SMED30012786

Overview
NameSMED30012786
Smed IDSMED30012786
Length (bp)1246
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30012786 (SMED30012786) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30012786 (SMED30012786) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30012786 (SMED30012786) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30012786 (SMED30012786) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012786

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30012786SMESG000030941.1 SMESG000030931.1 dd_Smed_v4_3765_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012786SMESG000030941.1 SMESG000030931.1 dd_Smed_v4_3765_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30012786SMESG000030941.1 SMESG000030931.1 dd_Smed_v4_3765_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012786 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005921:7664..8916 +6033
v31.024176:1582..2826 +4879
v31.002738:75638..76679 +4789
Homology
BLAST of SMED30012786 vs. UniProt/SwissProt
Match: sp|P33300|SUR1_YEAST (Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 3.293e-9
Identity = 49/154 (31.82%), Postives = 71/154 (46.10%), Query Frame = 1
Query:  337 IPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPL-RKFMIQSMVLYVFGGVSLSLDTVCQKPIH--LAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKN 789
            IPKI+H     EDIP+ + E  + C  L+ D   ILWTD   Y+ F+ E   + +D     F N  +P+ R   I+  +L  +GGV + LD  C++ +   LAF   L   KT    VSN                 V+G    HPF+   +K+
Sbjct:   55 IPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYE-FIKEEYPWFLD----TFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFL--RKTSPLGVSN----------------DVMGSVPRHPFFLKALKS 185          
BLAST of SMED30012786 vs. UniProt/SwissProt
Match: sp|Q10323|IMT3_SCHPO (Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.712e-8
Identity = 42/177 (23.73%), Postives = 77/177 (43.50%), Query Frame = 1
Query:  280 VMSIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASF-------YKVFVTEFDQYIIDKWKRVFSNLDHPLRKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKN 789
            ++ ++ + N    +  S  IPKI+H      +IP+ +    K+C  L+ D   +LWTD S        Y  F+T++D Y          N++   R  +++  +LY +GG+ L LD  C + +           +T  + +SN                +V+G +  HPF   +++N
Sbjct:   38 LLKVDDVYNHEIYSNQSAAIPKIIHQTWKTNEIPEKWVGAQKSCIDLHPDYEYVLWTDESMREFIATDYPWFLTQYDSYPY--------NIE---RADVVRYFILYKYGGIYLDLDVGCNRTLDPLLHYPAWVRRTSPSGISN----------------NVMGFAKGHPFLLQVVRN 187          
BLAST of SMED30012786 vs. UniProt/SwissProt
Match: sp|Q9UT67|IMT2_SCHPO (Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 2.715e-7
Identity = 65/253 (25.69%), Postives = 101/253 (39.92%), Query Frame = 1
Query:  121 VIFAAVVFIVM----LIWNKNFKFLGDSVQVDKEILVKIKRTKESIYIPTIYRGD--CRVMSIETLKNFSSSNRFSNG--IPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTD-------ASFYKVFVTEFDQYIIDKWKRVFSNLDHPLRKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKNTMTTKLSNLYFTEYL 834
             +FAAV F +M    L +N  F    D    D      I  ++E  Y+  +       +   + TLK   S N  S    IPKI+H      ++P+ +    ++C  L+ D   ILWTD       A  Y  F+  FD Y  +             R  +I+  VLY +GG  + LD  C++ +       +   +T    VSN                 V+G    HP++E++I+N    K +  Y+  YL
Sbjct:    9 AVFAAVNFFLMSSIVLYFNNEFLMFADRCTKD------IIPSEELRYLRQVLNDSIPSKDEPLPTLK-LDSLNDISGEPVIPKIIHQTWKTTEVPEGWKGAQQSCIDLHPDYEYILWTDEMSRNFIADNYPWFLPYFDAYPFNV-----------QRADVIRYFVLYHYGGNYIDLDDGCRQRLDSLLYYPVWVRRTDPVGVSN----------------DVMGSVPHHPYFELIIQN--LEKNAKSYWLPYL 225          
BLAST of SMED30012786 vs. UniProt/SwissProt
Match: sp|O14084|IMT1_SCHPO (Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 3.562e-7
Identity = 44/188 (23.40%), Postives = 81/188 (43.09%), Query Frame = 1
Query:  280 VMSIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKD---MMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPLRKF-MIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKNTMTTKLSNLYFTEY 831
             +S+  + + +S+      IP+++H +  +E+IP+ ++    +C + + D      ILWTD          +  ++      VF +  + ++KF   +  +LY +GGV + LD  C+KP+       LSK      S            +   Y       +  HPF    I N   +K ++ YFT+Y
Sbjct:   45 TLSLSDVSDDTSAPGEMEKIPRVIHQLWKDENIPERWSNTVNSCRRQHPDENGWQFILWTDEKIMSFMNENYSWFM-----PVFHSYPYNIQKFDAARYFILYHYGGVYMDLDIGCKKPM----DPLLSKATFILPST-----------EPIGYSNDWFAATPKHPFLYQAIHN--LSKFNHRYFTKY 210          
BLAST of SMED30012786 vs. UniProt/SwissProt
Match: sp|P38287|CSH1_YEAST (Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 5.441e-7
Identity = 41/152 (26.97%), Postives = 68/152 (44.74%), Query Frame = 1
Query:  337 IPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPL-RKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKN 789
            IPKI+H      DIP+ + +  + C  L+ D   ILWTD      F+ +   + +D     F + ++P+ R   I+  +L  +GG+ + LD  C++ +     D L K        S T  +N            V+G    HPF+  +IK+
Sbjct:   62 IPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTD-EMSDTFIKQEYPWFLD----TFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRL-----DPLLKVPAFLRKTSPTGVSN-----------DVMGSVPRHPFFLKVIKS 192          
BLAST of SMED30012786 vs. TrEMBL
Match: A0A1I8GZ28 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033812g2 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 5.561e-13
Identity = 63/263 (23.95%), Postives = 110/263 (41.83%), Query Frame = 1
Query:  322 RFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPL-RKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGE--SVLGCSAMHPFYEMLIKNTMTTKLSNLYFTEYLEFYHNFNDKFPVNFLDVAIAEQMFPKVEMEKICKKNSTGTKRN---LACKLMNKTKIPGTSKAMLVHLPSY--GVSNVQIVANDICSAG 1086
            R   G+PKI+H+V  + ++   Y E  +TC   N D  ++LWTD +        F  ++     +VF +  H + R   I+ ++LY +GG+ + LD  C  P+  +         +CF  + +  R   +    +QY    S +GC+  HPF+  +I+       +   F             FPV+       E +  + ++ K    N T    N    + K+  ++ I G  K+M   L  +  G+S  Q V   +   G
Sbjct:   79 RTPAGVPKIIHFVYRDANVLAPYREALQTCVTKNPDWQVVLWTDQAIKAFMQKHFSSHM-----KVFESFPHKIQRSDAIRYLILYKYGGLYMDLDMTCHAPLLPSLA-----PHSCF--LDSERRHQTQFLHGRQYSAMNSAMGCTPGHPFFRQVIRFVFRPSTAKRNFL------------FPVSIFSTTGPEMLTKQFDLWKRDAANPTVVMLNETYFSPKINPRSGIYGRCKSMAPRLQRHSGGLSPSQRVCLQLQQMG 317          
