRTFSSTIKMITTEFKRAKETNTESQQLIASAGPDLNIDVLKSSLLDKPVVVLIQGMATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNCSMHVMIVVAACAMGIFFLVIFFIXXXXXXXXXXXXSKYGKKILQYRLLDDTDS 1827
            SNKKEICNDINSSDDVYSQIVLLNHLPFGFVNKTNIIHKIVKLDEWDECIKYCCDYKQCDAVLFNTTHCKIIHCKNPSLCQPVKEKTEELFSLFLNISVNSGKHE                                        + EIDEGISSCELGIASSCKENQICQQIQEDRRSGVCLCDAGYIRNGDDCVYGEHKKRFNQTKMKTTKIVPIKTSRASTTNISRTFSSTIKMITTEFKRAKETNTESQQLIA+AGPDLNIDVLKSSLLDKPVVVLIQGMATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQN     TQIMFYARKFNKTTNRYEYISSGLLERNLKKKLLNHKFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNCSMHVMIVVAACAMGIFFLVIFFILCKKLLRKCRLRSKYGKKILQYRLLDDTDS
Sbjct:   17 SNKKEICNDINSSDDVYSQIVLLNHLPFGFVNKTNIIHKIVKLDEWDECIKYCCDYKQCDAVLFNTTHCKIIHCKNPSLCQPVKEKTEELFSLFLNISVNSGKHE----------------------------------------RKEIDEGISSCELGIASSCKENQICQQIQEDRRSGVCLCDAGYIRNGDDCVYGEHKKRFNQTKMKTTKIVPIKTSRASTTNISRTFSSTIKMITTEFKRAKETNTESQQLIANAGPDLNIDVLKSSLLDKPVVVLIQGMATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNN----TQIMFYARKFNKTTNRYEYISSGLLERNLKKKLLNHKFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNCSMHVMIVVAACAMGIFFLVIFFILCKKLLRKCRLRSKYGKKILQYRLLDDTDS 536          
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Match: SMESG000063418.1 (SMESG000063418.1)

HSP 1 Score: 80.1073 bits (196), Expect = 8.435e-16
Identity = 68/251 (27.09%), Postives = 113/251 (45.02%), Query Frame = 1
Query:  970 VLIQGMATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXF-IFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNCSMHVMIVVAACAMGIFF 1719
            V + G+ +  +R    K+L Y W     + A   I+ NS N+  L+L NL  G Y F+L V    G   +D  K+ +T  ED   +N+I+++L  N+  FS +  +NF   +  ++ K     +  ++I  +   K++       I+FY    ++T  R + I S      L + ++     IF + V    S+ C   C  HG CD +T +C C   W N+ +   N      SM      A+C   IF+
Sbjct:  131 VQLSGVNSFDDR----KVLRYQWIADVHNPAGLEILGNSVNEPNLILCNLSPGIYKFKLLVEDLEGLQDED--KMTLTVKEDRNAKNMIEMLLSTNLQNFSHKSLKNFQSQVYLIVSKSIPNINLQIKIVRL---KRDPLTGLALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLW---NILLDKDSM------ASCDCNIFY 363          
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Match: SMESG000063418.1 (SMESG000063418.1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.996e-13
Identity = 68/251 (27.09%), Postives = 108/251 (43.03%), Query Frame = 1
Query:  970 VLIQGMATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXF-IFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNCSMHVMIVVAACAMGIFF 1719
            V + G+ +  +R    K+L Y W     + A   I+ NS N+  L+L NL  G Y F+L V    G   +D  K+ +T  ED   +N+I+++L  N+  FS +  +NF                     +   P ++  +DS   I+FY    ++T  R + I S      L + ++     IF + V    S+ C   C  HG CD +T +C C   W N+ +   N      SM      A+C   IF+
Sbjct:  131 VQLSGVNSFDDR----KVLRYQWIADVHNPAGLEILGNSVNEPNLILCNLSPGIYKFKLLVEDLEGLQDED--KMTLTVKEDRNAKNMIEMLLSTNLQNFSHKSLKNFQ--------------------NQNCPIEKGSFDS-ALIVFYGIHHDRTQTRRKLIFSASSLIKLLRPVILDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLW---NILLDKDSM------ASCDCNIFY 345          
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Match: SMESG000063418.1 (SMESG000063418.1)

HSP 1 Score: 64.3142 bits (155), Expect = 9.763e-11
Identity = 63/250 (25.20%), Postives = 102/250 (40.80%), Query Frame = 1
Query:  970 VLIQGMATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYWFELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKENFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKTTNRYEYISSGXXXXXXXXXXXXXXFIFHYSVKSFQSLFCHDDCGGHGVCDQNTHRCKCSLPWFNDAFTEHNTGFSNCSMHVMIVVAACAMGIFF 1719
            V + G+ +  +R    K+L Y W     + A   I+ NS N+  L+L NL  G Y F+L V    G   +D  K+ +T  ED   +N+I+++L  N+  FS +  +NF   +  ++ K     +  ++I  +      K D  T  +  +                          L+   IF + V    S+ C   C  HG CD +T +C C   W N+ +   N      SM      A+C   IF+
