SEC14-like lipid binding 8

Overview
NameSEC14-like lipid binding 8
Smed IDSMED30012784
Length (bp)1322
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SEC14-like lipid binding 8 (SMED30012784) t-SNE clustered cells

Violin plots show distribution of expression levels for SEC14-like lipid binding 8 (SMED30012784) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SEC14-like lipid binding 8 (SMED30012784) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SEC14-like lipid binding 8 (SMED30012784) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012784

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30012784h1SMcG0008349 PL05003A1B05smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30012784h1SMcG0008349 PL05003A1B05ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30012784h1SMcG0008349 PL05003A1B05smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012784h1SMcG0008349 PL05003A1B05ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SEC14-like lipid binding 8 vs. Ensembl Human
Match: SEC14L4 (SEC14 like lipid binding 4 [Source:HGNC Symbol;Acc:HGNC:20627])

HSP 1 Score: 260.766 bits (665), Expect = 2.179e-82
Identity = 137/385 (35.58%), Postives = 228/385 (59.22%), Query Frame = 3
Query:   93 LCPQKVSELILELQNNVKDIWRPQF--ADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVK--NIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            L PQ+  E +   + N++D+  P    AD+ ++L+WL+AR+FD++KSE MLR H+ +R+++ +D I+  +Q P+V   Y  GG CG+D EG P++   +G LDP+G L S   +D+ + R+ + E L      Q +++  R I   + +FDME   LKHLW+PA+E   +   ++EANYPE++  LI+   P LF +A+NLVK F+   T++K+ ILG N+K+EL K I  DQLP   GG M  P+G+P+C   I +GG++P SYYL + V+       +V   S +++   +  P  ++ ++F++   DI F ++    + E +       +  EVL   +  +++  E G +   + G Y++ FDN+YS + +K L Y +E+L
Sbjct:    8 LSPQQ-QEALARFRENLQDLL-PILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDNIVT-WQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQ-TQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQ----SAREMTEVLPSQRYNAHMVPEDGSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVL 384          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Human
Match: SEC14L2 (SEC14 like lipid binding 2 [Source:HGNC Symbol;Acc:HGNC:10699])

HSP 1 Score: 257.684 bits (657), Expect = 3.474e-81
Identity = 133/379 (35.09%), Postives = 224/379 (59.10%), Query Frame = 3
Query:  114 ELILELQNNVKDIWRPQFA--DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIAL-FDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            E + + + NV+D+  P     D+ ++L+WL+AR FD++KSE MLR H+ +R+++ ID I+  +Q P+V  +Y  GG CG+D +G P+W + +G LD +G L S   +D+ + ++   E L +    Q +K   +  ++TI + +D E  GLKHLW+PA+E   E   + E NYPE++ +L +   P LF +AYNL+KPFL   T++K+ +LG+N+KE LLK I  DQ+P   GG M  P+G+P+C   I +GG IP  YY+   VK     ++ +   S  ++ Y +  P  ++ ++F +   D+ F I+    + E +    +  +  EVL   +  S+L  E G +  +  G Y++ FDN+YS++ +K + + +E+L
Sbjct:   14 EALAKFRENVQDVL-PALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIIS-WQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRK--VETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQ----RAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVL 384          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Human
Match: SEC14L3 (SEC14 like lipid binding 3 [Source:HGNC Symbol;Acc:HGNC:18655])

HSP 1 Score: 253.062 bits (645), Expect = 1.841e-79
Identity = 129/381 (33.86%), Postives = 227/381 (59.58%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFA--DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K +E + + + NV+D+  P     D+ ++L+WL+AR+FD++KSE +LR ++ +R+   ID IL D+Q P+V  KY  GG CG+D++G P+W + +G LDP+G L S+  +D+ K ++   E +      Q  +  ++ I   + +FD E  GLKH W+P +E   E   L+E NYPE++  ++I     LF + YNL+KPFL   T++K+ +LG+N+KE LLK+I  ++LP   GG +  P+G+P+C   I +GG+IP S Y+   VK     ++ +   S  ++ Y +  P  ++ ++FS+   DI F ++    + E +    +  +  +VL   +  +++  E G +  ++ G Y++ FDN+YS+V +K + + +E+L
Sbjct:   11 KQAETLAKFRENVQDVL-PALPNPDDYFLLRWLRARNFDLQKSEALLRKYMEFRKTMDIDHIL-DWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILHECDLQTERLGKK-IETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIIVLGNNWKEGLLKLISPEELPAQFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQINRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFLKTKMGERQ----RAGEMTDVLPSQRYNAHMVPEDGNLTCSEAGVYVLRFDNTYSFVHAKKVSFTVEVL 384          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Human
Match: SEC14L6 (SEC14 like lipid binding 6 [Source:HGNC Symbol;Acc:HGNC:40047])

HSP 1 Score: 246.514 bits (628), Expect = 4.804e-77
Identity = 130/375 (34.67%), Postives = 214/375 (57.07%), Query Frame = 3
Query:  120 ILELQNNVKDIWRP-QFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVK--NIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            + + + N++D+       D+ ++L+WL+AR FD++KSE MLR H+ +R+++ +  IL  +Q P+V   Y   G CGHD EG P+W   +G LDP+G L S   +++ +      E L +    Q  K  +R + + IA+F +E  GL+ LW+P +E   E    +EANYPE +  LI+   P LF +A+NLVK ++   T++KV ILG N+K+EL K I  DQLP   GG M  P+G+P+C   I +GG++P SYYL K V+       +V   S +++   +  P  ++ ++F++   DI F ++    + E +    +  +  EVL   +  +++  E G +   + G Y++ F N+YS V SK + Y +E+L
Sbjct:   16 LAQFRENIQDVLSALPNPDDYFLLRWLQARSFDLQKSEDMLRKHMEFRKQQDLANILA-WQPPEVVRLYNANGICGHDGEGSPVWYHIVGSLDPKGLLLSASKQELLRDSFRSCELLLRECELQSQKLGKR-VEKIIAIFGLEGLGLRDLWKPGIELLQEFFSALEANYPEILKSLIVVRAPKLFAVAFNLVKSYMSEETRRKVVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCKQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGERQ----RAREMTEVLPSQRYNAHMVPEDGILTCLQAGSYVLRFYNTYSLVHSKRISYTVEVL 384          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Human
Match: SEC14L4 (SEC14 like lipid binding 4 [Source:HGNC Symbol;Acc:HGNC:20627])

HSP 1 Score: 234.958 bits (598), Expect = 5.074e-73
Identity = 126/360 (35.00%), Postives = 210/360 (58.33%), Query Frame = 3
Query:   93 LCPQKVSELILELQNNVKDIWRPQF--ADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVK--NIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLG 1160
            L PQ+  E +   + N++D+  P    AD+ ++L+WL+AR+FD++KSE MLR H+ +R+++ +D I+  +Q P+V   Y  GG CG+D EG P++   +G LDP+G L S   +D+ + R+ + E L      Q +++  R I   + +FDME   LKHLW+PA+E   +   ++EANYPE++  LI+   P LF +A+NLVK F+   T++K+ ILG N+K+EL K I  DQLP   GG M  P+G+P+C   I +GG++P SYYL + V+       +V   S +++   +  P  ++ ++F++   DI F ++    + E +       +  EVL   +  +++  E G +   + G
Sbjct:    8 LSPQQ-QEALARFRENLQDLL-PILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDNIVT-WQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQ-TQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQ----SAREMTEVLPSQRYNAHMVPEDGSLTCLQAG 359          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Celegans
Match: ctg-1 (CRAL/TRIO and GOLD domain containing [Source:UniProtKB/TrEMBL;Acc:K8ES75])

HSP 1 Score: 162.54 bits (410), Expect = 1.673e-45
Identity = 119/380 (31.32%), Postives = 192/380 (50.53%), Query Frame = 3
Query:  132 QNNVKDIWR--PQFADEN--YILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIES-TKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILG-SNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGG-QIPISYYLN--KHVKNI-QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILDI 1241
            Q  ++D+    PQ  + N  Y+L+WL+A++    ++   L+ H+++R    +D I E +  P+  +KY   G  G D EGRPI M  LG +D +G L+S+   D  K  +  +E   K L  +++KE  RP  Q   +FD+EN    H        +  +   L + +YP  + K++I   P + +IAY  +   LQ    + V +   S++K  L +I++ D  P Y GGN+   NGDP+C   I++GG  +  SY+++  K + +  Q  TV A  K  +   V  P S I + + T E DI F I+Y     +      K ++ E V    ++        G +  T +G Y++EFDN YSW  +K L+Y IEI D+
Sbjct:   14 QQTIRDLRSIVPQIDNLNDGYVLRWLRAKEGRFDETAESLKKHVTFRNAWHLDKI-EQWTPPECLEKYCGYGLLG-DTEGRPILMSLLGNVDVEGLLRSVASLDYIKFSLAAIEKGMK-LCEEKAKESGRPFEQMTLVFDLENITSAHFSCKQFASSFTTLVSLFQDHYPLFLRKILIIRAPEMARIAYASITAILQDPITRLVEMPSESDWKWSLAQIVNLDAWPMYWGGNLV-ENGDPKCPSRIKYGGGAVDESYFVDPKKAMADYDQLTTVYAGDKHLIQIKVKRP-SRISWTYMTDEDDIGFEIHY-----DKTGSCDKLTEMETVYPYIRLECTNVPITGHLDVTDVGNYVLEFDNYYSWFSAKQLRYNIEIEDL 383          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Celegans
Match: T23G5.2 (CRAL-TRIO domain-containing protein T23G5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q03606])

HSP 1 Score: 154.451 bits (389), Expect = 1.209e-40
Identity = 81/263 (30.80%), Postives = 151/263 (57.41%), Query Frame = 3
Query:  120 ILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEER----PILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSI---LGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYL 887
            + E++ +++   + +  ++ ++L++L+ARDFD+ K++ M+   I WR++  +D ILE++  P V  +Y  G +   DK GRP+++   G LD +G L+S  ++++ K+ + I E+       QR+ E  R    PI     + D++   ++HLWRP ++C ++  +++EANYPE+M ++++   P +F + + L+ PF+   T++K  +    G + KEEL K I+   +P +LGG+    N    C      GG +P S YL
Sbjct:  259 LCEIKYSLQAHHKGKLPNDAHLLRFLRARDFDVAKAKDMVHASIIWRKQHNVDKILEEWTRPTVIKQYFPGCWHNSDKAGRPMYILRFGQLDTKGMLRSCGVENLVKLTLSICEDGL-----QRAAEATRKLGTPISSWSLVVDLDGLSMRHLWRPGVQCLLKIIEIVEANYPETMGQVLVVRAPRVFPVLWTLISPFIDEKTRKKFMVSGGSGGDLKEELRKHIEEKFIPDFLGGSCLTTN----CG----LGGHVPKSMYL 508          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Celegans
Match: T23G5.2 (CRAL-TRIO domain-containing protein T23G5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q03606])

HSP 1 Score: 154.451 bits (389), Expect = 1.209e-40
Identity = 81/263 (30.80%), Postives = 151/263 (57.41%), Query Frame = 3
Query:  120 ILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEER----PILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSI---LGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYL 887
            + E++ +++   + +  ++ ++L++L+ARDFD+ K++ M+   I WR++  +D ILE++  P V  +Y  G +   DK GRP+++   G LD +G L+S  ++++ K+ + I E+       QR+ E  R    PI     + D++   ++HLWRP ++C ++  +++EANYPE+M ++++   P +F + + L+ PF+   T++K  +    G + KEEL K I+   +P +LGG+    N    C      GG +P S YL
Sbjct:  259 LCEIKYSLQAHHKGKLPNDAHLLRFLRARDFDVAKAKDMVHASIIWRKQHNVDKILEEWTRPTVIKQYFPGCWHNSDKAGRPMYILRFGQLDTKGMLRSCGVENLVKLTLSICEDGL-----QRAAEATRKLGTPISSWSLVVDLDGLSMRHLWRPGVQCLLKIIEIVEANYPETMGQVLVVRAPRVFPVLWTLISPFIDEKTRKKFMVSGGSGGDLKEELRKHIEEKFIPDFLGGSCLTTN----CG----LGGHVPKSMYL 508          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Celegans
Match: ctg-1 (CRAL/TRIO and GOLD domain containing [Source:UniProtKB/TrEMBL;Acc:K8ES75])

HSP 1 Score: 123.25 bits (308), Expect = 8.286e-32
Identity = 92/296 (31.08%), Postives = 146/296 (49.32%), Query Frame = 3
Query:  372 MEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIES-TKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILG-SNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGG-QIPISYYLN--KHVKNI-QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILDI 1241
            M  LG +D +G L+S+   D  K  +  +E   K L  +++KE  RP  Q   +FD+EN    H        +  +   L + +YP  + K++I   P + +IAY  +   LQ    + V +   S++K  L +I++ D  P Y GGN+   NGDP+C   I++GG  +  SY+++  K + +  Q  TV A  K  +   V  P S I + + T E DI F I+Y     +      K ++ E V    ++        G +  T +G Y++EFDN YSW  +K L+Y IEI D+
Sbjct:    1 MSLLGNVDVEGLLRSVASLDYIKFSLAAIEKGMK-LCEEKAKESGRPFEQMTLVFDLENITSAHFSCKQFASSFTTLVSLFQDHYPLFLRKILIIRAPEMARIAYASITAILQDPITRLVEMPSESDWKWSLAQIVNLDAWPMYWGGNLV-ENGDPKCPSRIKYGGGAVDESYFVDPKKAMADYDQLTTVYAGDKHLIQIKVKRP-SRISWTYMTDEDDIGFEIHY-----DKTGSCDKLTEMETVYPYIRLECTNVPITGHLDVTDVGNYVLEFDNYYSWFSAKQLRYNIEIEDL 288          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Celegans
Match: ctg-2 (CRAL/TRIO and GOLD domain containing [Source:UniProtKB/TrEMBL;Acc:Q22467])