BLAST of SMED30012786 vs. TrEMBL
Match: A0A267GVK0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033812g1 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 6.158e-13
Identity = 63/263 (23.95%), Postives = 110/263 (41.83%), Query Frame = 1
Query:  322 RFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPL-RKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGE--SVLGCSAMHPFYEMLIKNTMTTKLSNLYFTEYLEFYHNFNDKFPVNFLDVAIAEQMFPKVEMEKICKKNSTGTKRN---LACKLMNKTKIPGTSKAMLVHLPSY--GVSNVQIVANDICSAG 1086
            R   G+PKI+H+V  + ++   Y E  +TC   N D  ++LWTD +        F  ++     +VF +  H + R   I+ ++LY +GG+ + LD  C  P+  +         +CF  + +  R   +    +QY    S +GC+  HPF+  +I+       +   F             FPV+       E +  + ++ K    N T    N    + K+  ++ I G  K+M   L  +  G+S  Q V   +   G
Sbjct:   79 RTPAGVPKIIHFVYRDANVLAPYREALQTCVTKNPDWQVVLWTDQAIKAFMQKHFSSHM-----KVFESFPHKIQRSDAIRYLILYKYGGLYMDLDMTCHAPLLPSLA-----PHSCF--LDSERRHQTQFLHGRQYSAMNSAMGCTPGHPFFRQVIRFVFRPSTAKRNFL------------FPVSIFSTTGPEMLTKQFDLWKRDAANPTVVMLNETYFSPKINPRSGIYGRCKSMAPRLQRHSGGLSPSQRVCLQLQQMG 317          
BLAST of SMED30012786 vs. TrEMBL
Match: A0A267F0E4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012259g1 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 6.510e-13
Identity = 63/263 (23.95%), Postives = 110/263 (41.83%), Query Frame = 1
Query:  322 RFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPL-RKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGE--SVLGCSAMHPFYEMLIKNTMTTKLSNLYFTEYLEFYHNFNDKFPVNFLDVAIAEQMFPKVEMEKICKKNSTGTKRN---LACKLMNKTKIPGTSKAMLVHLPSY--GVSNVQIVANDICSAG 1086
            R   G+PKI+H+V  + ++   Y E  +TC   N D  ++LWTD +        F  ++     +VF +  H + R   I+ ++LY +GG+ + LD  C  P+  +         +CF  + +  R   +    +QY    S +GC+  HPF+  +I+       +   F             FPV+       E +  + ++ K    N T    N    + K+  ++ I G  K+M   L  +  G+S  Q V   +   G
Sbjct:   79 RTPAGVPKIIHFVYRDANVLAPYREALQTCVTKNPDWQVVLWTDQAIKAFMQKHFSSHM-----KVFESFPHKIQRSDAIRYLILYKYGGLYMDLDMTCHAPLLPSLAS-----HSCF--LDSERRHQTQFLHGRQYSAMNSAMGCTPEHPFFRQVIQFVFRPSTAKRNFL------------FPVSIFSTTGPEMLTKQFDLWKRDAANPTVVMLNETYFSPKINPRSGIYGRCKSMAPRLQRHSGGLSPSQRVCLQLQQMG 317          
BLAST of SMED30012786 vs. TrEMBL
Match: A0A1I8IW34 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.471e-12
Identity = 52/192 (27.08%), Postives = 86/192 (44.79%), Query Frame = 1
Query:  298 LKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPL-RKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKNTMTTK--------LSNLYFTEYLEFYH 846
            ++N S S    N IP +LH + + + +P  Y      C +LN     +LWTD    +   T + Q+I      +F++   PL R   ++  +L+ FGGV L +D  C +P+     D+L  ++TCF       ++ I    D     S +GC   HPF E +++N    +           LY T  L+ + 
Sbjct:  214 IRNLSRSG-CGNRIPPLLHQIYSSDKLPVDYRASISACLRLNPQFSYMLWTDEDAKQFMRTHYAQFI-----GLFNSYKQPLQRSDALRYFILHQFGGVYLDMDVHCLRPM-----DSLVSKETCFFDQERPEQSRILHGVDFAVMNSAIGCVRRHPFLEQVLRNLQAARHNADIIRTTGPLYLTSQLKLFQ 394          