Sbjct:  131 VQLSGVNSFDDR----KVLRYQWIADVHNPAGLEILGNSVNEPNLILCNLSPGIYKFKLLVEDLEGLQDED--KMTLTVKEDRNAKNMIEMLLSTNLQNFSHKSLKNFQSQVYLIVSKSIPNINLQIKIVRL------KRDPLTVPLLCSMLLRPVI-------------------LDDINIFMFPVVQINSINCSRSCFEHGYCDFDTRKCICDPFWMNNLW---NILLDKDSM------ASCDCNIFY 340          
The following BLAST results are available for this feature:
BLAST of MANSC domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIAA0319L1.726e-1525.18KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071][more]
KIAA03194.552e-1527.02KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580][more]
KIAA03197.911e-1526.34KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580][more]
KIAA03198.218e-1527.27KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580][more]
KIAA03198.218e-1527.27KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580][more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG75652.530e-1324.58gene:FBgn0035833 transcript:FBtr0076738[more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-193k19.14.393e-1726.09si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
si:ch211-193k19.13.626e-1624.64si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
si:ch73-215d9.14.496e-1224.60si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-4... [more]
si:ch73-215d9.15.281e-1224.60si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-4... [more]
si:ch73-215d9.15.400e-1224.60si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-4... [more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIAA0319L3.773e-1525.00kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L4.813e-1525.00kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L5.084e-1525.00kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L5.191e-1525.00kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L5.257e-1525.00kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
D130043K22Rik1.569e-1630.04RIKEN cDNA D130043K22 gene [Source:MGI Symbol;Acc:... [more]
AU0403201.345e-1423.81expressed sequence AU040320 [Source:MGI Symbol;Acc... [more]
AU0403201.437e-1424.28expressed sequence AU040320 [Source:MGI Symbol;Acc... [more]
AU0403201.437e-1424.28expressed sequence AU040320 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of MANSC domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0CI71|K0319_RAT2.663e-1628.57Dyslexia-associated protein KIAA0319 homolog OS=Ra... [more]
sp|Q5SZV5|K0319_MOUSE1.097e-1530.04Dyslexia-associated protein KIAA0319 homolog OS=Mu... [more]
sp|Q5RFR6|K319L_PONAB3.876e-1424.74Dyslexia-associated protein KIAA0319-like protein ... [more]
sp|Q5VV43|K0319_HUMAN3.947e-1427.27Dyslexia-associated protein KIAA0319 OS=Homo sapie... [more]
sp|Q8IZA0|K319L_HUMAN5.518e-1424.74Dyslexia-associated protein KIAA0319-like protein ... [more]
back to top
BLAST of MANSC domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0P5VSC98.916e-1828.76Dyslexia-associated protein OS=Daphnia magna OX=35... [more]
A0A1L8FSG59.790e-1829.75Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A0P4ZUD59.813e-1830.37Dyslexia-associated protein OS=Daphnia magna OX=35... [more]
A0A0P5SKK39.898e-1830.37Dyslexia-associated protein OS=Daphnia magna OX=35... [more]
A0A0P5BGQ99.985e-1830.37Dyslexia-associated protein OS=Daphnia magna OX=35... [more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-193k19.15.126e-1724.43KIAA0319 like [Source:NCBI gene;Acc:103041131][more]
si:ch73-215d9.16.540e-1125.09dyslexia-associated protein KIAA0319 [Source:NCBI ... [more]