HSP 1 Score: 115.161 bits (287), Expect = 3.704e-28
Identity = 83/333 (24.92%), Postives = 165/333 (49.55%), Query Frame = 3
Query:  267 EKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPN--GDPRCSHLIRWGGQIPISYYLNKH----VKNIQNITVKAKSK--IKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLH---KVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEI 1232
            EK+    +D  +P    +Y  G   G D E   + ++ +G LD  G + +    D+Y++R+   E + + ++ +  KE+ +P L T  +FD++   +  +   A++        ++  +P+ + K+ I NTP   ++ ++++ P L   TQQKV ILG+++K+ L + I  + L    GG        G+      +R GG+IP     +       + +  + V A+S   + ++   N P   +Y+ +  + +DINF+I       E      K ++ ++   +H   K++++   E GE+ A + G Y   FDN++S ++SK ++Y+IE+
Sbjct:   78 EKVAQKCDDCSVPL---RYLPGSLIGLDHENNVVSLQMIGHLDAAGLMPATRNSDLYRMRIAESEGVMQ-IIRKMEKEQGKP-LGTSVIFDLDGLSMVQIDLAALKVVTTMLSQLQEMFPDVIRKIFIVNTPTFIQVLWSMISPCLAKQTQQKVKILGNDWKQHLKENIGEEVLFERWGGTRKAETEYGN------VRMGGKIPAELKYDPANDLPAEKLTKLNVSARSTTFVPITLEGNVPGRKLYWWWRLENNDINFSILRAAEGEE------KVAEHDDDYMVHPKFKLQTDFVPEDGEVCAAEPGVYKFVFDNTHSKLRSKTVKYFIEV 393          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Fly
Match: CG13893 (gene:FBgn0035146 transcript:FBtr0072562)

HSP 1 Score: 189.504 bits (480), Expect = 2.584e-55
Identity = 117/363 (32.23%), Postives = 185/363 (50.96%), Query Frame = 3
Query:  171 DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLK-HLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSN---YKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQNITVKAK----SKIKLSYLVNSPES-LIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEI 1232
            D+ ++++WL+AR ++++ +E MLR  +  R    +D I E +  P    +Y   G  G+D EG P+ + P    D  G +  +   +  K  V ++E   K    Q  K   R   Q +  FDM++  LK + WRPA EC I + K  EAN+PE +    I N P LF +A+N+VK FL   T  K+ I  S    ++E+L   ++    P   GG M   NGDP+C  L+ WGG++P   Y+++  +      V+A+     K+KL + VN  E  ++ +EF T ++DI F IY V         + K  +    + L  V SN   E G I       Y + FDNS S+++SK L+Y++++
Sbjct:   32 DDYFLVRWLRARKWNLEAAEKMLRASLKTRAMWNVDNI-EKWDPPKALQEYLPYGLMGYDNEGSPVLVCPFANFDMWGMMHCVTRFEFQKYLVLLLERFMKIAYDQSQKHGWRA-RQLVVFFDMQDVNLKQYAWRPAAECVISTVKQYEANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFSHVNRKAFPKAWGGEMVDRNGDPQCKALMVWGGKLPEELYIDQSSQQSDRDFVEAQVPKGDKLKLHFKVNVEEQKILSWEFRTFDYDIKFGIYSV---------DDKTGEKRSEVPLGTVYSNEMDEIGYISTRPNTTYTVVFDNSASYLRSKKLRYWVDL 383          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Fly
Match: retm (gene:FBgn0031814 transcript:FBtr0329951)

HSP 1 Score: 145.591 bits (366), Expect = 1.941e-37
Identity = 95/356 (26.69%), Postives = 178/356 (50.00%), Query Frame = 3
Query:   93 LCPQKVSELILELQ---NNVKDIWR-PQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILG---SNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYY----LNKHVKNI-------------------------------QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYV 1034
            L P + S+L LEL+   + V D+ R P +     IL++L ARD+ + ++  ML + + WR   +ID +L ++  P V  ++  GG+   DK+GRP+++  LG +D +G LKSL +  + ++ +HI E   +  + + ++  E+P+L    L D+E   ++HLWRP ++  +   + +E NYPE+M ++++   P +F IA+ +V  F+   T+ K    G   ++ K+ L + +D + +P +LGG          C  +I  GG +P + Y    L  H   +                               +++ +KA    +L      P+S++ ++F    +D++F +Y V
Sbjct:  217 LSPMQESKL-LELRKMLDGVDDLERVPSY---QTILRFLAARDWHVSQAYAMLCDSLRWRREHRIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQK-INESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGGP---------CKTMIHEGGLVPKTLYKMNSLEDHDDEVTAELPTTAAAQALVPGKRLSANQQHDHRNLYKSVDLKAGFAHELLIRNEDPKSVLTWDFDVMRNDLHFTLYRV 558          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Fly
Match: retm (gene:FBgn0031814 transcript:FBtr0079272)

HSP 1 Score: 145.206 bits (365), Expect = 1.998e-37
Identity = 95/356 (26.69%), Postives = 178/356 (50.00%), Query Frame = 3
Query:   93 LCPQKVSELILELQ---NNVKDIWR-PQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILG---SNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYY----LNKHVKNI-------------------------------QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYV 1034
            L P + S+L LEL+   + V D+ R P +     IL++L ARD+ + ++  ML + + WR   +ID +L ++  P V  ++  GG+   DK+GRP+++  LG +D +G LKSL +  + ++ +HI E   +  + + ++  E+P+L    L D+E   ++HLWRP ++  +   + +E NYPE+M ++++   P +F IA+ +V  F+   T+ K    G   ++ K+ L + +D + +P +LGG          C  +I  GG +P + Y    L  H   +                               +++ +KA    +L      P+S++ ++F    +D++F +Y V
Sbjct:  217 LSPMQESKL-LELRKMLDGVDDLERVPSY---QTILRFLAARDWHVSQAYAMLCDSLRWRREHRIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQK-INESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGGP---------CKTMIHEGGLVPKTLYKMNSLEDHDDEVTAELPTTAAAQALVPGKRLSANQQHDHRNLYKSVDLKAGFAHELLIRNEDPKSVLTWDFDVMRNDLHFTLYRV 558          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Fly
Match: retm (gene:FBgn0031814 transcript:FBtr0339788)

HSP 1 Score: 145.206 bits (365), Expect = 1.998e-37
Identity = 95/356 (26.69%), Postives = 178/356 (50.00%), Query Frame = 3
Query:   93 LCPQKVSELILELQ---NNVKDIWR-PQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILG---SNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYY----LNKHVKNI-------------------------------QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYV 1034
            L P + S+L LEL+   + V D+ R P +     IL++L ARD+ + ++  ML + + WR   +ID +L ++  P V  ++  GG+   DK+GRP+++  LG +D +G LKSL +  + ++ +HI E   +  + + ++  E+P+L    L D+E   ++HLWRP ++  +   + +E NYPE+M ++++   P +F IA+ +V  F+   T+ K    G   ++ K+ L + +D + +P +LGG          C  +I  GG +P + Y    L  H   +                               +++ +KA    +L      P+S++ ++F    +D++F +Y V
Sbjct:  217 LSPMQESKL-LELRKMLDGVDDLERVPSY---QTILRFLAARDWHVSQAYAMLCDSLRWRREHRIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHMDVKGLLKSLGMDGLLRLALHICEEGIQK-INESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKDGLAQYLDEEIVPDFLGGP---------CKTMIHEGGLVPKTLYKMNSLEDHDDEVTAELPTTAAAQALVPGKRLSANQQHDHRNLYKSVDLKAGFAHELLIRNEDPKSVLTWDFDVMRNDLHFTLYRV 558          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Fly
Match: CG10026 (gene:FBgn0032785 transcript:FBtr0081238)

HSP 1 Score: 63.1586 bits (152), Expect = 7.932e-11
Identity = 60/244 (24.59%), Postives = 114/244 (46.72%), Query Frame = 3
Query:   96 CPQKVSELILELQNNV--KDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWRER-----EKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGG 806
            CP    ++I + +N +   +  +P  +D  Y+ K+L+AR + I+ S  +L ++  +RE+     EK+  +  D +     D   V  +   D+ G  I +   G   P      + + DI++  + +++ L        S E    I+  + +FD+++ GL+H+   +     +   L+  + P   + L I N   +F  A+ + KPFL  A ++K+ I GS+    L K I+ + LP   GG
Sbjct:   29 CPSSKDKVIEQFRNYILEHNECQPHRSDAKYLEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPL--DLRHVGQSDILTVTPY--RDQHGHRILIYRFGLWRP----NQVTVDDIFRATI-VLQEL-------GSLEPISQIVGGVGIFDLKDLGLEHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMT-SLHKHINPEHLPKRYGG 255          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Zebrafish
Match: sec14l8 (SEC14-like lipid binding 8 [Source:ZFIN;Acc:ZDB-GENE-060526-180])

HSP 1 Score: 280.411 bits (716), Expect = 2.239e-90
Identity = 142/391 (36.32%), Postives = 235/391 (60.10%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFADEN--YILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILDIMKTEHRDN 1265
            K +E + + +  V+D+  PQ   ++  ++L+WL+AR+F+++KSE MLR HI +R+  K+DTI  ++Q+P+V DKY  GG CGHD+EG P+W + +G LDP+G + S   +D+ K +V   E L K+   ++S+   R I     ++D E  G+KHL++PA+E   E   + E NYPE + +L +   P LF +AYNLVK FL   T++KV +LGSN++E L K ID ++LP Y GG +  P+GDP+C   I +G +IP SYY+   +K    Q++++   S  ++ Y + +P   + ++FS    DI F +Y    + E     +K  +  E++   +  ++L  E G +   + G Y++ FDN+YS  +SK +++ +E+L   +    DN
Sbjct:   11 KQAEALAQFREKVQDVL-PQCPSQSDHFLLRWLRARNFNLQKSEAMLRKHIEFRKHMKVDTITTEWQVPEVIDKYLSGGMCGHDREGSPVWYDVIGPLDPKGLMHSASKQDLIKSKVRDCEILQKDC-DRQSERLGRNIESITMVYDCEGLGMKHLYKPAIETYGEVLTMFEDNYPEGLKRLFVIKAPKLFPVAYNLVKHFLSEDTRRKVIVLGSNWQEVLQKYIDPEELPAYYGGKLTDPDGDPKCRTRITFGSEIPKSYYVRDSIKVDYEQSVSIGRGSSHQMEYELIAPNCALRWQFSCDGADIGFGVYLKKKMGE----RMKAGEMREIVPNQRYNAHLVPEDGSLTCPEPGVYVLRFDNTYSVFQSKTVKFTVEVLLPSQVNQSDN 395          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Zebrafish
Match: sec14l7 (SEC14-like lipid binding 7 [Source:ZFIN;Acc:ZDB-GENE-141216-145])

HSP 1 Score: 278.1 bits (710), Expect = 2.220e-89
Identity = 136/381 (35.70%), Postives = 238/381 (62.47%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFADE--NYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K +E + + +  ++D+W  Q +++  +Y+L+WL+AR F++ K+E MLR H+ +R   K++TI++D+  P+V ++Y  GG CG+D+EG PIW + +G LDP+G L S   +D  + ++   E L +    ++SK+  + I     ++D E  G+KHLW+PA+E   E   + E NYPES+ K+++   P LF IAYNLVK FL+  T+QK+++LGSN+K+ L   +D+DQ+P   GG++  P+G+P C+ ++R+GG +P SYY+   +K    QNIT+   S  ++ Y +  P  L+ ++F+++  DI F ++      E++    K    +E+L+  +  ++L  E+G     + G Y++ FDNSYS + SK + + +++L
Sbjct:   24 KQAEALTQFREKLEDVW-DQLSNQTDHYLLRWLRARTFNVPKAEAMLRKHLEFRRHMKLETIIDDWSPPEVLERYVAGGMCGYDREGSPIWFDIIGPLDPKGLLLSASKQDCLRTKIRDAE-LLRRECEKQSKKLGKHIESITIIYDCEGLGMKHLWKPAVEMYGEILTMYEENYPESLKKVLLIKAPKLFPIAYNLVKHFLREETRQKIAVLGSNWKDVLKNYVDADQIPAAYGGSLTDPDGNPLCTTMLRYGGVVPKSYYVRDSIKVQYEQNITISRGSAHQIEYELLFPNCLLRWQFASEGSDIGFGLFLKTKGSETK----KVEDMQEILRNERYNAHLVPEEGSYTCEEPGIYVVRFDNSYSVLHSKKVSFTVDVL 398          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Zebrafish
Match: sec14l7 (SEC14-like lipid binding 7 [Source:ZFIN;Acc:ZDB-GENE-141216-145])

HSP 1 Score: 227.639 bits (579), Expect = 3.982e-70
Identity = 119/381 (31.23%), Postives = 217/381 (56.96%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFADE--NYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K +E + + +  ++D+W  Q +++  +Y+L+WL+AR F++ K+E MLR H+ +R   K++TI++D+  P+V ++Y  GG CG+D+EG PIW + +G LDP+G L S   +D  + ++   E L +    ++SK+  + I     ++D E  G+KHLW+PA+E   E   + E NYPES+                            +KV ++ +N+K+ L   +D+DQ+P   GG++  P+G+P C+ ++R+GG +P SYY+   +K    QNIT+   S  ++ Y +  P  L+ ++F+++  DI F ++      E++    K    +E+L+  +  ++L  E+G     + G Y++ FDNSYS + SK + + +++L
Sbjct:   24 KQAEALTQFREKLEDVW-DQLSNQTDHYLLRWLRARTFNVPKAEAMLRKHLEFRRHMKLETIIDDWSPPEVLERYVAGGMCGYDREGSPIWFDIIGPLDPKGLLLSASKQDCLRTKIRDAE-LLRRECEKQSKKLGKHIESITIIYDCEGLGMKHLWKPAVEMYGEILTMYEENYPESL----------------------------KKVLLIKANWKDVLKNYVDADQIPAAYGGSLTDPDGNPLCTTMLRYGGVVPKSYYVRDSIKVQYEQNITISRGSAHQIEYELLFPNCLLRWQFASEGSDIGFGLFLKTKGSETK----KVEDMQEILRNERYNAHLVPEEGSYTCEEPGIYVVRFDNSYSVLHSKKVSFTVDVL 370          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Zebrafish
Match: SEC14L1 (si:dkey-237i9.1 [Source:ZFIN;Acc:ZDB-GENE-060503-441])

HSP 1 Score: 145.206 bits (365), Expect = 1.203e-37
Identity = 85/300 (28.33%), Postives = 162/300 (54.00%), Query Frame = 3
Query:  180 YILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSI-LGSNYKEE--LLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQNITVKAKSKI---KLSYLVNSPE----------SLIYYEFSTKEHDINFAIYY 1031
            +IL++L+ARDF+I K+  +L   ++WR++ ++D +L+ +  P V   +  GG+  HD +GRP+++  LG +D +G +++L  + + +  + I E   +    + +K   RPI     L D+E   ++HLWRPA++  +   +++EANYPE++ +L+I   P +F + + LV PF+   T++K  I  G++Y+    L+  ID + +P +LGG          C   +  GG +P S Y  +  + ++N  ++  ++      S    +P           S+I ++F   + D+ F IY+
Sbjct:  181 HILRFLRARDFNIDKAREILCQSLTWRKQHQVDYLLDTWSSPQVLHDFYTGGWHHHDNDGRPLYILRLGHMDTKGLVRALGEESLLRHVLSINEEGLRRC-EENTKVFGRPISCWTCLVDLEGLNMRHLWRPAVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDENTRKKFLIYAGNDYQGSGGLVDYIDKEVIPDFLGGE---------CMCEVPEGGLVPKSLY--RTAEELENDEIRLWTETIYQSASIFKGAPHEQLIEIIDATSVITWDFDVCKGDVIFNIYH 468          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Zebrafish
Match: sec14l7 (SEC14-like lipid binding 7 [Source:ZFIN;Acc:ZDB-GENE-141216-145])

HSP 1 Score: 128.642 bits (322), Expect = 6.856e-35
Identity = 60/162 (37.04%), Postives = 104/162 (64.20%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFADE--NYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAME 584
            K +E + + +  ++D+W  Q +++  +Y+L+WL+AR F++ K+E MLR H+ +R   K++TI++D+  P+V ++Y  GG CG+D+EG PIW + +G LDP+G L S   +D  + ++   E L +    Q SK+  + I     ++D E  G+KHLW+PA+E
Sbjct:   12 KQAEALTQFREKLEDVW-DQLSNQTDHYLLRWLRARTFNVPKAEAMLRKHLEFRRHMKLETIIDDWSPPEVLERYVAGGMCGYDREGSPIWFDIIGPLDPKGLLLSASKQDCLRTKIRDAELLRRECEKQ-SKKLGKHIESITIIYDCEGLGMKHLWKPAVE 171          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Xenopus
Match: cldn8.4 (claudin 8, gene 4 [Source:Xenbase;Acc:XB-GENE-991592])

HSP 1 Score: 269.626 bits (688), Expect = 6.787e-86
Identity = 138/382 (36.13%), Postives = 228/382 (59.69%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWR--PQFADENY-ILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVK-NIQN-ITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K  E +++ + NVKD+    P F+ ++Y +L+WL+AR F+++K+E MLR ++ +R++   D +LE +Q P+V  KY  GG CGHD+E  PIW + +G LDP+G L S   +D+ K ++   E L+     Q  K  +R +   + ++D+E  GLKHLW+PA+E   E  ++ E NYPE++ +L +   P LF +AYNL+K FL   T++K+ +LG N+++ L K I  ++LP Y GG +  P+GDP+C   I +GG IP  YY+   VK N +N + +   S  ++ Y +  P  ++ ++F +   DI F IY      E +    K  +  EVL   +  +++  E G +  T+ G Y++ FDN+YS++ +K + Y +E+L
Sbjct:   11 KQEEALVKFRENVKDLMPRLPPFSQDDYFLLRWLRARSFNLQKAENMLRKNVEFRKQMDSDNVLEKWQPPEVVQKYLSGGLCGHDREDSPIWYDVIGPLDPKGLLFSASKQDLMKTKMRDCEVLHHACRMQSEKLGKR-VEDVVMIYDVEGLGLKHLWKPAVELYGEILQMFEDNYPEALKRLFVIKAPKLFPVAYNLIKHFLSEDTRRKIMVLGDNWQDVLKKYIAPEELPQYYGGTLTDPDGDPKCKSKINYGGDIPKKYYVRDQVKQNYENTLNINRGSSQQMEYEILFPSCVLRWQFQSDGADIGFGIYRKTKAGERQ----KAGEMVEVLANQRYNAHMVPEDGTMTCTEPGTYVLRFDNTYSFIHAKKVSYTVEVL 387          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Xenopus
Match: cldn8.4 (claudin 8, gene 4 [Source:Xenbase;Acc:XB-GENE-991592])

HSP 1 Score: 242.276 bits (617), Expect = 2.428e-75
Identity = 130/382 (34.03%), Postives = 217/382 (56.81%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWR--PQFADENY-ILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVK-NIQN-ITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K  E +++ + NVKD+    P F+ ++Y +L+WL+       +       ++ +R++   D +LE +Q P+V  KY  GG CGHD+E  PIW + +G LDP+G L S   +D+ K ++   E L+     Q  K  +R +   + ++D+E  GLKHLW+PA+E   E  ++ E NYPE++ +L +   P LF +AYNL+K FL   T++K+ +LG N+++ L K I  ++LP Y GG +  P+GDP+C   I +GG IP  YY+   VK N +N + +   S  ++ Y +  P  ++ ++F +   DI F IY      E +    K  +  EVL   +  +++  E G +  T+ G Y++ FDN+YS++ +K + Y +E+L
Sbjct:   11 KQEEALVKFRENVKDLMPRLPPFSQDDYFLLRWLRG------ECSWEGNKNVEFRKQMDSDNVLEKWQPPEVVQKYLSGGLCGHDREDSPIWYDVIGPLDPKGLLFSASKQDLMKTKMRDCEVLHHACRMQSEKLGKR-VEDVVMIYDVEGLGLKHLWKPAVELYGEILQMFEDNYPEALKRLFVIKAPKLFPVAYNLIKHFLSEDTRRKIMVLGDNWQDVLKKYIAPEELPQYYGGTLTDPDGDPKCKSKINYGGDIPKKYYVRDQVKQNYENTLNINRGSSQQMEYEILFPSCVLRWQFQSDGADIGFGIYRKTKAGERQ----KAGEMVEVLANQRYNAHMVPEDGTMTCTEPGTYVLRFDNTYSFIHAKKVSYTVEVL 381          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Xenopus
Match: cldn8.4 (claudin 8, gene 4 [Source:Xenbase;Acc:XB-GENE-991592])

HSP 1 Score: 241.891 bits (616), Expect = 3.612e-75
Identity = 130/382 (34.03%), Postives = 217/382 (56.81%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWR--PQFADENY-ILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVK-NIQN-ITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K  E +++ + NVKD+    P F+ ++Y +L+WL+       +       ++ +R++   D +LE +Q P+V  KY  GG CGHD+E  PIW + +G LDP+G L S   +D+ K ++   E L+     Q  K  +R +   + ++D+E  GLKHLW+PA+E   E  ++ E NYPE++ +L +   P LF +AYNL+K FL   T++K+ +LG N+++ L K I  ++LP Y GG +  P+GDP+C   I +GG IP  YY+   VK N +N + +   S  ++ Y +  P  ++ ++F +   DI F IY      E +    K  +  EVL   +  +++  E G +  T+ G Y++ FDN+YS++ +K + Y +E+L
Sbjct:   11 KQEEALVKFRENVKDLMPRLPPFSQDDYFLLRWLRG------ECSWEGNKNVEFRKQMDSDNVLEKWQPPEVVQKYLSGGLCGHDREDSPIWYDVIGPLDPKGLLFSASKQDLMKTKMRDCEVLHHACRMQSEKLGKR-VEDVVMIYDVEGLGLKHLWKPAVELYGEILQMFEDNYPEALKRLFVIKAPKLFPVAYNLIKHFLSEDTRRKIMVLGDNWQDVLKKYIAPEELPQYYGGTLTDPDGDPKCKSKINYGGDIPKKYYVRDQVKQNYENTLNINRGSSQQMEYEILFPSCVLRWQFQSDGADIGFGIYRKTKAGERQ----KAGEMVEVLANQRYNAHMVPEDGTMTCTEPGTYVLRFDNTYSFIHAKKVSYTVEVL 381          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Xenopus
Match: cldn8.4 (claudin 8, gene 4 [Source:Xenbase;Acc:XB-GENE-991592])

HSP 1 Score: 238.424 bits (607), Expect = 2.780e-74
Identity = 126/362 (34.81%), Postives = 203/362 (56.08%), Query Frame = 3
Query:  159 PQFADENY-ILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVK-NIQN-ITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            P F+ ++Y +L+WL+AR F+++K+E MLR                      V  KY  GG CGHD+E  PIW + +G LDP+G L S   +D+ K ++   E L+     Q  K  +R +   + ++D+E  GLKHLW+PA+E   E  ++ E NYPE++ +L +   P LF +AYNL+K FL   T++K+ +LG N+++ L K I  ++LP Y GG +  P+GDP+C   I +GG IP  YY+   VK N +N + +   S  ++ Y +  P  ++ ++F +   DI F IY      E +    K  +  EVL   +  +++  E G +  T+ G Y++ FDN+YS++ +K + Y +E+L
Sbjct:    5 PPFSQDDYFLLRWLRARSFNLQKAENMLRK---------------------VVQKYLSGGLCGHDREDSPIWYDVIGPLDPKGLLFSASKQDLMKTKMRDCEVLHHACRMQSEKLGKR-VEDVVMIYDVEGLGLKHLWKPAVELYGEILQMFEDNYPEALKRLFVIKAPKLFPVAYNLIKHFLSEDTRRKIMVLGDNWQDVLKKYIAPEELPQYYGGTLTDPDGDPKCKSKINYGGDIPKKYYVRDQVKQNYENTLNINRGSSQQMEYEILFPSCVLRWQFQSDGADIGFGIYRKTKAGERQ----KAGEMVEVLANQRYNAHMVPEDGTMTCTEPGTYVLRFDNTYSFIHAKKVSYTVEVL 340          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Xenopus
Match: cldn8.4 (claudin 8, gene 4 [Source:Xenbase;Acc:XB-GENE-991592])

HSP 1 Score: 236.113 bits (601), Expect = 3.051e-73
Identity = 124/362 (34.25%), Postives = 206/362 (56.91%), Query Frame = 3
Query:  159 PQFADENY-ILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVK-NIQN-ITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            P F+ ++Y +L+WL+       +       ++ +R++   D +LE +Q P+V  KY  GG CGHD+E  PIW + +G LDP+G L S   +D+ K ++   E L+     Q  K  +R +   + ++D+E  GLKHLW+PA+E   E  ++ E NYPE++ +L +   P LF +AYNL+K FL   T++K+ +LG N+++ L K I  ++LP Y GG +  P+GDP+C   I +GG IP  YY+   VK N +N + +   S  ++ Y +  P  ++ ++F +   DI F IY      E +    K  +  EVL   +  +++  E G +  T+ G Y++ FDN+YS++ +K + Y +E+L
Sbjct:    7 PPFSQDDYFLLRWLRG------ECSWEGNKNVEFRKQMDSDNVLEKWQPPEVVQKYLSGGLCGHDREDSPIWYDVIGPLDPKGLLFSASKQDLMKTKMRDCEVLHHACRMQSEKLGKR-VEDVVMIYDVEGLGLKHLWKPAVELYGEILQMFEDNYPEALKRLFVIKAPKLFPVAYNLIKHFLSEDTRRKIMVLGDNWQDVLKKYIAPEELPQYYGGTLTDPDGDPKCKSKINYGGDIPKKYYVRDQVKQNYENTLNINRGSSQQMEYEILFPSCVLRWQFQSDGADIGFGIYRKTKAGERQ----KAGEMVEVLANQRYNAHMVPEDGTMTCTEPGTYVLRFDNTYSFIHAKKVSYTVEVL 357          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Mouse
Match: Sec14l2 (SEC14-like lipid binding 2 [Source:MGI Symbol;Acc:MGI:1915065])

HSP 1 Score: 261.536 bits (667), Expect = 5.743e-83
Identity = 135/382 (35.34%), Postives = 228/382 (59.69%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFA--DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIAL-FDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K  E + + + NV+D+  P     D+ ++L+WL+AR FD++KSE MLR H+ +R+++ ID I+  +Q P+V  +Y  GG CG+D +G P+W + +G LD +G L S   +D+ + ++   E L +  + Q +K  ++  ++TI + +D E  GLKHLW+PA+E   E   + E NYPE++ +L +   P LF +AYNL+KPFL   T++K+ +LG+N+KE LLK I  DQLP   GG M  P+G+P+C   I +GG IP  YY+   VK      + V   S  ++ Y +  P  ++ ++F ++  D+ F I+    + E +    +  +  EVL   +  S++  E G +  ++ G Y++ FDN+YS++ +K + + +E+L
Sbjct:   11 KQEEALAKFRENVQDVL-PTLPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDKIIS-WQPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRDCELLLQECIQQTTKLGKK--IETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGANWKEVLLKHISPDQLPVEYGGTMTDPDGNPKCKSKINYGGDIPKQYYVRDQVKQQYEHTVQVSRGSSHQVEYEILFPGCVLRWQFMSEGSDVGFGIFLKTKMGERQ----RAGEMTEVLPNQRYNSHMVPEDGTLTCSEPGIYVLRFDNTYSFIHAKKVSFTVEVL 384          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Mouse
Match: Sec14l4 (SEC14-like lipid binding 4 [Source:MGI Symbol;Acc:MGI:2144095])

HSP 1 Score: 259.61 bits (662), Expect = 3.928e-82
Identity = 136/385 (35.32%), Postives = 225/385 (58.44%), Query Frame = 3
Query:   93 LCPQKVSELILELQNNVKDIWRPQF--ADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            L PQ+  E +   +  ++D+  P    AD+ ++L+WL+AR+FD+KKSE MLR H+ +R ++ +D IL  +Q P+V   Y  GG  G+D EG P+W + +G +DP+G   S   +D+ + R+ + E L      Q S++  R I + + +FDME   L+HLW+PA+E   +   ++EANYPE++  LII   P LF +A+NLVK F+   TQ+K+ ILG N+K+EL+K +  DQLP   GG M  P+G+P+C   I +GG++P  YYL+   +     ++ V   S  ++   +  P  ++ ++F++   DI F ++    + E +    K  +  EVL   +  +++  E G +   K G Y++ FDN+YS + +K + Y  E+L
Sbjct:    8 LSPQQ-QEALARFRETLQDLL-PTLPKADDYFLLRWLRARNFDLKKSEDMLRKHVEFRNQQNLDQIL-TWQAPEVIQLYDSGGLSGYDYEGCPVWFDIIGTMDPKGLFMSASKQDMIRKRIKVCEMLLHECELQ-SQKLGRKIERMVMVFDMEGLSLRHLWKPAVEVYQQFFAILEANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKIVILGGNWKQELVKFVSPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKRYYLSNQERPQYEHSVVVGRGSSHQVENEILFPGCVLRWQFASDGGDIGFGVFLKTRMGERQ----KAGEMVEVLPSQRYNAHMVPEDGSLNCLKAGVYVLRFDNTYSLLHTKKVGYTAEVL 384          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Mouse
Match: Sec14l3 (SEC14-like lipid binding 3 [Source:MGI Symbol;Acc:MGI:3617848])

HSP 1 Score: 256.529 bits (654), Expect = 6.377e-81
Identity = 134/382 (35.08%), Postives = 228/382 (59.69%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFA--DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSN-YKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K +E + + + NV+D+  P     D+ ++L+WL+AR+FD++KSE MLR ++ +R+   ID IL D+Q P+V  KY  GG CG+D++G P+W + +G LDP+G L S+  +D+ K ++   E +      Q ++   R I   + +FD E  GLKH W+P +E   E   L+E NYPE++  ++I     LF + YNL+KPFL   T++K+ +LGSN +KE LLK+I  ++LP + GG +  P+G+P+C   I +GG+IP S Y+   VK     ++ +   S  ++ Y +  P  ++ ++FS+   DI F ++    + E +    K  +  EVL   +  +++  E G +  ++ G Y++ FDN+YS+V +K + + +E+L
Sbjct:   11 KQAETLAKFRENVQDVL-PALPNPDDYFLLRWLRARNFDLQKSEAMLRKYMEFRKTMDIDHIL-DWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILHECDLQ-TERLGRKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGSNSWKEGLLKLISPEELPAHFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFLKTKMGERQ----KAGEMVEVLTSQRYNAHMVPEDGSLTCSEAGVYVLRFDNTYSFVHAKKVSFTVEVL 385          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Mouse
Match: Sec14l1 (SEC14-like lipid binding 1 [Source:MGI Symbol;Acc:MGI:1921386])

HSP 1 Score: 146.747 bits (369), Expect = 1.108e-37
Identity = 96/328 (29.27%), Postives = 176/328 (53.66%), Query Frame = 3
Query:   93 LCPQKVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSI-LGSNYKEE--LLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYL------NKHVKNIQNITVKAKSKIK------LSYLVNSPESLIYYEFSTKEHDINFAIYY 1031
            L P + S LI  L+  +++  + +   + +IL++L+ARDF+I K+  ++   ++WR++ ++D IL+ +  P V   Y  GG+  HDK+GRP+++  LG +D +G +++L  + + +  + I E   +    + +K   RPI     L D+E   ++HLWRP ++  +   +++EANYPE++ +L+I   P +F + + LV PF+   T++K  I  G++Y+    LL  ID + +P +L G          C   +  GG +P S Y       N+ +K       ++ S  K      L  +V++  S+I ++F   + DI F IY+
Sbjct:  251 LTPLQESCLI-RLRQWLQETHKGKIPKDEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLLDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRR-CEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGE---------CMCDVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILIQIVDA-SSVITWDFDVCKGDIVFNIYH 566          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Mouse
Match: Sec14l5 (SEC14-like lipid binding 5 [Source:MGI Symbol;Acc:MGI:3616084])

HSP 1 Score: 146.362 bits (368), Expect = 1.156e-37
Identity = 87/329 (26.44%), Postives = 177/329 (53.80%), Query Frame = 3
Query:   93 LCPQKVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSIL-GSNYKEE--LLKIIDSDQLPTYLGG-NMCGPNGDPRCSHLIRWGGQIPISYYLNKH-----------VKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYV 1034
            L P + S L+ +L++ +++  + +   + +IL++L+ARDF + K+  ML   +SWR++ ++D +L+ ++ P    ++  GG+   D +GRP+++  LG +D +G +K++  + + +  + + E   K      +++  RPI     L D+E   ++HLWRP ++  +   +++E NYPE++ +L+I   P +F + + LV PF+   T++K  I  GSNY+    L+  +D D +P +LGG ++C           +  GG +P S YL +             +   + +V   +  +++  +   ES+I ++F     D+ F++Y+ 
Sbjct:  238 LSPMQESCLV-QLRHWLQETHKGKIPKDEHILRFLRARDFHLDKARDMLCQSLSWRKQHQVDLLLQTWRPPPPLQEFYAGGWHYQDIDGRPLYILRLGQMDTKGLMKAVGEEALLQHVLSVNEEGQKR-CEGNTRQFGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLVSPFINENTRRKFLIYSGSNYQGPGGLVDYLDKDVIPDFLGGESVCN----------VPEGGMVPKSLYLTEEEQEQADQLQQWSETYHSASVLRGTPYEVAMEIPEGESVITWDFDILRGDVVFSLYHA 554          
BLAST of SEC14-like lipid binding 8 vs. UniProt/SwissProt
Match: sp|P58875|S14L2_BOVIN (SEC14-like protein 2 OS=Bos taurus OX=9913 GN=SEC14L2 PE=1 SV=2)

HSP 1 Score: 270.396 bits (690), Expect = 1.883e-85
Identity = 140/381 (36.75%), Postives = 226/381 (59.32%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFA--DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K  E + + + NV+D+  P     D+ ++L+WL+AR+F+++KSE MLR H+ +R+++ ID I+  +Q P+V  +Y  GG CG+D EG PIW + +G LD +G L S   +D++K ++   E L +  + Q  K  ++ I  T  ++D E  GLKHLW+PA+E   E   + E NYPE++ +L I   P LF +AYNLVKPFL   T++K+ +LG+N+KE LLK I  DQLP   GG M  P+G+P+C   I +GG IP  YY+   VK     ++ +   S  ++ Y +  P  ++ ++F +   DI F I+    V E +    +  +  EVL   +  ++L  E G +  +  G Y++ FDN+YS++ +K + + +E+L
Sbjct:   11 KQKEALAKFRENVQDVL-PALPNPDDYFLLRWLRARNFNLQKSEAMLRKHVEFRKQKDIDNIMS-WQPPEVVQQYLSGGMCGYDLEGSPIWYDIIGPLDAKGLLLSASKQDLFKTKMRDCELLLQECVRQTEKMGKK-IEATTLIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFIVKAPKLFPVAYNLVKPFLSEDTRKKIQVLGANWKEVLLKYISPDQLPVEYGGTMTDPDGNPKCKSKINYGGDIPKKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGSDIGFGIFLKTKVGERQ----RAGEMREVLPSQRYNAHLVPEDGSLTCSDPGIYVLRFDNTYSFIHAKKVSFTVEVL 384          
BLAST of SEC14-like lipid binding 8 vs. UniProt/SwissProt
Match: sp|Q99J08|S14L2_MOUSE (SEC14-like protein 2 OS=Mus musculus OX=10090 GN=Sec14l2 PE=1 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 4.017e-82
Identity = 135/382 (35.34%), Postives = 228/382 (59.69%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFA--DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIAL-FDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K  E + + + NV+D+  P     D+ ++L+WL+AR FD++KSE MLR H+ +R+++ ID I+  +Q P+V  +Y  GG CG+D +G P+W + +G LD +G L S   +D+ + ++   E L +  + Q +K  ++  ++TI + +D E  GLKHLW+PA+E   E   + E NYPE++ +L +   P LF +AYNL+KPFL   T++K+ +LG+N+KE LLK I  DQLP   GG M  P+G+P+C   I +GG IP  YY+   VK      + V   S  ++ Y +  P  ++ ++F ++  D+ F I+    + E +    +  +  EVL   +  S++  E G +  ++ G Y++ FDN+YS++ +K + + +E+L
Sbjct:   11 KQEEALAKFRENVQDVL-PTLPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDKIIS-WQPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRDCELLLQECIQQTTKLGKK--IETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGANWKEVLLKHISPDQLPVEYGGTMTDPDGNPKCKSKINYGGDIPKQYYVRDQVKQQYEHTVQVSRGSSHQVEYEILFPGCVLRWQFMSEGSDVGFGIFLKTKMGERQ----RAGEMTEVLPNQRYNSHMVPEDGTLTCSEPGIYVLRFDNTYSFIHAKKVSFTVEVL 384          
BLAST of SEC14-like lipid binding 8 vs. UniProt/SwissProt
Match: sp|Q99MS0|S14L2_RAT (SEC14-like protein 2 OS=Rattus norvegicus OX=10116 GN=Sec14l2 PE=1 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 9.088e-82
Identity = 134/382 (35.08%), Postives = 228/382 (59.69%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFA--DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIAL-FDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K  E + + + NV+D+  P     D+ ++L+WL+AR FD++KSE MLR H+ +R+++ ID I+  +Q P+V  +Y  GG CG+D +G P+W + +G LD +G L S   +D+ + ++   E L +    Q +K  ++  ++TI + +D E  GLKHLW+PA+E   E   + E NYPE++ +L +   P LF +AYNL+KPFL   T++K+ +LG+N+KE LLK I  DQLP   GG M  P+G+P+C   I +GG IP  YY+   VK     ++ +   S  ++ Y +  P  ++ ++F ++  D+ F I+    + E +    +  +  EVL   +  S++  E G +  ++ G Y++ FDN+YS++ +K + + +E+L
Sbjct:   11 KQEEALAKFRENVQDVL-PALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDKIIS-WQPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRDCELLLQECTQQTAKLGKK--IETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQLPVEYGGTMTDPDGNPKCKSKINYGGDIPKQYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSEGSDVGFGIFLKTKMGERQ----RAGEMTEVLPNQRYNSHMVPEDGTLTCSEPGIYVLRFDNTYSFIHAKKVSFTVEVL 384          
BLAST of SEC14-like lipid binding 8 vs. UniProt/SwissProt
Match: sp|Q9UDX3|S14L4_HUMAN (SEC14-like protein 4 OS=Homo sapiens OX=9606 GN=SEC14L4 PE=1 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 1.046e-81
Identity = 137/385 (35.58%), Postives = 228/385 (59.22%), Query Frame = 3
Query:   93 LCPQKVSELILELQNNVKDIWRPQF--ADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVK--NIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            L PQ+  E +   + N++D+  P    AD+ ++L+WL+AR+FD++KSE MLR H+ +R+++ +D I+  +Q P+V   Y  GG CG+D EG P++   +G LDP+G L S   +D+ + R+ + E L      Q +++  R I   + +FDME   LKHLW+PA+E   +   ++EANYPE++  LI+   P LF +A+NLVK F+   T++K+ ILG N+K+EL K I  DQLP   GG M  P+G+P+C   I +GG++P SYYL + V+       +V   S +++   +  P  ++ ++F++   DI F ++    + E +       +  EVL   +  +++  E G +   + G Y++ FDN+YS + +K L Y +E+L
Sbjct:    8 LSPQQ-QEALARFRENLQDLL-PILPNADDYFLLRWLRARNFDLQKSEDMLRRHMEFRKQQDLDNIVT-WQPPEVIQLYDSGGLCGYDYEGCPVYFNIIGSLDPKGLLLSASKQDMIRKRIKVCELLLHECELQ-TQKLGRKIEMALMVFDMEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNLVKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGEQQ----SAREMTEVLPSQRYNAHMVPEDGSLTCLQAGVYVLRFDNTYSRMHAKKLSYTVEVL 384          
BLAST of SEC14-like lipid binding 8 vs. UniProt/SwissProt
Match: sp|Q9Z1J8|S14L3_RAT (SEC14-like protein 3 OS=Rattus norvegicus OX=10116 GN=Sec14l3 PE=1 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 2.412e-81
Identity = 133/381 (34.91%), Postives = 228/381 (59.84%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFA--DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K +E + + + NV+D+  P     D+ ++L+WL+AR+FD++KSE MLR ++ +R+   ID IL D+Q P+V  KY  GG CG+D++G P+W + +G LDP+G L S+  +D+ K ++   E +      Q ++   R I   + +FD E  GLKH W+P +E   E   L+E NYPE++  ++I     LF + YNL+KPFL   T++K+ +LG+++KE LLK+I  ++LP + GG +  P+G+P+C   I +GG+IP S Y+   VK     ++ +   S  ++ Y +  P  ++ ++FS+   DI F ++    + E +    K  +  EVL   +  +++  E G +  T+ G Y++ FDN+YS+V +K + + +E+L
Sbjct:   11 KQAETLAKFRENVQDVL-PALPNPDDYFLLRWLRARNFDLQKSEAMLRKYMEFRKTMDIDHIL-DWQPPEVIQKYMPGGLCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKTKMRDCERILHECDLQ-TERLGRKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGNSWKEGLLKLISPEELPAHFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFLKTKMGERQ----KAGEMTEVLTSQRYNAHMVPEDGSLTCTEAGVYVLRFDNTYSFVHAKKVSFTVEVL 384          
BLAST of SEC14-like lipid binding 8 vs. TrEMBL
Match: A0A2C9JYA2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106072750 PE=4 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 3.567e-101
Identity = 159/380 (41.84%), Postives = 236/380 (62.11%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQNI---TVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K + ++ E + NV D+ +P   D+ Y+L+WL+AR FD+KKSE MLRNH  WRE   +DTILEDFQ P+V  KY  GG  G DKEG  IW++P G++D +G L S+  +DI K ++ ++E  YK L    S+++ R + Q + LFD+E FGLKHLW+P ++   +   + E NYPE++ +  + N P +F IA+NL+KPFL   T +KV+I G+NYKE LL+ ID+DQLP + GG    P+G+PRC   I  GG++P SYY   ++ ++      TV   S ++L + ++   S + ++F T   DI F IY       +E +  K    E ++   KV S++  E+G +     G Y++ FDN++SWV+SK L Y IEIL
Sbjct:   11 KQAAILEEFRQNVSDLLKPHH-DDYYLLRWLRARKFDLKKSEAMLRNHFRWREENNVDTILEDFQPPEVMKKYYPGGLFGQDKEGSLIWVDPTGYIDLKGLLMSIKKQDILKSKIQLLEEFYK-LFDILSEKQGRRVDQIVILFDLEKFGLKHLWKPGIDVFTDILTIFEDNYPETLKRTYVLNAPRVFPIAFNLIKPFLSEETVRKVTICGANYKEVLLQHIDADQLPAHWGGTCVDPDGNPRCPSKINPGGEVPKSYYQQNNIVDLTGFTEATVGRGSSLQLDFSIDEVGSALRWQFKTDGFDIGFGIYR-----RTEDKKQKAGDMEPIITSQKVNSHMFPEEGSMHCKHPGTYIVRFDNTHSWVRSKKLYYLIEIL 383          
BLAST of SEC14-like lipid binding 8 vs. TrEMBL
Match: A0A0B6Z7E2 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF51358 PE=4 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 1.563e-100
Identity = 153/381 (40.16%), Postives = 241/381 (63.25%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQN---ITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILD 1238
            K +  + E +  ++DI +P   D+ ++L++L+AR+FD KKSE MLRNH+ WRE+   DTIL+DF+ P+V  KY  GG  G DKEG  +W+EP+G LD +G L S+  +D+ + +  ++E++Y+     +SKE+ R + Q + LFD+E FG+KHLW+P M+  IE   L E +YPE++ +  IFN P +F IAY+L++PFL  AT +KV I G+NYKE LL+ I++DQLP   GG+   P+G+PRC   I  GG +P +YY    + ++ +   +++   S ++L Y+++ P S I ++F T   DI F +Y     L +     K    E +L   +V S++  E G +   + G Y++ FDN+YS+V++K L Y IE+L+
Sbjct:   11 KQAAALSEFKECIQDIRKPHH-DDYFLLRFLRARNFDYKKSEVMLRNHMRWREQNNADTILQDFEPPEVMRKYYTGGLFGQDKEGSFLWVEPMGHLDIKGILMSMRKQDVIRSKTWLMEDIYRQF-AIKSKEQGRRVDQIVILFDLEKFGMKHLWKPGMDVFIEIVSLFEDHYPETLKRTFIFNAPRIFPIAYSLIRPFLSEATHKKVMICGANYKEVLLQYIEADQLPKQWGGSCVDPDGNPRCPSKIVPGGDVPHTYYRQNDLTDMTDFAEVSIGRGSSLQLDYVIDKPNSAIRWQFKTDGFDIGFGVY-----LRTTDHRQKAVDMEPILPSQRVNSHMVPEDGSVTCRRTGIYVVRFDNTYSFVRTKKLYYQIEVLE 384          
BLAST of SEC14-like lipid binding 8 vs. TrEMBL
Match: A0A1S3H0K5 (SEC14-like protein 2 OS=Lingula unguis OX=7574 GN=LOC106150969 PE=4 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 8.833e-97
Identity = 153/381 (40.16%), Postives = 237/381 (62.20%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNK----HVKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K S+L+ + + NV DI  P+  D++++L+WL+AR FD+KKSE MLRNH++WR++   DTILED  +P+V   Y  GG+CG DKEG P+W++P+G LD +G   S   +DI K ++  VE  Y+ ++  +SK+  + + Q   +FDME FG+KHLW+P ++   E  ++ E+NYPE++ +  + N P +F +AY++VKP L   T+ K+ +LGSN+KE +L+ ID +++P Y GG    P+G+P C   +  GG++P SYYL +      + +    +K  S + +   VN P   I +EF T+ HDI +AIYY     E  +     S  E V+   +V S+L  E G +  +K G Y+  FDNSYSW +SK + Y IE++
Sbjct:   11 KQSQLLEKFRLNVSDILEPKH-DDHFLLRWLRARCFDLKKSEAMLRNHLAWRKKVGADTILEDCVLPEVITTYYAGGWCGFDKEGDPVWVDPVGRLDLKGIAHSAKKEDIIKSKIMCVERGYR-MMADQSKKLGKRVSQLCIIFDMEGFGMKHLWKPGVDIFCEILEMFESNYPETLKRCYVINAPKIFPLAYHIVKPILSEDTKNKIKVLGSNWKERVLRDIDPNEIPLYWGGTRTDPDGNPFCKSKVCIGGEVPKSYYLREKDQLSSEYLVKSVIKKGSMLPVELEVNEPGCAIRWEFHTENHDIGYAIYYKTSPGEQNV-----SDMEVVVGNKRVNSHLVPEDGTVYCSKAGIYVFCFDNSYSWTRSKTVLYVIEVI 384          
BLAST of SEC14-like lipid binding 8 vs. TrEMBL
Match: K1R1F6 (SEC14-like protein 2 OS=Crassostrea gigas OX=29159 GN=CGI_10023256 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.914e-95
Identity = 148/379 (39.05%), Postives = 230/379 (60.69%), Query Frame = 3
Query:  114 ELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYY----LNKHVKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILD 1238
            + + + +  +KD+ +P   D+ Y+L+WL+ARDFD+ KSETMLRNH SWR+REK++ I  D++ P+V  KY  GG  G D +G P+W++P G +D +G LKS    DI K +V ++E L+       SK++ + +   I L+D+   G+KHL++P ++   E   + E +YPE++   I+ N P  F IAYN+VKPFL  AT +K  ILG+NY + L + I  +QLP   GG    P+G+P C   I  GG++P+SYY    L+  + N   ++V   S +++   V    S I ++FST+ +DI F +Y       +  +  K S+ EEV+  H+V S+L  E G +  T+ G Y++ FDN+YSW K+K L Y +E+L+
Sbjct:   14 DCLQKFKERLKDVLKPGH-DDYYLLRWLRARDFDLNKSETMLRNHFSWRKREKLENI-ADWECPEVIQKYFTGGLFGVDVDGCPVWIDPFGQIDLKGMLKSAKKADIIKAKVQLLEKLHSETFSDLSKQKGQRVESLIILYDLAKLGMKHLYKPGVDAYCEMITMFEDHYPETLKYAIVINAPRFFPIAYNIVKPFLSEATAKKTIILGTNYHDTLYRYISPEQLPVCYGGKRTDPDGNPTCRSQIGQGGEVPLSYYKQQMLSADIDNAVCVSVGRGSSLQVECEVAVKNSAIRWQFSTQGYDIGFGVYR-----RTTGERQKASKMEEVVPTHRVNSHLVPEDGSVTCTEAGTYVLRFDNTYSWTKAKRLHYLVEVLE 385          
BLAST of SEC14-like lipid binding 8 vs. TrEMBL
Match: V3ZK42 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_163396 PE=4 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 2.271e-93
Identity = 148/380 (38.95%), Postives = 222/380 (58.42%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLN--KHVKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILD 1238
            K ++++ + + NVKDI +P   D+ ++ KWL+ARDFD++K+E  +RN  +WR    +DTILED+++P+V +KY VGG CG DKEG PIW++  G LD +G L S   +DI K +VH++E +  N+  + S  E R +   + + D+E  G+KHLW+P M+       + E +YPE++      N P +F I YNL +PFL   T +KV +LG++YK+ LLK ID DQLP Y GG    P+G+P+C  LI  GG IP SY+ N    +     + +   S ++L Y +    S+I Y+F T   D+ F IY       +  +         V+   +V S+L  E G     + G Y++ FDN+YSW + K L Y IEIL+
Sbjct:   11 KQADILGKFKENVKDILKPNH-DDYHLTKWLRARDFDLQKAEAAIRNDAAWRNDNNVDTILEDYKVPEVIEKYFVGGICGRDKEGCPIWIDTFGDLDIRGMLCSAKKQDILKSKVHLLERI-NNIFTEESTPERR-VEGLVVIIDLEKMGMKHLWKPGMDMMNSILAMFEEHYPETLKISFAINAPRIFPIIYNLARPFLNENTIKKVHVLGADYKQVLLKYIDPDQLPVYWGGTKTDPDGNPKCPSLINLGGDIPSSYFCNVLNDLDGFTQVDIGRGSSLQLDYEITVKRSVIRYQFKTDGFDLGFGIYR-----RTRNKRQSAGDMAAVMASERVNSHLVPEDGSFTCKETGTYVVRFDNTYSWTRGKKLFYLIEILE 382          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Cavefish
Match: sec14l8 (SEC14-like protein 2 [Source:NCBI gene;Acc:103022567])

HSP 1 Score: 268.855 bits (686), Expect = 9.467e-86
Identity = 133/382 (34.82%), Postives = 228/382 (59.69%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFADE--NYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQ---NITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            + +E + + +  ++D+  PQ   +  +++L+WL+AR+F+++KSE MLR H+ +R+  K DTI  D++ P+  DKY  GG CG+D+EG P+W + +G +DP+G L S   +D  K +V   E L K    Q+S+   + +     ++D E  GLKHLW+PA++   E   + E NYPE + +L++   P LF +AYNLVK FL   T+ K+ ILGSN+++ L K ID ++LP   GG +  P+GDPRC   I+ GG +P SYY  + +K +Q   ++++   S  ++ Y + +P  ++ ++F  +  D+ F ++    + E     +K  Q +EV+   +  ++L  E G +   + G Y++ FDN+YS  +SK + + +E+L
Sbjct:   11 RQAEALAQFREKIQDVL-PQCPSQTDHFLLRWLRARNFNVQKSEAMLRKHLEFRKHMKADTITADWKPPEAIDKYLSGGMCGYDREGSPVWYDVIGPVDPKGLLLSASKQDFIKCKVRDCEMLQKEC-EQQSQRLGKNVESITMIYDCEGLGLKHLWKPAIDLYGEVLTMFEDNYPEGLKRLLVIKAPKLFPVAYNLVKHFLSEDTRHKIMILGSNWQDVLRKYIDPEELPAVYGGKLTDPDGDPRCRTRIKQGGLVPQSYYAREFIK-VQYDHSVSISRGSSHQMEYEILAPGCVLRWQFCCEGADVGFGVFLKKRLGEW----MKAGQMQEVVPSQRYNAHLVPEDGTLTCAEAGVYVLRFDNTYSIFQSKKVSFTVEVL 385          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Cavefish
Match: sec14l8 (SEC14-like protein 2 [Source:NCBI gene;Acc:103022567])

HSP 1 Score: 238.039 bits (606), Expect = 1.008e-73
Identity = 128/394 (32.49%), Postives = 217/394 (55.08%), Query Frame = 3
Query:  111 SELILELQNNVKDIWRPQFADENYILKWLKARDFDIK---KSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQ---NITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQN-LKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILDIMKTEHRDNKK 1271
            +E + + +  ++D+  PQ   +      LK+    +K   K       H+ +R+  K DTI  D++ P+  DKY  GG CG+D+EG P+W + +G +DP+G L S   +D  K +V   E L K    Q+S+   + +     ++D E  GLKHLW+PA++   E   + E NYPE + +L++   P LF +AYNLVK FL   T+ K+ ILGSN+++ L K ID ++LP   GG +  P+GDPRC   I+ GG +P SYY  + +K +Q   ++++   S  ++ Y + +P  ++ ++F  +  D+ F ++     L+  +   +K  Q +EV+   +  ++L  E G +   + G Y++ FDN+YS  +SK + + +E+L   K    + KK
Sbjct:   13 AEALAQFREKIQDVL-PQCPSQTDHFLLLKSFYLSVKQGLKQSPFTLQHLEFRKHMKADTITADWKPPEAIDKYLSGGMCGYDREGSPVWYDVIGPVDPKGLLLSASKQDFIKCKVRDCEMLQKEC-EQQSQRLGKNVESITMIYDCEGLGLKHLWKPAIDLYGEVLTMFEDNYPEGLKRLLVIKAPKLFPVAYNLVKHFLSEDTRHKIMILGSNWQDVLRKYIDPEELPAVYGGKLTDPDGDPRCRTRIKQGGLVPQSYYAREFIK-VQYDHSVSISRGSSHQMEYEILAPGCVLRWQFCCEGADVGFGVF-----LKKRLGEWMKAGQMQEVVPSQRYNAHLVPEDGTLTCAEAGVYVLRFDNTYSIFQSKKVSFTVEVLLPSKFRDENTKK 398          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Cavefish
Match: sec14l7 (SEC14-like lipid binding 7 [Source:ZFIN;Acc:ZDB-GENE-141216-145])

HSP 1 Score: 204.142 bits (518), Expect = 5.070e-62
Identity = 108/310 (34.84%), Postives = 171/310 (55.16%), Query Frame = 3
Query:  309 VFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIAL-FDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            V +KY  GG CG+D+EG PIW + +G LDP+G L S   +D  + +V   E L +    QR  ++    +++I + +D E  GLKH+++PA+E   E   + E NYPE + ++++   P +F IAYNL+K FL   T++K+ ++GSN+KE L K +D DQLP   GG    P+GDP C  +I +GG +P SYY+              +   KL Y V  P  L+ ++F++   DI F IY        +    K  + +EVL   +  ++L  E G       G Y++ FDN+YS + SK + + ++++
Sbjct:    5 VIEKYVSGGLCGYDREGSPIWYDVIGPLDPKGLLMSASKQDFLRTKVRDSEVLRREC--QRQTDKLGKYIESITMIYDCEGLGLKHMYKPAIETYGEVLTMFEDNYPEGLKRVLVIKAPKIFPIAYNLIKHFLCEETRRKIVVVGSNWKEVLQKYVDPDQLPEAYGGTRKDPDGDPYCKSMINYGGNVPKSYYV--------------RESFKLEYEVLIPNCLLRWQFASDGADIGFGIYMKTKAGAKQ----KIGEMQEVLPTQRYNAHLVPEDGSYTCEDPGIYVLRFDNTYSMLHSKKISFSVDVV 294          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Cavefish
Match: ENSAMXT00000012900.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:343085:366086:-1 gene:ENSAMXG00000012521.2 transcript:ENSAMXT00000012900.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 5.217e-43
Identity = 102/333 (30.63%), Postives = 176/333 (52.85%), Query Frame = 3
Query:   93 LCPQKVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEE-----RPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSIL-GSNY--KEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLN----KHVKNI--------QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYY 1031
            L P + S LI +L+ +++   R +   + +IL++L+ARDF+++K+  ML   +SWR   ++D+IL+ +  P    +Y  GG+   D+EGRP+++  LG +D +G +K+L  + + +  + I E        QR  EE      +PI     L D+E   ++HLWRP ++  +   +++EANYPE++ +L+I   P +F + + LV PF+   T+QK  +  GSNY     L+  I S+ +P +LGG+         C   +  GGQ+P SYY      +H  +I        Q+  V   +  ++   V    S+I ++F     DI F I++
Sbjct:  237 LTPMQESCLI-QLRASLQQTHRGKIPKDEHILRFLRARDFNVEKARDMLYQSLSWRTEFQVDSILDSWTPPSCLKEYYAGGWHHQDREGRPLYILRLGHMDTKGLVKALGEESLLRHVLSINEE------GQRRCEENTKIFGQPITSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLIVRAPRVFPVLWTLVSPFINENTRQKFLVYSGSNYLGSGGLVDYIHSEIIPDFLGGD---------CLCEVPEGGQVPKSYYQTEVELEHADHIRLWTDSIYQSAQVSRGAPHEVMMEVVEESSVITWDFDILRGDIVFNIFH 553          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Cavefish
Match: si:dkey-237i9.1 (SEC14-like protein 1 [Source:NCBI gene;Acc:103027714])

HSP 1 Score: 144.436 bits (363), Expect = 5.241e-37
Identity = 83/318 (26.10%), Postives = 173/318 (54.40%), Query Frame = 3
Query:  120 ILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSI-LGSNYKEE--LLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLN-KHVKN----------IQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYY 1031
            ++ L++ +++  + +   + +IL++L+ARDF++ K+  +L   ++WR++ ++D +L+ +  P V   Y  GG+  HD++GRP+++  LG +D +G +++L  + + +  + I E   +    + +K   RPI     L D+E   ++HLWRP ++  +   +++EANYPE++ +L+I   P +F + + LV PF+   T++K  I  G++Y+    L+  ID + +P +LGG          C   +  GG +P + Y   + ++N           Q+ ++   +  +L   +    S++ ++F   + D+ F IY+
Sbjct:  261 LIRLRSWLQETHKGKIPKDQHILRFLRARDFNMDKAREILCQSLTWRKQHQVDYLLDTWTSPQVLHDYYTGGWHHHDRDGRPLYILRLGQMDTKGLVRALGEESLLRHVLSINEEGLRR-CEENTKVFGRPISCWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDENTRKKFLIYAGNDYQGPGGLVDYIDKEIIPDFLGGE---------CMCEVPEGGLVPKTLYRTPEELENDDIRLWTETIYQSASIFKGAPHELLIEIIDASSVVTWDFDVCKGDVVFNIYH 568          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Yeast
Match: SEC14 (Phosphatidylinositol/phosphatidylcholine transfer protein; involved in regulating PtdIns, PtdCho, and ceramide metabolism, products of which regulate intracellular transport and UPR; has a role in localization of lipid raft proteins; functionally homologous to mammalian PITPs; SEC14 has a paralog, YKL091C, that arose from the whole genome duplication [Source:SGD;Acc:S000004684])

HSP 1 Score: 110.538 bits (275), Expect = 6.615e-28
Identity = 70/231 (30.30%), Postives = 120/231 (51.95%), Query Frame = 3
Query:  120 ILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPD--VFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGG 806
            + EL+  ++D    +  D++ +L++L+AR FD++ ++ M  N   WR+    DTIL+DF   +  +  K+    +   DK+GRP++ E LG ++     K    + + K  V   E++ +  LP  S+     +  +  + D++   +   +   M    E++ + +  YPE M K  I N P  F  A+ L KPFL   T  K+ ILGS+Y++ELLK I ++ LP   GG
Sbjct:   37 LAELRKLLEDAGFIERLDDSTLLRFLRARKFDVQLAKEMFENCEKWRKDYGTDTILQDFHYDEKPLIAKFYPQYYHKTDKDGRPVYFEELGAVNLHEMNKVTSEERMLKNLVWEYESVVQYRLPACSRAAGHLVETSCTIMDLKGISISSAYS-VMSYVREASYISQNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYQKELLKQIPAENLPVKFGG 266          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Yeast
Match: YKL091C (Putative phosphatidylinositol/phosphatidylcholine transfer protein; possibly involved in lipid metabolism; localizes to the nucleus; contains a CRAL/TRIO domain and binds several lipids in a large-scale study; YKL091C has a paralog, SEC14, that arose from the whole genome duplication [Source:SGD;Acc:S000001574])

HSP 1 Score: 96.2857 bits (238), Expect = 9.042e-23
Identity = 74/259 (28.57%), Postives = 118/259 (45.56%), Query Frame = 3
Query:  171 DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQ------------IPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMC-------------GPNGDPRCSHLIRWGGQIP 872
            D++ +L++L+AR FDI  S  M      WRE    +TI+ED++            +  ++ +Y    +   DK+GRP++ E LG ++ +   K    K + +  V   E      +P  S+     I  +  + D++   L + +   +    +   + +  YPE M K  I ++P  F   + +VKPFL   T  K+ ILGS+YK+ELLK I  + LP   GG                GP  DPR    I   G+IP
Sbjct:   50 DDSTLLRFLRARKFDINASVEMFVETERWREEYGANTIIEDYENNKEAEDKERIKLAKMYPQY----YHHVDKDGRPLYFEELGGINLKKMYKITTEKQMLRNLVKEYELFATYRVPACSRRAGYLIETSCTVLDLKGISLSNAYH-VLSYIKDVADISQNYYPERMGKFYIIHSPFGFSTMFKMVKPFLDPVTVSKIFILGSSYKKELLKQIPIENLPVKYGGTSVLHNPNDKFYYSDIGPWRDPR---YIGPEGEIP 300          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Yeast
Match: CSR1 (Phosphatidylinositol transfer protein; has a potential role in regulating lipid and fatty acid metabolism under heme-depleted conditions; interacts specifically with thioredoxin peroxidase; may have a role in oxidative stress resistance; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004372])

HSP 1 Score: 50.0618 bits (118), Expect = 3.355e-7
Identity = 57/222 (25.68%), Postives = 104/222 (46.85%), Query Frame = 3
Query:  183 ILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVG----------GFCGHDKEGRPIWMEPLGFLDPQGFLKSLPL-KDIYKVRVHIVENLYKNLLPQRSK---EEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGG 806
            ILK+++AR ++  K+  ML + + WR ++ I+ I+   +   V++    G             G+D + RP+ +     + P+    S    +++ K  + ++E         +SK   +E  P   TI LFD+  F + ++    ++  I      EA+YPES+  L+I   P +F   +N++K +L      K  I+ +   +EL K I    +P YLGG
Sbjct:  112 ILKFIRARKWNADKTIAMLGHDLYWR-KDTINKIINGGERA-VYENNETGVIKNLELQKATIQGYDNDMRPVIL-----VRPRLHHSSDQTEQELEKFSLLVIE---------QSKLFFKENYPASTTI-LFDLNGFSMSNMDYAPVKFLI---TCFEAHYPESLGHLLIHKAPWIFNPIWNIIKNWLDPVVASK--IVFTKNIDELHKFIQPQYIPRYLGG 311          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Nematostella
Match: EDO39269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAF7])

HSP 1 Score: 262.307 bits (669), Expect = 7.365e-84
Identity = 135/378 (35.71%), Postives = 221/378 (58.47%), Query Frame = 3
Query:  114 ELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKH---VKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILD 1238
            E + +    V D+ + +  D+ ++L+WL+ARDF+++K+E MLR  ++ R++  +D IL+ +++P+V  KY  GG+ G+D EG P++++PLG +D +G L S+   +I + + +  E L  +L  Q+SK+  + I Q + + DME  GLKHLW+P +          E N+PE M  + +   P +F IAYNLVKPFL  AT++KV ILG N+KE L + I +D LP Y GG     +GDP CS  I +GG +P SY+           Q   V+  S  KLSY + +P S+I +EF +++HDI F +Y+     +      K     E++   +V  +L  E+  I   + G Y++ FDN+YSW ++K + + +++ +
Sbjct:   14 ETLEQFSVKVSDVLQKEH-DDFFLLRWLRARDFNLEKAEFMLRESLAVRKKMGLDNILDTYKVPEVLQKYYPGGYFGYDIEGVPVFIDPLGNIDFKGLLLSVRKDEIIRFKGYTAE-LGLHLGAQQSKKVNKRIAQVVMVMDMEGLGLKHLWKPGVMTFNSVASFYEDNFPEVMKSIFVIRAPRIFPIAYNLVKPFLSPATRKKVQILGDNWKEVLCQHIPADHLPVYYGGTCVDDSGDPACSQKICYGGDVPESYFSTSQTLETDAYQTGIVRRGSTFKLSYEIETPNSVISWEFKSEDHDIGFGVYFSANTED----KCKCKDMVELVPSRRVDCHLIPEQDSITCERPGTYVLRFDNTYSWTRNKKILFCVDVTE 385          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Nematostella
Match: EDO39298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAF0])

HSP 1 Score: 224.172 bits (570), Expect = 1.465e-69
Identity = 123/364 (33.79%), Postives = 213/364 (58.52%), Query Frame = 3
Query:  171 DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVR-VHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYL-NKHVKNIQNITVKAKSKIKLSYL----VNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILDIM 1244
            D+ ++LKWL+A +FD++++E + R  +  R++  +DTILED++ P+V +KY  GGF G+DKEG PI+++P+G +D +G L S   +++ + + +H  + +   L   +SK+  + + + + + DME  G+KHLW P +    +     E+NYP    ++++   P LF +AY+LVKPFL   T+ ++ +LGS++K+EL + +D D LP + GG       DP+C+  I +GG IP S+++  K     +   V    + K+  +    +     LI ++F TKE+D+ F +      ++   + +    F + L + +V S+L  E+G     K G Y++ FDNSYSW++SK L+Y IE L  M
Sbjct:    2 DDYFLLKWLQATNFDVQQAEDIFRQSLWVRKKFGLDTILEDYKPPEVLEKYDPGGFFGYDKEGFPIFIDPVGKIDFKGLLHSARREEVLRFKGMHAEQGM--QLAKDQSKKLGKRVDKVVTILDMEGLGMKHLWTPEI-IFFQVLHFYESNYPGYWKQILVIKAPALFPVAYSLVKPFLSEYTRGQIKVLGSDWKKELQEYVDEDNLPEFYGGKCRDEKDDPKCATKICYGGDIPESFHVAQKPFGEAEGTKVTVVERGKILEIRGDHIKVGLCLIRWDFRTKENDVGFGL------VKKSTRKVTLYDFPQ-LPIQRVDSHLIPEQGCFKCDKTGTYVLRFDNSYSWIRSKDLEYKIEGLANM 355          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Nematostella
Match: EDO48390 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK1])

HSP 1 Score: 119.398 bits (298), Expect = 5.049e-29
Identity = 84/325 (25.85%), Postives = 157/325 (48.31%), Query Frame = 3
Query:   93 LCPQKVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKE---ELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKN----------IQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIY 1028
            L P++ ++LI +L+  + +  + +  ++ ++L++L+ARD  ++K+  ML   ++WR    ID ILE ++ P+    Y  GG+   DK  +       G    +  +     + I +  V I E   K      +KE  +P+     L D+E   ++HLWRP ++  +   +++E NYPE+M +L+I   P +F + + LV PF+   T+ K  I G N  +    +   ID++ LP +LG       G   C   I+ G  +P S Y +   ++           Q + V   S  ++   ++  ES+I ++F   + D+ F ++
Sbjct:  244 LTPREENQLI-QLRKKLGEAHKGKMPNDAHLLRFLRARDLHLEKAYEMLCQSLAWRRHHHIDNILEIWKPPEPLLDYYCGGWHHQDKVRQMDRQGKKGRWTNKERVDCTQRRSINQSVVSINEEGLKKT-EILTKETGKPVSSWTCLCDLEGLSMRHLWRPGIKALLRVIEMVEVNYPETMGRLLIVRAPRIFGVLWTLVSPFIDENTRNKFLIYGGNDYQGPGGVTDYIDAEYLPDFLG-------GPAECK--IKEGKLVPKSLYRSLDFEDGNEPSFASDIYQTVHVSKGSPHEVLVSMSQSESVITWDFDVMKADVTFTVF 557          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Nematostella
Match: EDO43833 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXE8])

HSP 1 Score: 80.1073 bits (196), Expect = 2.185e-17
Identity = 65/222 (29.28%), Postives = 99/222 (44.59%), Query Frame = 3
Query:  183 ILKWLKARDFDIKKSETMLRNHISWREREKIDTIL-------EDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKS---LPLKDIYKVRVHIVENLYKNL----LPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGG 806
            +L +L+AR FD++ +     + + WR++  ID+IL       E   I  V       GF   DKEGRP ++E  G  D    +K    LP+  +  +R HI    Y+      L Q S          I L +    G    +R A+       KL + +YPE M K+ I NTP +F + + + + FL   T+ K  +L S+   +LL    +  LP   GG
Sbjct:    2 LLGFLRARGFDVQAAYKQYLSTVEWRKKNGIDSILDKPVNHSECLLITQVMS----CGFHKQDKEGRPCYIEYTGRTDVSALVKVHTILPVDQV--IRRHIWNCEYQIARMAELSQNSVSSLEENTSIITLLNCRFGG----FRKALNIFKRLAKLDQDHYPERMGKIFIVNTPWVFPVLWKIARVFLDPKTRSKCVVLKSSENPKLLNYFYAADLPEEFGG 213          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Medaka
Match: sec14l8 (SEC14 like lipid binding 2 [Source:NCBI gene;Acc:101157844])

HSP 1 Score: 261.922 bits (668), Expect = 3.139e-83
Identity = 139/388 (35.82%), Postives = 228/388 (58.76%), Query Frame = 3
Query:   84 PPVLCPQKVSELILELQNNVKDIWRPQFADEN--YILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNI--QNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            P  L P K +E + + +  ++DI  PQ   ++  ++L+WL+AR+F+++KSE MLR H+ +R++ K+D +  +++ P+V +KY  GG CG+D+EG P+W + +G +DP+G   S   +D  K ++   E L K    Q ++   R +     ++D+E  GLKHLW+PA+E   E   + E NYPE + +L +   P LF +AYNLVK FL  AT+ K+ ILG+N++E LLK ID ++LP   GG +  P+GDPRC   I   G +P SYY+  HVK    Q+ITV   S  +  Y +  P  ++ + F++   DI F ++      E +    K  + EE++   +  ++L  E G +   + G Y++ FDN+YS  ++K + + +E+L
Sbjct:    5 PGDLSP-KQAETLQQFRERIQDIL-PQLPAQHDAFLLRWLRARNFNLQKSEAMLRKHMEFRKQMKVDMLANEWRPPEVIEKYLSGGMCGYDREGSPVWYDVIGPMDPKGLFLSASKQDFIKSKIRDCELLQKECNRQ-TERLGRNVESITMIYDVEGLGLKHLWKPAIETFGEILTMFEDNYPEGLKRLFVIKAPKLFPVAYNLVKHFLCEATRDKIYILGANWQEVLLKYIDVEELPAIYGGKLTDPDGDPRCRTRINHVGPVPPSYYVRDHVKVDYEQSITVNRASSQQQDYEILFPGCVLRWHFASDGADIGFGVFLKAKKGEWK----KAGEMEEIIPNQRYNAHLVPEDGSLTCERPGVYVLRFDNTYSIFQAKKVSFTVEVL 385          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Medaka
Match: sec14l7 (SEC14-like protein 2 [Source:NCBI gene;Acc:101163915])

HSP 1 Score: 219.935 bits (559), Expect = 2.754e-67
Identity = 123/381 (32.28%), Postives = 217/381 (56.96%), Query Frame = 3
Query:  105 KVSELILELQNNVKDIWRPQFAD-ENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQ---NITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEIL 1235
            K +E + + Q  ++D+     A  ++Y+L+WL              R H+ +R++ ++DTI+ D+  P+V  KY  GG CG+D+EG P+W + +G LDP+G L S   +D  + ++   E L +    Q S++  + +   + ++D E  GLKH+W+PA+E   E   + E NYPE + K+ I   P LF +AYNL+K F+   T++K+ +LG +++E+L K ID DQLP   GG    P+GDPRC  +I +GG +P SYY+   +K +Q   ++T+   S ++L + + +  +L+ ++F+++  DI F +Y        +    K S+  +VL   +  +++  E   +  ++ G  +  FDNSYS ++SK + Y +E++
Sbjct:   11 KQAECLAQFQERIRDVLPSLPAQHDHYLLRWL--------------RQHVDFRKQMRLDTIVSDWTPPEVIQKYVSGGMCGYDREGSPVWFDVIGPLDPKGLLMSASKQDYQRTKIQHAEMLQQECRRQ-SEKLGKNVEGIVLIYDCEGLGLKHIWKPAIETYGEILTMFEENYPEGLKKVFIIK-PKLFPVAYNLIKHFMCEETRRKILVLG-DWQEDLHKHIDPDQLPVLYGGTRTDPDGDPRCRTMINYGGTVPKSYYVQDALK-VQYDTSVTISRGSSLQLDFHIPAASTLL-WQFASEGADIGFGVYRRTKAGGQQ----KVSEMLQVLPGQRYNAHMVPESSCLICSEPGVVLC-FDNSYSLLQSKKVSYSVEVV 367          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Medaka
Match: sec14l1 (SEC14 like lipid binding 1 [Source:NCBI gene;Acc:101162929])

HSP 1 Score: 131.339 bits (329), Expect = 1.318e-32
Identity = 79/320 (24.69%), Postives = 171/320 (53.44%), Query Frame = 3
Query:   93 LCPQKVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSI-LGSNYK--EELLKIIDSDQLPTYLGGN-MCG-PNGDPRCSHLIRWGGQIPI--SYYLNKHVKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYY 1031
            L P + S LI  L+  +++  + +   + ++L++L+ARDF++ K+   L   ++WR++ ++D +L+ ++ P +   +  G +  HD++GRP+++  LG +D +G +++L  + + +  + + E   +    + ++   RPI     L D++   ++H+WRP ++  +   +++EANYPE++ +L+I   P +F + + LV P +   +++K  +  G++Y+    L+  ID + +P +LGG  +C  P+G      L R   Q+    +  L   +    NI     +  ++   +    S+I ++F   + D  F IY+
Sbjct:  234 LTPLQESCLI-RLRQWLQETHKGKIPKDQHVLRFLRARDFNMDKAREFLCQSLTWRKQHQVDFLLDTWERPQLLQDFFTGAWHHHDRDGRPLYVLRLGQMDTKGLVRALGEEVLLRQVLSLNEEGLRR-CEENTRVFGRPISCWTCLMDLDGLNMRHMWRPGVKALLRIIEVVEANYPETLGRLLIVRAPRVFPVLWTLVSPLIDENSRKKFLVYAGNDYQGPGGLVDYIDREIIPDFLGGACLCDIPDGGTVPKSLYRTAEQLESEENCLLTDCIYKTANIF--KGTPFEMLIEITEASSVITWDFDVSKGDTVFNIYH 549          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Medaka
Match: sec14l1 (SEC14 like lipid binding 1 [Source:NCBI gene;Acc:101162929])

HSP 1 Score: 131.339 bits (329), Expect = 1.318e-32
Identity = 79/320 (24.69%), Postives = 171/320 (53.44%), Query Frame = 3
Query:   93 LCPQKVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSI-LGSNYK--EELLKIIDSDQLPTYLGGN-MCG-PNGDPRCSHLIRWGGQIPI--SYYLNKHVKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYY 1031
            L P + S LI  L+  +++  + +   + ++L++L+ARDF++ K+   L   ++WR++ ++D +L+ ++ P +   +  G +  HD++GRP+++  LG +D +G +++L  + + +  + + E   +    + ++   RPI     L D++   ++H+WRP ++  +   +++EANYPE++ +L+I   P +F + + LV P +   +++K  +  G++Y+    L+  ID + +P +LGG  +C  P+G      L R   Q+    +  L   +    NI     +  ++   +    S+I ++F   + D  F IY+
Sbjct:  234 LTPLQESCLI-RLRQWLQETHKGKIPKDQHVLRFLRARDFNMDKAREFLCQSLTWRKQHQVDFLLDTWERPQLLQDFFTGAWHHHDRDGRPLYVLRLGQMDTKGLVRALGEEVLLRQVLSLNEEGLRR-CEENTRVFGRPISCWTCLMDLDGLNMRHMWRPGVKALLRIIEVVEANYPETLGRLLIVRAPRVFPVLWTLVSPLIDENSRKKFLVYAGNDYQGPGGLVDYIDREIIPDFLGGACLCDIPDGGTVPKSLYRTAEQLESEENCLLTDCIYKTANIF--KGTPFEMLIEITEASSVITWDFDVSKGDTVFNIYH 549          
BLAST of SEC14-like lipid binding 8 vs. Ensembl Medaka
Match: sec14l1 (SEC14 like lipid binding 1 [Source:NCBI gene;Acc:101162929])

HSP 1 Score: 131.339 bits (329), Expect = 1.318e-32
Identity = 79/320 (24.69%), Postives = 171/320 (53.44%), Query Frame = 3
Query:   93 LCPQKVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSI-LGSNYK--EELLKIIDSDQLPTYLGGN-MCG-PNGDPRCSHLIRWGGQIPI--SYYLNKHVKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYY 1031
            L P + S LI  L+  +++  + +   + ++L++L+ARDF++ K+   L   ++WR++ ++D +L+ ++ P +   +  G +  HD++GRP+++  LG +D +G +++L  + + +  + + E   +    + ++   RPI     L D++   ++H+WRP ++  +   +++EANYPE++ +L+I   P +F + + LV P +   +++K  +  G++Y+    L+  ID + +P +LGG  +C  P+G      L R   Q+    +  L   +    NI     +  ++   +    S+I ++F   + D  F IY+
Sbjct:  234 LTPLQESCLI-RLRQWLQETHKGKIPKDQHVLRFLRARDFNMDKAREFLCQSLTWRKQHQVDFLLDTWERPQLLQDFFTGAWHHHDRDGRPLYVLRLGQMDTKGLVRALGEEVLLRQVLSLNEEGLRR-CEENTRVFGRPISCWTCLMDLDGLNMRHMWRPGVKALLRIIEVVEANYPETLGRLLIVRAPRVFPVLWTLVSPLIDENSRKKFLVYAGNDYQGPGGLVDYIDREIIPDFLGGACLCDIPDGGTVPKSLYRTAEQLESEENCLLTDCIYKTANIF--KGTPFEMLIEITEASSVITWDFDVSKGDTVFNIYH 549          
BLAST of SEC14-like lipid binding 8 vs. Planmine SMEST
Match: SMESG000008338.1 (SMESG000008338.1)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 318/318 (100.00%), Postives = 318/318 (100.00%), Query Frame = 3
Query:   81 MPPVLCPQKVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYV 1034
            MPPVLCPQKVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYV
Sbjct:    1 MPPVLCPQKVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQNITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYV 318          
BLAST of SEC14-like lipid binding 8 vs. Planmine SMEST
Match: SMESG000035531.1 (SMESG000035531.1)

HSP 1 Score: 192.586 bits (488), Expect = 8.794e-57
Identity = 121/380 (31.84%), Postives = 201/380 (52.89%), Query Frame = 3
Query:  117 LILELQNNVKD-IWRPQFADENYILK-WLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIA-LFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQN---ITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILD 1238
            L LE +  +KD +    F  +++ LK WL ARD+++KK+  M  ++  +R+R ++D I E FQ   +   Y  GG  G+DK    + +E  G LD +G + +    D+ K+++   EN+   +  + S+E    I   +  +FDME    + LWR  +E  +   KL+E NYPE +  L + N P +F   + + KP +   T++K+ IL SNY + LL+ ID   LP   GG     N DPRCS +I  GG I  + Y NK + NI+N   IT+   S+  +   +    S++ +EF + ++D+ F I +         ++ K S+ + ++ + ++  +L  E G     ++G Y + FDNSYS  +SK +  Y E+LD
Sbjct:    8 LFLEFKEIIKDHLNEDNFLHQDHFLKKWLIARDYNVKKAVKMFIDNAEFRKRFEVDNIKETFQPNHILKTYTTGGIVGYDKNANVVRVELFGLLDMKGLMYTCKKSDLEKMKILECENVVA-MWKKYSEENPGKISDGMTVIFDMEGVTSRVLWRSGLEMYLHLIKLLEDNYPEMLRNLFLINAPSIFPFLWRICKPLVSEHTKKKIHILKSNYPDTLLEHIDPKVLPKQFGGMRTDENDDPRCSSIIMQGGIIDEALY-NKQMLNIENSESITISHGSQHVIKIQIEKSNSILRWEFKSSDYDLGFGINF---------EDEKASK-KTLVAISRINCHLVPEDGTHLCEEIGTYELVFDNSYSVARSKSVDIYYEVLD 375          
BLAST of SEC14-like lipid binding 8 vs. Planmine SMEST
Match: SMESG000035531.1 (SMESG000035531.1)

HSP 1 Score: 193.356 bits (490), Expect = 8.952e-57
Identity = 122/389 (31.36%), Postives = 205/389 (52.70%), Query Frame = 3
Query:   90 VLCPQKVSELILELQNNVKD-IWRPQFADENYILK-WLKARDFDIKKSETMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIA-LFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGDPRCSHLIRWGGQIPISYYLNKHVKNIQN---ITVKAKSKIKLSYLVNSPESLIYYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIEKGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILD 1238
            ++ P +   L LE +  +KD +    F  +++ LK WL ARD+++KK+  M  ++  +R+R ++D I E FQ   +   Y  GG  G+DK    + +E  G LD +G + +    D+ K+++   EN+   +  + S+E    I   +  +FDME    + LWR  +E  +   KL+E NYPE +  L + N P +F   + + KP +   T++K+ IL SNY + LL+ ID   LP   GG     N DPRCS +I  GG I  + Y NK + NI+N   IT+   S+  +   +    S++ +EF + ++D+ F I +         ++ K S+ + ++ + ++  +L  E G     ++G Y + FDNSYS  +SK +  Y E+LD
Sbjct:   26 IMAPNQ-ENLFLEFKEIIKDHLNEDNFLHQDHFLKKWLIARDYNVKKAVKMFIDNAEFRKRFEVDNIKETFQPNHILKTYTTGGIVGYDKNANVVRVELFGLLDMKGLMYTCKKSDLEKMKILECENVVA-MWKKYSEENPGKISDGMTVIFDMEGVTSRVLWRSGLEMYLHLIKLLEDNYPEMLRNLFLINAPSIFPFLWRICKPLVSEHTKKKIHILKSNYPDTLLEHIDPKVLPKQFGGMRTDENDDPRCSSIIMQGGIIDEALY-NKQMLNIENSESITISHGSQHVIKIQIEKSNSILRWEFKSSDYDLGFGINF---------EDEKASK-KTLVAISRINCHLVPEDGTHLCEEIGTYELVFDNSYSVARSKSVDIYYEVLD 401          
BLAST of SEC14-like lipid binding 8 vs. Planmine SMEST
Match: SMESG000027354.1 (SMESG000027354.1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.265e-7
Identity = 59/221 (26.70%), Postives = 99/221 (44.80%), Query Frame = 3
Query:  171 DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTI--LEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDP-----QGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPL-FKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGN 809
            DE   +K+L+A+ F+I  +  +   H + R +E +  I   E+  + ++F +         DK G  I +       P     Q  LK+L    I+++   +       LLP   K         I +++M      +     M  +++   L++  YP  + K+IIF TPPL F+ A+N ++ F++   Q +V IL  N  EEL   +  D LP   GGN
Sbjct:   38 DEEIAIKFLRAKKFNIDSALDLYVKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKAL----IFQLDAIL-------LLPTTQKN------GLIFIYNMTGSLYSNF---DMALSVKILNLLKGAYPARLCKVIIF-TPPLWFRAAFNFLRIFVKDKLQDRVYILTKN--EELYFHLSKDILPLTFGGN 235          
BLAST of SEC14-like lipid binding 8 vs. Planmine SMEST
Match: SMESG000027354.1 (SMESG000027354.1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.420e-7
Identity = 59/221 (26.70%), Postives = 99/221 (44.80%), Query Frame = 3
Query:  171 DENYILKWLKARDFDIKKSETMLRNHISWREREKIDTI--LEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEPLGFLDP-----QGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIALFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPL-FKIAYNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGN 809
            DE   +K+L+A+ F+I  +  +   H + R +E +  I   E+  + ++F +         DK G  I +       P     Q  LK+L    I+++   +       LLP   K         I +++M      +     M  +++   L++  YP  + K+IIF TPPL F+ A+N ++ F++   Q +V IL  N  EEL   +  D LP   GGN
Sbjct:   41 DEEIAIKFLRAKKFNIDSALDLYVKHEAIRSKENLIEIDPFENEILHELFSEKFTFLMDTDDKSGASICIFTAKLHHPSKASHQHVLKAL----IFQLDAIL-------LLPTTQKN------GLIFIYNMTGSLYSNF---DMALSVKILNLLKGAYPARLCKVIIF-TPPLWFRAAFNFLRIFVKDKLQDRVYILTKN--EELYFHLSKDILPLTFGGN 238          
The following BLAST results are available for this feature:
BLAST of SEC14-like lipid binding 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEC14L42.179e-8235.58SEC14 like lipid binding 4 [Source:HGNC Symbol;Acc... [more]
SEC14L23.474e-8135.09SEC14 like lipid binding 2 [Source:HGNC Symbol;Acc... [more]
SEC14L31.841e-7933.86SEC14 like lipid binding 3 [Source:HGNC Symbol;Acc... [more]
SEC14L64.804e-7734.67SEC14 like lipid binding 6 [Source:HGNC Symbol;Acc... [more]
SEC14L45.074e-7335.00SEC14 like lipid binding 4 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SEC14-like lipid binding 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctg-11.673e-4531.32CRAL/TRIO and GOLD domain containing [Source:UniP... [more]
T23G5.21.209e-4030.80CRAL-TRIO domain-containing protein T23G5.2 [Sour... [more]
T23G5.21.209e-4030.80CRAL-TRIO domain-containing protein T23G5.2 [Sour... [more]
ctg-18.286e-3231.08CRAL/TRIO and GOLD domain containing [Source:UniP... [more]
ctg-23.704e-2824.92CRAL/TRIO and GOLD domain containing [Source:UniP... [more]
back to top
BLAST of SEC14-like lipid binding 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG138932.584e-5532.23gene:FBgn0035146 transcript:FBtr0072562[more]
retm1.941e-3726.69gene:FBgn0031814 transcript:FBtr0329951[more]
retm1.998e-3726.69gene:FBgn0031814 transcript:FBtr0079272[more]
retm1.998e-3726.69gene:FBgn0031814 transcript:FBtr0339788[more]
CG100267.932e-1124.59gene:FBgn0032785 transcript:FBtr0081238[more]
back to top
BLAST of SEC14-like lipid binding 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec14l82.239e-9036.32SEC14-like lipid binding 8 [Source:ZFIN;Acc:ZDB-GE... [more]
sec14l72.220e-8935.70SEC14-like lipid binding 7 [Source:ZFIN;Acc:ZDB-GE... [more]
sec14l73.982e-7031.23SEC14-like lipid binding 7 [Source:ZFIN;Acc:ZDB-GE... [more]
SEC14L11.203e-3728.33si:dkey-237i9.1 [Source:ZFIN;Acc:ZDB-GENE-060503-4... [more]
sec14l76.856e-3537.04SEC14-like lipid binding 7 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of SEC14-like lipid binding 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cldn8.46.787e-8636.13claudin 8, gene 4 [Source:Xenbase;Acc:XB-GENE-9915... [more]
cldn8.42.428e-7534.03claudin 8, gene 4 [Source:Xenbase;Acc:XB-GENE-9915... [more]
cldn8.43.612e-7534.03claudin 8, gene 4 [Source:Xenbase;Acc:XB-GENE-9915... [more]
cldn8.42.780e-7434.81claudin 8, gene 4 [Source:Xenbase;Acc:XB-GENE-9915... [more]
cldn8.43.051e-7334.25claudin 8, gene 4 [Source:Xenbase;Acc:XB-GENE-9915... [more]
back to top
BLAST of SEC14-like lipid binding 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sec14l25.743e-8335.34SEC14-like lipid binding 2 [Source:MGI Symbol;Acc:... [more]
Sec14l43.928e-8235.32SEC14-like lipid binding 4 [Source:MGI Symbol;Acc:... [more]
Sec14l36.377e-8135.08SEC14-like lipid binding 3 [Source:MGI Symbol;Acc:... [more]
Sec14l11.108e-3729.27SEC14-like lipid binding 1 [Source:MGI Symbol;Acc:... [more]
Sec14l51.156e-3726.44SEC14-like lipid binding 5 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of SEC14-like lipid binding 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P58875|S14L2_BOVIN1.883e-8536.75SEC14-like protein 2 OS=Bos taurus OX=9913 GN=SEC1... [more]
sp|Q99J08|S14L2_MOUSE4.017e-8235.34SEC14-like protein 2 OS=Mus musculus OX=10090 GN=S... [more]
sp|Q99MS0|S14L2_RAT9.088e-8235.08SEC14-like protein 2 OS=Rattus norvegicus OX=10116... [more]
sp|Q9UDX3|S14L4_HUMAN1.046e-8135.58SEC14-like protein 4 OS=Homo sapiens OX=9606 GN=SE... [more]
sp|Q9Z1J8|S14L3_RAT2.412e-8134.91SEC14-like protein 3 OS=Rattus norvegicus OX=10116... [more]
back to top
BLAST of SEC14-like lipid binding 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JYA23.567e-10141.84Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A0B6Z7E21.563e-10040.16Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A1S3H0K58.833e-9740.16SEC14-like protein 2 OS=Lingula unguis OX=7574 GN=... [more]
K1R1F61.914e-9539.05SEC14-like protein 2 OS=Crassostrea gigas OX=29159... [more]
V3ZK422.271e-9338.95Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of SEC14-like lipid binding 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec14l89.467e-8634.82SEC14-like protein 2 [Source:NCBI gene;Acc:1030225... [more]
sec14l81.008e-7332.49SEC14-like protein 2 [Source:NCBI gene;Acc:1030225... [more]
sec14l75.070e-6234.84SEC14-like lipid binding 7 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSAMXT00000012900.25.217e-4330.63pep primary_assembly:Astyanax_mexicanus-2.0:12:343... [more]
si:dkey-237i9.15.241e-3726.10SEC14-like protein 1 [Source:NCBI gene;Acc:1030277... [more]
back to top
BLAST of SEC14-like lipid binding 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SEC14-like lipid binding 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SEC146.615e-2830.30Phosphatidylinositol/phosphatidylcholine transfer ... [more]
YKL091C9.042e-2328.57Putative phosphatidylinositol/phosphatidylcholine ... [more]
CSR13.355e-725.68Phosphatidylinositol transfer protein; has a poten... [more]
back to top
BLAST of SEC14-like lipid binding 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO392697.365e-8435.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392981.465e-6933.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483905.049e-2925.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438332.185e-1729.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SEC14-like lipid binding 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sec14l83.139e-8335.82SEC14 like lipid binding 2 [Source:NCBI gene;Acc:1... [more]
sec14l72.754e-6732.28SEC14-like protein 2 [Source:NCBI gene;Acc:1011639... [more]
sec14l11.318e-3224.69SEC14 like lipid binding 1 [Source:NCBI gene;Acc:1... [more]
sec14l11.318e-3224.69SEC14 like lipid binding 1 [Source:NCBI gene;Acc:1... [more]
sec14l11.318e-3224.69SEC14 like lipid binding 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SEC14-like lipid binding 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008338.10.000e+0100.00SMESG000008338.1[more]
SMESG000035531.18.794e-5731.84SMESG000035531.1[more]
SMESG000035531.18.952e-5731.36SMESG000035531.1[more]
SMESG000027354.14.265e-726.70SMESG000027354.1[more]
SMESG000027354.14.420e-726.70SMESG000027354.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012784 ID=SMED30012784|Name=SEC14-like lipid binding 8|organism=Schmidtea mediterranea sexual|type=transcript|length=1322bp
GTGTCATATAAAATATAAGTATACTCACTGAACCTTGTACCTATTGATAA
CGGACAATAATTGTGATTTTATTTTACAAAATGCCACCAGTTCTTTGTCC
ACAGAAAGTTAGTGAATTAATTTTAGAATTACAGAACAATGTAAAAGACA
TTTGGCGACCTCAATTTGCCGATGAAAATTACATACTCAAATGGCTGAAG
GCTAGAGATTTTGATATAAAAAAGTCTGAAACGATGCTGCGAAATCATAT
CAGTTGGAGAGAACGTGAAAAAATCGACACGATTTTGGAAGACTTCCAAA
TTCCAGATGTCTTTGATAAATATGGAGTAGGAGGGTTTTGCGGACATGAC
AAAGAAGGTCGACCAATTTGGATGGAACCACTTGGATTTCTAGATCCACA
AGGGTTTTTGAAATCTTTACCCTTAAAAGATATTTATAAAGTTCGTGTTC
ATATTGTTGAAAATCTTTACAAAAATCTTTTACCTCAAAGAAGTAAAGAG
GAAGAAAGACCAATTTTGCAAACCATTGCTTTATTTGACATGGAAAATTT
TGGGTTGAAGCATTTATGGAGACCAGCAATGGAATGTACCATAGAAAGTA
CCAAATTAATGGAAGCGAATTACCCGGAATCTATGGCTAAGTTGATTATT
TTCAATACACCTCCTCTTTTTAAGATTGCGTACAATTTGGTGAAACCATT
TCTTCAACATGCTACACAACAAAAGGTCTCTATATTGGGATCAAACTACA
AAGAGGAGTTATTGAAAATAATTGATAGTGATCAATTGCCAACGTATTTA
GGTGGCAATATGTGCGGCCCAAACGGGGATCCTCGTTGTAGCCACTTGAT
TCGTTGGGGTGGCCAAATTCCAATTTCTTATTATCTAAATAAGCATGTGA
AAAATATACAAAATATAACGGTGAAGGCTAAATCGAAAATAAAGTTATCA
TATTTAGTCAACTCACCGGAGTCTTTGATCTATTATGAGTTTTCAACCAA
AGAACACGATATCAACTTCGCCATTTATTATGTCGGGCCAGTTCTCGAAT
CCGAGATCCAGAATTTGAAACCCAGCCAGTTTGAAGAAGTACTAAAATTG
CATAAAGTGCGCAGTAATTTAACAATTGAAAAAGGCGAGATTCCCGCAAC
AAAACTCGGATATTACATGATCGAATTCGACAATAGCTACAGTTGGGTTA
AATCAAAACATTTACAGTATTATATAGAAATATTGGATATAATGAAAACA
GAACACAGGGACAATAAAAAATGAATTACTTCTATCATTTTAGATTTTTC
TAGCCAATATTCAACATTTTAT
back to top

protein sequence of SMED30012784-orf-1

>SMED30012784-orf-1 ID=SMED30012784-orf-1|Name=SMED30012784-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=398bp
MPPVLCPQKVSELILELQNNVKDIWRPQFADENYILKWLKARDFDIKKSE
TMLRNHISWREREKIDTILEDFQIPDVFDKYGVGGFCGHDKEGRPIWMEP
LGFLDPQGFLKSLPLKDIYKVRVHIVENLYKNLLPQRSKEEERPILQTIA
LFDMENFGLKHLWRPAMECTIESTKLMEANYPESMAKLIIFNTPPLFKIA
YNLVKPFLQHATQQKVSILGSNYKEELLKIIDSDQLPTYLGGNMCGPNGD
PRCSHLIRWGGQIPISYYLNKHVKNIQNITVKAKSKIKLSYLVNSPESLI
YYEFSTKEHDINFAIYYVGPVLESEIQNLKPSQFEEVLKLHKVRSNLTIE
KGEIPATKLGYYMIEFDNSYSWVKSKHLQYYIEILDIMKTEHRDNKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0032794GTPase activating protein binding
GO:0005215transporter activity
Vocabulary: biological process
TermDefinition
GO:0007223Wnt signaling pathway, calcium modulating pathway
GO:1901232regulation of convergent extension involved in axis elongation
GO:1904088positive regulation of epiboly involved in gastrulation with mouth forming second
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0019897extrinsic component of plasma membrane
GO:0005622intracellular
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036865CRAL-TRIO_dom_sf
IPR036273CRAL/TRIO_N_dom_sf
IPR036598GOLD_dom_sf
IPR001071CRAL-bd_toc_tran
IPR001251CRAL-TRIO_dom
IPR011074CRAL/TRIO_N_dom
IPR009038GOLD_dom
IPR011528NERD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00180CRETINALDHBPcoord: 201..220
score: 36.25
coord: 34..56
score: 31.52
coord: 234..243
score: 50.0
NoneNo IPR availableGENE3DG3DSA:2.60.120.680coord: 275..317
e-value: 2.2E-102
score: 344.9
NoneNo IPR availablePANTHERPTHR23324SEC14 RELATED PROTEINcoord: 17..317
IPR001251CRAL-TRIO lipid binding domainSMARTSM00516sec14_4coord: 74..245
e-value: 1.9E-45
score: 167.0
IPR001251CRAL-TRIO lipid binding domainPFAMPF00650CRAL_TRIOcoord: 79..243
e-value: 5.9E-35
score: 120.3
IPR001251CRAL-TRIO lipid binding domainPROSITEPS50191CRAL_TRIOcoord: 74..248
score: 25.283
IPR001251CRAL-TRIO lipid binding domainCDDcd00170SEC14coord: 74..243
e-value: 2.17449E-33
score: 118.642
IPR011074CRAL/TRIO, N-terminal domainSMARTSM01100CRAL_TRIO_N_2coord: 31..56
e-value: 5.4E-6
score: 35.9
IPR036865CRAL-TRIO lipid binding domain superfamilyGENE3DG3DSA:3.40.525.10coord: 14..274
e-value: 2.2E-102
score: 344.9
IPR036865CRAL-TRIO lipid binding domain superfamilySUPERFAMILYSSF52087CRAL/TRIO domaincoord: 78..268
IPR036273CRAL/TRIO, N-terminal domain superfamilySUPERFAMILYSSF46938CRAL/TRIO N-terminal domaincoord: 13..72
IPR036598GOLD domain superfamilySUPERFAMILYSSF101576Supernatant protein factor (SPF), C-terminal domaincoord: 273..317