BLAST of SMED30012786 vs. TrEMBL
Match: A0A267G0Y6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012114g1 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.872e-11
Identity = 48/163 (29.45%), Postives = 81/163 (49.69%), Query Frame = 1
Query:  331 NGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPLRKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQ------YG------ESVLGCSAMHPFYEMLI 783
            +GIPKILHYV   E +   Y    K+C   N D  ++ W+D+   K+    + ++ I K++     L+   +   ++ M+L+ FGGV L +D  C+KP    FT    +E+  FA  S T   +  L ++++      YG       S++G    HPF+++ I
Sbjct:   76 SGIPKILHYVFKSEQVFDSYKPFIKSCLDQNPDWQVLFWSDSHSEKLIADHYARF-IHKYRSYRDRLE---KSDSVRYMILHKFGGVYLDMDVECRKPFSRLFTQPPVQER--FAVASATAAPSAFLGEERREQTRILYGYSYCAMNSMMGSRPGHPFFQLAI 232          
BLAST of SMED30012786 vs. Ensembl Yeast
Match: SUR1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Csh1p; SUR1 has a paralog, CSH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005978])

HSP 1 Score: 62.003 bits (149), Expect = 4.743e-11
Identity = 49/154 (31.82%), Postives = 71/154 (46.10%), Query Frame = 1
Query:  337 IPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPL-RKFMIQSMVLYVFGGVSLSLDTVCQKPIH--LAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKN 789
            IPKI+H     EDIP+ + E  + C  L+ D   ILWTD   Y+ F+ E   + +D     F N  +P+ R   I+  +L  +GGV + LD  C++ +   LAF   L   KT    VSN                 V+G    HPF+   +K+
Sbjct:   55 IPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYE-FIKEEYPWFLD----TFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFL--RKTSPLGVSN----------------DVMGSVPRHPFFLKALKS 185          
BLAST of SMED30012786 vs. Ensembl Yeast
Match: CSH1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Sur1p; CSH1 has a paralog, SUR1, that arose from the whole genome duplication [Source:SGD;Acc:S000000365])

HSP 1 Score: 55.0694 bits (131), Expect = 7.836e-9
Identity = 41/152 (26.97%), Postives = 68/152 (44.74%), Query Frame = 1
Query:  337 IPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPL-RKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKN 789
            IPKI+H      DIP+ + +  + C  L+ D   ILWTD      F+ +   + +D     F + ++P+ R   I+  +L  +GG+ + LD  C++ +     D L K        S T  +N            V+G    HPF+  +IK+
Sbjct:   62 IPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTD-EMSDTFIKQEYPWFLD----TFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRL-----DPLLKVPAFLRKTSPTGVSN-----------DVMGSVPRHPFFLKVIKS 192          
BLAST of SMED30012786 vs. Planmine SMEST
Match: SMESG000030941.1 (SMESG000030941.1)

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 312/320 (97.50%), Postives = 315/320 (98.44%), Query Frame = 1
Query:  151 MLIWNKNFKFLGDSVQVDKEILVKIKRTKESIYIPTIYRGDCRVMSIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPLRKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKNTMTTKLSNLYFTEYLEFYHNFNDKFPVNFLDVAIAEQMFPKVEMEKICKKNSTGTKRNLACKLMNKTKIPGTSKAMLVHLPSYGVSNVQIVANDICSAGIPVYIVII 1110
            M IWNKNFKFL DSVQVDKEILVK++RTKESIYIPTIYRGDCRVMSIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWK VFSNLDHPLR FMIQSMVLYVFGGVSLSLDTVCQKPIHLAFT+TLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKN MTTKLSNLYFTEYLEFYHNFNDKFPVNFLDVAIAEQMFPKVEMEKICKKNSTGTKRNLACKLMNKTKIPGTSKAMLVHLPSYGVSNVQIVANDICSAGIPVYIVII
Sbjct:    1 MFIWNKNFKFLDDSVQVDKEILVKVQRTKESIYIPTIYRGDCRVMSIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKMVFSNLDHPLRTFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTNTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKNKMTTKLSNLYFTEYLEFYHNFNDKFPVNFLDVAIAEQMFPKVEMEKICKKNSTGTKRNLACKLMNKTKIPGTSKAMLVHLPSYGVSNVQIVANDICSAGIPVYIVII 320          
BLAST of SMED30012786 vs. Planmine SMEST
Match: SMESG000030921.1 (SMESG000030921.1)

HSP 1 Score: 315.079 bits (806), Expect = 9.712e-105
Identity = 150/299 (50.17%), Postives = 197/299 (65.89%), Query Frame = 1
Query:  214 LVKIKRTKESIYIPTIYRGDCRVMSIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPLRKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKNTMTTKLSNLYFTEYLEFYHNFNDKFPVNFLDVAIAEQMFPKVEMEKICKKNSTGTKRNLACKLMNKTKIPGTSKAMLVHLPSYGVSNVQIVANDICSAGIPVYIVII 1110
            L K  +   SI +P IYRGDC+V++ + LK+F+  N+F NGIPKILH +S EEDI K Y ++YK C K+N DM  +LWTDASFY++F+TEF++ + DKWK   S LD   R  +I+SM+LYVFGGV LSLDTVC+ PI       +     CF ++ N +R NIE D+D +YGE +  CS+ H F + LI +         Y T Y E Y     KF V  ++V +AEQ+ PK EMEKICK N TGTKR   C+L+   K+   S A+LVHLP YG+S VQIVA+DICS GI ++IVI+
Sbjct:   77 LFKRMKNNHSIDLPAIYRGDCKVIAADYLKDFAIINQFPNGIPKILHLISEEEDISKEYKQLYKECSKINSDMKTVLWTDASFYRIFITEFNEKLTDKWKSFLSKLDDQFRLTIIKSMILYVFGGVVLSLDTVCRSPIK-----QIMNSSDCFVNIGNRLRNNIEFDKDNKYGEFLFACSSKHQFLKSLINDKNNFDKDRFYLTNYFELYKGQASKFKVETVNVKLAEQVLPKTEMEKICKTNVTGTKRKFGCELLKTYKVNVNSSAVLVHLPLYGISKVQIVADDICSLGIAIHIVIV 370          
BLAST of SMED30012786 vs. Planmine SMEST
Match: SMESG000030931.1 (SMESG000030931.1)

HSP 1 Score: 222.631 bits (566), Expect = 3.096e-72
Identity = 108/119 (90.76%), Postives = 113/119 (94.96%), Query Frame = 1
Query:  202 DKEILVKIKRTKESIYIPTIYRGDCRVMSIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPLRKFMI 558
            +K ILVKIKRTKE    PTIYRGDCRVM+IETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYT+MYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVF NL+HPLRKFM+
Sbjct:    5 NKVILVKIKRTKEK---PTIYRGDCRVMNIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTKMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFWNLNHPLRKFML 120          
BLAST of SMED30012786 vs. Planmine SMEST
Match: SMESG000077190.1 (SMESG000077190.1)

HSP 1 Score: 101.679 bits (252), Expect = 6.564e-24
Identity = 75/269 (27.88%), Postives = 129/269 (47.96%), Query Frame = 1
Query:  274 CRVMSIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDAS----FYKVFVTEFDQYIIDKWKRVFSNLDHPL-RKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLIKN-------TMTTKLSNLYFTEYLEFYH----NFNDKFPVNFLDVAI-AEQMFPKVEMEKICKKNSTGTKRNLACKLMNKTKIPGTSKAMLVHL 1029
            C+V S+ETL  +  +N++ NGIPK++H V     IP  Y ++ + C K+N D+  + WTD S      + F  +F  Y     +   ++   PL R  + +  +L  FGG+ + LDT CQKP +L   +     +TC  S  N  ++ I  +QD     S++ C++ H F+  ++KN       ++      ++ T+    Y     + NDK  V   D  + + Q+ P + ++ I  + +  T      +L  KT      KA++VHL
Sbjct:   38 CQVESVETLIEYGQNNQYPNGIPKLIHNVYENHRIPFQYKDLVENCMKINPDVKFVFWTDESAVNLVRQYFPAQFSVY-----QTYLNSKVEPLKRSDLNRYFILMKFGGIYMDLDTRCQKPFNLVMVN-----ETCILSTENQAQSLILWNQDCIAMNSLMACTSQHKFFRFILKNVRKFENISILELTGPIWLTKMFHLYKIMKDSHNDKDAVVLADSYMFSPQVDPYLILKCIRIRKNWKTVGCQKLRLHRKTARKKIRKAIVVHL 296          
BLAST of SMED30012786 vs. Planmine SMEST
Match: SMESG000005599.1 (SMESG000005599.1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.155e-23
Identity = 80/269 (29.74%), Postives = 123/269 (45.72%), Query Frame = 1
Query:  268 GDCRVMSIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYTEMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPLR-KFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTMRTNIELDQDKQYGESVLGCSAMHPFYEMLI-KNTMT------TKLSNLYFTEYLEFYHNF--NDKFPVNFLDVAIAEQMFPKVE--MEKICKKNSTGTKRNLACKLMNKTKIPGTSK---AMLVHL 1029
            G C V+S++ L  F   ++++NGIPKI+HYV     IP  Y+   K C  +NKD   + WTD + Y+  +  F  Y +  +   FS   H L+   +I+  +LY FGG+ + LDT CQKP  +A  +      +C  S     +T I  ++      S +     H F++ LI K TM       ++      T  LE Y     +   P N + +A      P  E  +E++CK   T  KR   C  +N  +     K   A+ +HL
Sbjct:   33 GHCDVISMKGLLEFGRRHQYANGIPKIIHYVYKTAYIPTQYSSHIKNCKAINKDAKFVFWTDFTAYRFIINNFLDY-VKLYSSYFSKSTHSLKISDVIRYFILYKFGGIYMDLDTRCQKPFDMAMLNG-----SCILSQEVHEQTRILWNRPYLAMNSFMAVIPDHDFFKYLIEKLTMADSSPILSQTGPFMLTNTLESYIKLISHQTKPKNSVSLANPYLYSPLTEHYLERLCKFQYTKWKRK-GCTHLNNHRQQQKVKMKEAVAIHL 294          
The following BLAST results are available for this feature:
BLAST of SMED30012786 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012786 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012786 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012786 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012786 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012786 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012786 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P33300|SUR1_YEAST3.293e-931.82Mannosyl phosphorylinositol ceramide synthase SUR1... [more]
sp|Q10323|IMT3_SCHPO1.712e-823.73Inositol phosphoceramide mannosyltransferase 3 OS=... [more]
sp|Q9UT67|IMT2_SCHPO2.715e-725.69Inositol phosphoceramide mannosyltransferase 2 OS=... [more]
sp|O14084|IMT1_SCHPO3.562e-723.40Inositol phosphoceramide mannosyltransferase 1 OS=... [more]
sp|P38287|CSH1_YEAST5.441e-726.97Mannosyl phosphorylinositol ceramide synthase CSH1... [more]
back to top
BLAST of SMED30012786 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GZ285.561e-1323.95Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GVK06.158e-1323.95Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F0E46.510e-1323.95Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IW341.471e-1227.08Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G0Y61.872e-1129.45Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30012786 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012786 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012786 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SUR14.743e-1131.82Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
CSH17.836e-926.97Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
back to top
BLAST of SMED30012786 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012786 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012786 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030941.10.000e+097.50SMESG000030941.1[more]
SMESG000030921.19.712e-10550.17SMESG000030921.1[more]
SMESG000030931.13.096e-7290.76SMESG000030931.1[more]
SMESG000077190.16.564e-2427.88SMESG000077190.1[more]
SMESG000005599.13.155e-2329.74SMESG000005599.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012786 ID=SMED30012786|Name=SMED30012786|organism=Schmidtea mediterranea sexual|type=transcript|length=1246bp
GCTCAGTCACATAAGTATTAAGAAAAATTGACAATTATAAATTAGTTTAT
TGATAAACTATTGAAAGTTTGATAAAATTATATTTTTCTGAAAATGAAAA
GGAAAAGGTTTTTTTACTGTGTAATCTTCGCTGCCGTGGTGTTTATCGTG
ATGCTTATTTGGAACAAGAATTTCAAATTTCTAGGTGACAGCGTCCAGGT
CGACAAGGAGATATTGGTGAAAATCAAACGAACCAAGGAAAGCATTTACA
TTCCGACAATATACCGCGGAGACTGCAGAGTTATGAGTATTGAAACGTTG
AAAAATTTCAGTTCCTCCAACAGATTCTCAAATGGAATTCCGAAAATCCT
CCATTACGTTTCAAATGAAGAAGACATTCCGAAAGTTTACACAGAAATGT
ACAAAACCTGCGGAAAGTTGAACAAAGACATGATGTTGATTTTGTGGACA
GATGCAAGTTTTTATAAGGTCTTCGTCACGGAATTTGATCAGTATATTAT
TGATAAATGGAAAAGGGTGTTCTCGAATCTGGATCACCCTTTGCGAAAAT
TCATGATCCAGTCAATGGTTTTGTACGTGTTTGGTGGGGTTAGTCTTTCA
CTAGATACGGTATGTCAGAAACCTATTCATCTTGCCTTTACCGACACTTT
GTCAAAAGAAAAGACTTGCTTTGCAAGTGTCAGCAACACAATGAGAACAA
ACATAGAATTAGACCAAGACAAACAATACGGAGAATCTGTTTTGGGCTGC
TCGGCAATGCATCCGTTTTATGAGATGTTAATAAAAAACACAATGACCAC
GAAATTGAGCAACCTTTATTTTACTGAGTATTTGGAATTTTACCACAATT
TCAATGATAAATTCCCGGTGAACTTTCTGGATGTTGCCATCGCCGAGCAA
ATGTTTCCGAAAGTAGAGATGGAAAAAATTTGTAAGAAAAATTCAACCGG
AACCAAGCGGAATTTGGCGTGTAAATTAATGAATAAAACTAAAATTCCCG
GGACTTCGAAAGCCATGCTGGTTCACTTACCTAGTTATGGAGTGTCAAAT
GTGCAAATTGTCGCTAATGATATTTGTTCAGCGGGTATTCCGGTCTATAT
TGTCATAATTTGATTGGCTGACCGCACAAATTGCTCTCTTCCTATTCGAT
GATAATAATTGAAAGTTATTTCAAGGAACTCTTTTATATTGTTAATGTTA
AAAAAAATTTTATGTGATTTTTAAAACAATTTTCATTAATAAATTA
back to top

protein sequence of SMED30012786-orf-1

>SMED30012786-orf-1 ID=SMED30012786-orf-1|Name=SMED30012786-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=340bp
MKRKRFFYCVIFAAVVFIVMLIWNKNFKFLGDSVQVDKEILVKIKRTKES
IYIPTIYRGDCRVMSIETLKNFSSSNRFSNGIPKILHYVSNEEDIPKVYT
EMYKTCGKLNKDMMLILWTDASFYKVFVTEFDQYIIDKWKRVFSNLDHPL
RKFMIQSMVLYVFGGVSLSLDTVCQKPIHLAFTDTLSKEKTCFASVSNTM
RTNIELDQDKQYGESVLGCSAMHPFYEMLIKNTMTTKLSNLYFTEYLEFY
HNFNDKFPVNFLDVAIAEQMFPKVEMEKICKKNSTGTKRNLACKLMNKTK
IPGTSKAMLVHLPSYGVSNVQIVANDICSAGIPVYIVII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029044Nucleotide-diphossugar_trans
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.550.20coord: 82..283
e-value: 1.9E-5
score: 27.0
NoneNo IPR availablePANTHERPTHR32385FAMILY NOT NAMEDcoord: 71..232
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 74..254