si:ch73-215d9.16.540e-1125.09dyslexia-associated protein KIAA0319 [Source:NCBI ... [more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-193k19.12.139e-1426.86si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO428711.191e-1825.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MANSC domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-193k19.15.338e-1424.17KIAA0319 like [Source:NCBI gene;Acc:101168634][more]
back to top
BLAST of MANSC domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015184.10.000e+095.39SMESG000015184.1[more]
SMESG000015184.10.000e+091.49SMESG000015184.1[more]
SMESG000063418.18.435e-1627.09SMESG000063418.1[more]
SMESG000063418.17.996e-1327.09SMESG000063418.1[more]
SMESG000063418.19.763e-1125.20SMESG000063418.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012787 ID=SMED30012787|Name=MANSC domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1911bp
GAATTTTTAACCTTATAATTAAAGTATAAAAATTGAATTTGTAAAGTAAT
TCGTCTGGCTTATATTGAACTTCATTTTTTTTCTCAAATGATTTTAAAAT
TATATACATTATTGATATTGCTAAAATTCATAACCTCGAACAAAAAGGAA
ATATGTAATGATATTAATTCATCTGATGATGTCTATTCACAAATCGTGTT
ATTGAACCATCTTCCATTTGGCTTTGTTAATAAAACTAATATCATACATA
AGATAGTCAAGCTGGACGAATGGGACGAATGCATTAAATATTGCTGTGAC
TATAAACAATGTGACGCTGTATTGTTCAATACTACCCATTGCAAAATAAT
TCACTGCAAAAACCCATCATTATGCCAGCCAGTCAAAGAAAAAACTGAGG
AATTATTTAGCCTTTTCTTGAATATTAGTGTAAATTCTGGTAAACATGAA
AGAAAAGAAGAAGAAGAAGAAAAAGACGAGAATGATGATAATGAAAATGA
GGAGGAAAAAGAAATGGAAGAGGATAATGAAAATAGGAAAAATGGAAAAT
TCAAAAGTTCTTTAAAGTATAAAATAGAAATTGATGAAGGAATTTCCAGT
TGTGAACTTGGTATTGCAAGTAGTTGTAAGGAAAATCAAATTTGTCAGCA
AATCCAAGAAGACCGTCGAAGTGGAGTGTGCTTATGTGACGCCGGATATA
TTCGAAACGGAGATGATTGTGTTTATGGAGAACATAAAAAACGATTTAAT
CAAACAAAGATGAAAACCACAAAAATAGTTCCAATAAAAACCAGTAGAGC
ATCAACAACAAATATTAGTCGTACTTTTTCATCAACTATAAAAATGATAA
CAACAGAATTTAAAAGGGCAAAAGAAACAAATACAGAATCTCAACAATTG
ATTGCAAGTGCTGGACCTGACTTGAATATTGATGTACTGAAATCATCACT
ACTCGACAAGCCGGTAGTCGTTCTTATTCAAGGAATGGCAACTATTAGTA
ACCGAACGGTTTCTAATAAATTATTATCCTATTATTGGAAGCGACTTCCT
CAAAGCATCGCCGCCGGAACCATCGTTAACAATTCTCAAAACAAGTCAAC
TCTAATGTTGACTAATCTCATTCAAGGTCAATATTGGTTTGAATTAACAG
TAACATATTACAATGGAGATACCGCCAAAGATCTGGTAAAACTAAATGTG
ACTGAGATCGAAGACGAAATTGATAGGAATTTGATCAAAATAGTATTGCA
AATTAATGTTTATAAATTTTCTGAGCAAAAAAAGGAAAACTTCTCGAAAT
GGATGGCTCATGTAATTGAAAAACATTTCTCATACTCCCATACTGGTGTT
GAAATTCACTCAGTTTTACCAGACAAACAAAACAAGTGGGACTCTTTCAC
TCAAATCATGTTTTATGCTAGAAAATTTAATAAAACTACGAATAGATATG
AATATATATCTTCTGGTTTACTAGAAAGAAATTTAAAGAAAAAATTATTG
AATCATAAATTTATATTTCATTATTCGGTAAAAAGTTTTCAAAGTCTCTT
CTGTCACGATGATTGTGGTGGTCACGGTGTTTGTGATCAGAATACTCATC
GGTGCAAATGCTCTTTGCCATGGTTCAATGACGCTTTTACGGAGCACAAT
ACCGGATTCTCTAATTGCAGTATGCACGTCATGATTGTGGTGGCAGCATG
TGCTATGGGAATATTTTTTCTGGTGATATTCTTCATTTTATGCAAGAAAT
TATTAAGAAAATGTAGACTGCGAAGCAAATACGGAAAAAAGATTTTGCAA
TATAGACTTTTAGACGACACAGATTCATAATATTGGGATGACAGAATATT
CATGTTTATAGTTTTGTATTTCATTTTACCACATTTGATAAATTTTTTCG
TTTATAATTCA
back to top

protein sequence of SMED30012787-orf-1

>SMED30012787-orf-1 ID=SMED30012787-orf-1|Name=SMED30012787-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=581bp
MILKLYTLLILLKFITSNKKEICNDINSSDDVYSQIVLLNHLPFGFVNKT
NIIHKIVKLDEWDECIKYCCDYKQCDAVLFNTTHCKIIHCKNPSLCQPVK
EKTEELFSLFLNISVNSGKHERKEEEEEKDENDDNENEEEKEMEEDNENR
KNGKFKSSLKYKIEIDEGISSCELGIASSCKENQICQQIQEDRRSGVCLC
DAGYIRNGDDCVYGEHKKRFNQTKMKTTKIVPIKTSRASTTNISRTFSST
IKMITTEFKRAKETNTESQQLIASAGPDLNIDVLKSSLLDKPVVVLIQGM
ATISNRTVSNKLLSYYWKRLPQSIAAGTIVNNSQNKSTLMLTNLIQGQYW
FELTVTYYNGDTAKDLVKLNVTEIEDEIDRNLIKIVLQINVYKFSEQKKE
NFSKWMAHVIEKHFSYSHTGVEIHSVLPDKQNKWDSFTQIMFYARKFNKT
TNRYEYISSGLLERNLKKKLLNHKFIFHYSVKSFQSLFCHDDCGGHGVCD
QNTHRCKCSLPWFNDAFTEHNTGFSNCSMHVMIVVAACAMGIFFLVIFFI
LCKKLLRKCRLRSKYGKKILQYRLLDDTDS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR013032EGF-like_CS
IPR003114Phox_assoc
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane