TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30012770
Length (bp)1828
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30012770) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30012770) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30012770) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30012770) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012770

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30012770SMESG000001662.1 dd_Smed_v4_19417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 92.8189 bits (229), Expect = 4.238e-19
Identity = 53/179 (29.61%), Postives = 91/179 (50.84%), Query Frame = 3
Query: 1101 KLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLN-DSPLLRGNEIFIKCKVHI 1634
            +L  N +  K LE  C N          G+ +W + ++    R+A++G   +IFS+SFY+ + GYRLC     NG    + SHLS++  +++G FD+ L WPF+  VTL + +Q +G   +    T++  PN   + +P    N   G  R +    L N  +  ++ + +F+K  V +
Sbjct:  386 QLSKNEERFKLLEGTCYN----------GKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIME--TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 92.8189 bits (229), Expect = 4.238e-19
Identity = 53/179 (29.61%), Postives = 91/179 (50.84%), Query Frame = 3
Query: 1101 KLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLN-DSPLLRGNEIFIKCKVHI 1634
            +L  N +  K LE  C N          G+ +W + ++    R+A++G   +IFS+SFY+ + GYRLC     NG    + SHLS++  +++G FD+ L WPF+  VTL + +Q +G   +    T++  PN   + +P    N   G  R +    L N  +  ++ + +F+K  V +
Sbjct:  386 QLSKNEERFKLLEGTCYN----------GKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIME--TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 92.8189 bits (229), Expect = 4.238e-19
Identity = 53/179 (29.61%), Postives = 91/179 (50.84%), Query Frame = 3
Query: 1101 KLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLN-DSPLLRGNEIFIKCKVHI 1634
            +L  N +  K LE  C N          G+ +W + ++    R+A++G   +IFS+SFY+ + GYRLC     NG    + SHLS++  +++G FD+ L WPF+  VTL + +Q +G   +    T++  PN   + +P    N   G  R +    L N  +  ++ + +F+K  V +
Sbjct:  386 QLSKNEERFKLLEGTCYN----------GKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIME--TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF1 (TNF receptor associated factor 1 [Source:HGNC Symbol;Acc:HGNC:12031])

HSP 1 Score: 87.0409 bits (214), Expect = 3.149e-18
Identity = 51/182 (28.02%), Postives = 88/182 (48.35%), Query Frame = 3
Query:  939 EYVNQELFQEKMLSELSGQ-------------SIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQD 1445
            E   Q   +EK+L+EL G+              +E     +  S    + D  +   ++++  E+   L     A+  LE+    +E   E    G FLW I N +    ++  G   ++FS +FY+ K GY+LC+ +  NG    K +HLS+++ I++G +D  LPWPF+  VT  + +Q+
Sbjct:   53 ELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLME---EASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQN 231          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 87.4261 bits (215), Expect = 1.346e-17
Identity = 42/145 (28.97%), Postives = 78/145 (53.79%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G  +W I+++    ++A+ G   +++S+ FY+   GY++C  +  NG  + K +HLS++  I++G +D  LPWPFK  VTL + +Q +    +     ++  PN   + KPT   N   G    +  + +L +   ++ + IFIK
Sbjct:  333 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIK 474          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 63.929 bits (154), Expect = 1.629e-10
Identity = 31/100 (31.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query: 1149 LNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRL--CIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQ 1442
            L+  ++  +M   + +W I        +A +G++TTIFS  F SH+ GY++  C  +  +G +  K+  +S+++ +LKG FD +L WPF   + +S+ +Q
Sbjct:  251 LSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKS--ISLYVLLLKGEFDPTLEWPFHRAIKISLLDQ 348          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 62.3882 bits (150), Expect = 2.883e-10
Identity = 39/131 (29.77%), Postives = 66/131 (50.38%), Query Frame = 3
Query: 1239 NGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGW-TKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKV 1628
            N S+ +I+S+ FYSH  GY++    +P G  +A   + S+++ ++KG +D+ L WPF+ +VT SI + D   L +T T+     P    +  +P    N   G    + L  +          +IFI+ KV
Sbjct:  177 NKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKEL-LTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVTE---FAADGDIFIQIKV 303          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 78.1814 bits (191), Expect = 6.917e-15
Identity = 42/149 (28.19%), Postives = 77/149 (51.68%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNL-IGVYRLIKLEDLLNDSPLLRGNEIFIKCKV 1628
            G  LW I ++S    +A       + S  FY+ + GY+L   +  NG    +N+H+S+++++L G +D  L WPF +++T ++  Q     Q     ++   P    + +P+  P+ L  G  R I  E LL+  P ++G+ +F++ KV
Sbjct:  322 GTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHE-LLHSRPFIKGDTVFLRVKV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 77.7962 bits (190), Expect = 8.158e-15
Identity = 42/149 (28.19%), Postives = 77/149 (51.68%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNL-IGVYRLIKLEDLLNDSPLLRGNEIFIKCKV 1628
            G  LW I ++S    +A       + S  FY+ + GY+L   +  NG    +N+H+S+++++L G +D  L WPF +++T ++  Q     Q     ++   P    + +P+  P+ L  G  R I  E LL+  P ++G+ +F++ KV
Sbjct:  331 GTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHE-LLHSRPFIKGDTVFLRVKV 478          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf5 (Tnf receptor-associated factor 5 [Source:ZFIN;Acc:ZDB-GENE-071120-3])

HSP 1 Score: 88.1965 bits (217), Expect = 4.489e-19
Identity = 62/237 (26.16%), Postives = 116/237 (48.95%), Query Frame = 3
Query:  945 VNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEI-------TIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLN--DSPLLRGNEIFIKCKV 1628
            V +EL   ++L    G  ++ E P +Q S    +   + T  ++E    +       T  L  +++ ++  E++   +E S      G+ +W ++++   HR     S   + S  FY+ ++GY+L +     G    + SH+S+++ I++G FD+ LPWPF+ N+TL++ +Q      ++HT   +   N   + +PT + N   G  R I   DL N  ++  +R   +FIK KV
Sbjct:   31 VQRELRDLRVL----GSELKEELPRLQASLDSLRQQVAVTESLREHLGALEQTCERHTRLLDIHVEQLQCNEQRLRQLESS---SYDGKLIWKVRDY--WHRKE---SGAALSSSPFYTSRSGYKLSVRAYLGGDGSGRGSHMSLYITIMRGDFDSFLPWPFRQNITLTLLDQSGTRNHMSHTFIPD--VNSDSFHRPTSDANVATGFTRFISHCDLENPRNAVFVRDETLFIKVKV 253          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 90.8929 bits (224), Expect = 8.374e-19
Identity = 48/146 (32.88%), Postives = 72/146 (49.32%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTL-TYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G F+W I  FS   +DA+ G    +FS +FYS K GY++C+ +  NG    + SHLS++  ++KG +D  L WPF   VTL + +Q+       H +  +    +   + +P    N   G      L  L   S  LR + IFIK
Sbjct:  383 GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNN----REHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 524          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 90.8929 bits (224), Expect = 8.374e-19
Identity = 48/146 (32.88%), Postives = 72/146 (49.32%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTL-TYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G F+W I  FS   +DA+ G    +FS +FYS K GY++C+ +  NG    + SHLS++  ++KG +D  L WPF   VTL + +Q+       H +  +    +   + +P    N   G      L  L   S  LR + IFIK
Sbjct:  383 GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNN----REHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIK 524          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 90.8929 bits (224), Expect = 8.701e-19
Identity = 49/151 (32.45%), Postives = 74/151 (49.01%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTL-TYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHI 1634
            G F+W I  FS   +DA+ G    +FS +FYS K GY++C+ +  NG    + SHLS++  ++KG +D  L WPF   VTL + +Q+       H +  +    +   + +P    N   G      L  L   S  LR + IFIK  V +
Sbjct:  396 GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNN----REHIIDAFRPDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDL 542          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 89.7373 bits (221), Expect = 1.706e-18
Identity = 57/174 (32.76%), Postives = 92/174 (52.87%), Query Frame = 3
Query: 1149 LNIEKSIEKMN---HGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQ-DTGFLQVTH-TLTYESFPNHVGWTKPTRNPNNL------IGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHIP 1637
            L + + +E+++    G  +W + ++S   ++A   +N   FS  FY+H+ GY+L +    NG    + SHLSI++R+L G +DN L WPF Y VT SI +Q D    +  H T T+   PN   + KP  + N+L       G  + I  E++   +  +R N IF+K  + IP
Sbjct:  293 LELRREMEELSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKKRN-YIRDNSIFLKASIEIP 465          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 93.2041 bits (230), Expect = 1.663e-19
Identity = 67/214 (31.31%), Postives = 108/214 (50.47%), Query Frame = 3
Query: 1059 KTNKIKEKNDEITIK--LQTNIDA--------IKYLERKCLNIEKSIEKMN---HGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQ-DTGFLQVTH-TLTYESFPNHVGWTKPTRNPNNL------IGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHIP 1637
            K +  K +  +ITI   L+ N+ A        +    ++ L + K +E+++    G  +W I ++S   ++A    N   FS  FY+HK GY+L +    NG    + S+LS+++R+L G +DN L WPF Y VT S+ +Q D    +  H T T+   PN   + KPT + N+L       G  + I  ED+   +  +R N IF++  V IP
Sbjct:  253 KDSGCKHRGPKITISRHLEENMRAHLSMMSSLVSRQRQEILELRKQVEELSVSSEGVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNFQKPTGSRNSLDESTLGFGYPKFISHEDIRKRN-YVRDNAIFLRASVEIP 465          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 87.0409 bits (214), Expect = 8.638e-18
Identity = 48/154 (31.17%), Postives = 81/154 (52.60%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSIT---NQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSP---LLRGNEIFIKCKV 1628
            G FLW I + ++   DA+ G   +++S +FY+ K GY++C+ I  NG    K +H+S++  ++KG +D  LPWPFK+ VT  +    N+D+ F      +T  SF       +P  + N   G      +  L  +SP    +R N ++I+C +
Sbjct:  230 GVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNRDSVFDAFRPDVTSASF------QRPINDMNVASGCPLFCPIAKL--NSPKHAYIRENTLYIRCII 375          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 85.1149 bits (209), Expect = 9.977e-17
Identity = 41/145 (28.28%), Postives = 77/145 (53.10%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G  +W I+++    ++A+ G   +++S+ FY+   GY++C  +  NG  + K +HLS++  I++G +D  LPWPFK  V+L + +Q      +     ++  PN   + KPT   N   G    +  + +L +   ++ + IFIK
Sbjct:  384 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIK 525          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 84.7297 bits (208), Expect = 1.150e-16
Identity = 41/145 (28.28%), Postives = 77/145 (53.10%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G  +W I+++    ++A+ G   +++S+ FY+   GY++C  +  NG  + K +HLS++  I++G +D  LPWPFK  V+L + +Q      +     ++  PN   + KPT   N   G    +  + +L +   ++ + IFIK
Sbjct:  409 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIK 550          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 84.3445 bits (207), Expect = 1.551e-16
Identity = 47/147 (31.97%), Postives = 73/147 (49.66%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLN--DSPLLRGNEIFIK 1619
            G+ +W I ++    R+A+ G   +IFS+ FY+   GYRLC     NG    K S LS++  ++KG FD+ L WPFK  VTL + +Q      +T    + + PN   + +P    N   G  R      L N  +   ++ + +FIK
Sbjct:  384 GKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITD--VFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIK 528          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 89.7373 bits (221), Expect = 1.376e-19
Identity = 49/179 (27.37%), Postives = 88/179 (49.16%), Query Frame = 3
Query: 1101 KLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLND-SPLLRGNEIFIKCKVHI 1634
            +L  N +  K LE  C +          G+ +W + ++    R+A+ G   ++FS+ FY+ + GYRLC     NG    K +HLS++  +++G FD+ L WPF+  VTL + +Q      +    T+++ PN   + +P    N   G  R +    L N  +  ++ + +F+K  V +
Sbjct:   78 QLNKNEERFKQLEGACYS----------GKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVE--TFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 244          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 89.7373 bits (221), Expect = 1.376e-19
Identity = 49/179 (27.37%), Postives = 88/179 (49.16%), Query Frame = 3
Query: 1101 KLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLND-SPLLRGNEIFIKCKVHI 1634
            +L  N +  K LE  C +          G+ +W + ++    R+A+ G   ++FS+ FY+ + GYRLC     NG    K +HLS++  +++G FD+ L WPF+  VTL + +Q      +    T+++ PN   + +P    N   G  R +    L N  +  ++ + +F+K  V +
Sbjct:   78 QLNKNEERFKQLEGACYS----------GKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVE--TFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 244          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 88.5817 bits (218), Expect = 5.153e-18
Identity = 49/179 (27.37%), Postives = 88/179 (49.16%), Query Frame = 3
Query: 1101 KLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLND-SPLLRGNEIFIKCKVHI 1634
            +L  N +  K LE  C +          G+ +W + ++    R+A+ G   ++FS+ FY+ + GYRLC     NG    K +HLS++  +++G FD+ L WPF+  VTL + +Q      +    T+++ PN   + +P    N   G  R +    L N  +  ++ + +F+K  V +
Sbjct:  380 QLNKNEERFKQLEGACYS----------GKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVE--TFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 546          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 88.5817 bits (218), Expect = 5.153e-18
Identity = 49/179 (27.37%), Postives = 88/179 (49.16%), Query Frame = 3
Query: 1101 KLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLND-SPLLRGNEIFIKCKVHI 1634
            +L  N +  K LE  C +          G+ +W + ++    R+A+ G   ++FS+ FY+ + GYRLC     NG    K +HLS++  +++G FD+ L WPF+  VTL + +Q      +    T+++ PN   + +P    N   G  R +    L N  +  ++ + +F+K  V +
Sbjct:  380 QLNKNEERFKQLEGACYS----------GKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVE--TFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 546          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 87.8113 bits (216), Expect = 9.766e-18
Identity = 42/145 (28.97%), Postives = 78/145 (53.79%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G  +W I+++    ++A+ G   +++S+ FY+   GY++C  +  NG  + K +HLS++  I++G +D  LPWPFK  VTL + +Q +    +     ++  PN   + KPT   N   G    +  + +L +   ++ + IFIK
Sbjct:  390 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIK 531          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 2.035e-18
Identity = 53/179 (29.61%), Postives = 91/179 (50.84%), Query Frame = 3
Query: 1101 KLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLN-DSPLLRGNEIFIKCKVHI 1634
            +L  N +  K LE  C N          G+ +W + ++    R+A++G   +IFS+SFY+ + GYRLC     NG    + SHLS++  +++G FD+ L WPF+  VTL + +Q +G   +    T++  PN   + +P    N   G  R +    L N  +  ++ + +F+K  V +
Sbjct:  386 QLSKNEERFKLLEGTCYN----------GKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIME--TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.672e-17
Identity = 49/179 (27.37%), Postives = 88/179 (49.16%), Query Frame = 3
Query: 1101 KLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLND-SPLLRGNEIFIKCKVHI 1634
            +L  N +  K LE  C +          G+ +W + ++    R+A+ G   ++FS+ FY+ + GYRLC     NG    K +HLS++  +++G FD+ L WPF+  VTL + +Q      +    T+++ PN   + +P    N   G  R +    L N  +  ++ + +F+K  V +
Sbjct:  386 QLNKNEERFKQLEGACYS----------GKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVE--TFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 552          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 8.550e-17
Identity = 42/145 (28.97%), Postives = 78/145 (53.79%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G  +W I+++    ++A+ G   +++S+ FY+   GY++C  +  NG  + K +HLS++  I++G +D  LPWPFK  VTL + +Q +    +     ++  PN   + KPT   N   G    +  + +L +   ++ + IFIK
Sbjct:  415 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIK 556          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.126e-16
Identity = 42/145 (28.97%), Postives = 78/145 (53.79%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G  +W I+++    ++A+ G   +++S+ FY+   GY++C  +  NG  + K +HLS++  I++G +D  LPWPFK  VTL + +Q +    +     ++  PN   + KPT   N   G    +  + +L +   ++ + IFIK
Sbjct:  416 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD--AFKPDPNSSSFKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIK 557          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13077|TRAF1_HUMAN (TNF receptor-associated factor 1 OS=Homo sapiens OX=9606 GN=TRAF1 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.940e-16
Identity = 51/182 (28.02%), Postives = 88/182 (48.35%), Query Frame = 3
Query:  939 EYVNQELFQEKMLSELSGQ-------------SIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQD 1445
            E   Q   +EK+L+EL G+              +E     +  S    + D  +   ++++  E+   L     A+  LE+    +E   E    G FLW I N +    ++  G   ++FS +FY+ K GY+LC+ +  NG    K +HLS+++ I++G +D  LPWPF+  VT  + +Q+
Sbjct:  175 ELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLME---EASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQN 353          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A7SM27 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g22095 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 3.925e-22
Identity = 61/205 (29.76%), Postives = 113/205 (55.12%), Query Frame = 3
Query: 1005 NEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            N++ L+    +++  DDS+TN  K       ++    I   K  +   L I+        G FLW I  F++ + +A +G+ T+I+S  FY+H+ GY+LC  + PNG   A++++LSI++ +++G +D+ LPWPF+  +T+++ +QD G   +  + T++  P  + + +PTRN N   G  R    + +L     +  N +F+K
Sbjct:  321 NKECLLSLMKRLEVQDDSQTNPNKLNRRLSQLESSITIHKTKLFQED-LRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNG---MNISETFDPDPCSISFQRPTRNINVASGCPRFCS-QTVLRTRGYMNENCVFVK 520          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: X1ZK62 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.491e-21
Identity = 62/205 (30.24%), Postives = 107/205 (52.20%), Query Frame = 3
Query: 1068 KIKEKNDEI-TIKLQTNIDA--IKYLERKCLNIEK-----------------SIEKMNH-GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDS-PLLRGNEIFI 1616
            +IK+  D I T++ Q  +D   +  +E+KC ++E+                 S+E +++ G +LW + +FS   +DAI+G  T+++SE F++HK GYR+C+ +  NG  + K +HLS++  +++GP D+ LPWPF+  VT    +Q     QV     +   P    + +PT + N   G    + L  L N     +R +  FI
Sbjct:  218 EIKKNQDSIATLERQRRLDRELLDAMEKKCRDLERIVSMSDINLKEVELRLSSMENVSYDGRYLWKLSDFSRKRQDAIDGRTTSLYSEPFFTHKTGYRMCVRLYLNGDGLGKGTHLSLFFVLMRGPCDSLLPWPFRQKVTFKFVDQSQNDHQVD---CFRPDPTSTSFKRPTSDMNIASGCPLFMPLTLLDNPQHAFIRDDTAFI 419          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG59 (TNF receptor-associated factor-2-like protein A OS=Dugesia japonica OX=6161 GN=TRAF-2A PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 8.453e-21
Identity = 50/148 (33.78%), Postives = 83/148 (56.08%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKV 1628
              F+W   +F     DA +G   ++ S++FY+ + GY++C+ + P G  + K +HLS++  I+KG FD+ L WPFK  VTLSI +Q++G     H+ T++       + KPT   N   G  + I L  ++N+S   + + IF+K  V
Sbjct:  203 ASFIWKFTDFEVRRVDAESGGRVSVTSDAFYTSEFGYKMCLRVYPAGDGVGKGTHLSVFFAIMKGEFDDLLSWPFKQKVTLSILDQESG--SKPHSDTFKPDARSACYQKPTDECNIASGFPKFILLSLIMNNSIYCKNDTIFLKIAV 348          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1IJI5 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.596e-20
Identity = 56/173 (32.37%), Postives = 95/173 (54.91%), Query Frame = 3
Query: 1125 IKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPL-LRGNEIFIKCKVHIPL 1640
            +  +E +C N      K +  E++W ++NF+ + +   +G+ T +FS+ FYS + GY++ + + PNG  +   +HLSI+L+++KGP D  L WP +Y  + S+ +Q T  + +T+TL Y+       + KP    N  +G    I L+ L    PL L  + IF K +V I L
Sbjct:  367 VDEMELECRN------KCSSFEYVWKVENFARVQQSMKSGTKTDVFSDPFYSSEFGYKMRLQLYPNGNGVGMGTHLSIFLQVMKGPHDAVLKWPIEYRASFSVLDQSTHQVHLTYTLEYDLIKFREDYAKPIDEFNTGLGFSTFISLDVL---KPLYLVDDAIFFKVEVKITL 530          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: Q1RPY5 (Zinc finger protein OS=Ciona intestinalis OX=7719 GN=Ci-ZF(TRAF/RING)-3 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.328e-19
Identity = 59/204 (28.92%), Postives = 108/204 (52.94%), Query Frame = 3
Query: 1041 QKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIE----KMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTH-TLTYESFPNHVGWTKPTRNPNNL-IGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHI 1634
            Q + D K  ++     E+  K++T I  IK ++ +   +E+ I+    +  +G + W IK+++ L R A  G    + S  FY+   GYR+CI  + +G+  A+ +HLS+++ ++KG FD+ LPWPF  ++TL++ NQ     Q  H +   ES  N + + +P    N    G    + L +L+     ++ + + IK +VH+
Sbjct:  371 QTDQDGKIVRLDHHVRELMAKMETQILQIKDIQNRLTGMEQRIDNQELRCCNGLYYWKIKDYAQLRRAACLGEMPVLHSPGFYTSPQGYRMCIRANLDGVESAQGTHLSLFVHLMKGDFDDVLPWPFCGSITLTVINQKELPSQRAHVSEMLESRANLMAFQRPITERNQKGYGYIDFLPL-NLIETEGFIKSDTLVIKAQVHV 573          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 90.5077 bits (223), Expect = 1.111e-18
Identity = 48/151 (31.79%), Postives = 75/151 (49.67%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTL-TYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHI 1634
            G F+W I +FS   +DA+ G    +FS +FYS K GY++C+ +  NG    + SHLS++  +++G +D  L WPF   VTL + +Q+       H +  +    +   + +P    N   G      L  L   S  LR + IFIK  V +
Sbjct:  382 GVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNR----EHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDL 528          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 88.1965 bits (217), Expect = 4.837e-18
Identity = 55/159 (34.59%), Postives = 83/159 (52.20%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQ-DTGFLQVTH-TLTYESFPNHVGWTKPTRNPNNL------IGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHIP 1637
            G  +W + ++S   ++A   +N   FS  FY+H+ GY+L +    NG    + SHLSI++R+L G +DN L WPF Y VT SI +Q D    +  H T T+   PN   + KP+ + N+L       G  + I   D +     +R N IF+K  + IP
Sbjct:  308 GVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPSSSRNSLDESTLGFGYPKFIS-HDEIRKRNYIRDNAIFLKASIEIP 465          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 2.184e-17
Identity = 41/148 (27.70%), Postives = 76/148 (51.35%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKV 1628
            G  +W I+++     +A+     +++S+ FY+   GY++C  +  NG  + K +HLS++  +++G +D  LPWPFK  VTL + +Q      +     ++  PN   + +PT   N   G   L   + +L +   ++ + IFIK  V
Sbjct:    4 GTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPARKHLGD--AFKPDPNSSSFRRPTGEMNIASGC-PLFVAQTVLENGTYIKDDTIFIKVTV 148          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 83.1889 bits (204), Expect = 2.065e-16
Identity = 47/150 (31.33%), Postives = 82/150 (54.67%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDL--LNDSPLLRGNEIFIKCKV 1628
            G+ +W + ++   HR    G  T + S  FY+  +GY+L   +   G   A+ +HLS+++ +++G FD+ LPWPF+ NVTL++ +Q      V+ + T +   N+  + +PT   N  +G  R I   DL    ++  +R + +FIK KV
Sbjct:  400 GKLIWKVHDY---HRKKEAG--TALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVSLSFTPDLASNN--FRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKV 542          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 82.0333 bits (201), Expect = 4.141e-16
Identity = 45/151 (29.80%), Postives = 76/151 (50.33%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTL-TYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHI 1634
            G F+W I +FS   +DA+ G    +FS +FY+ K GY++C+ I  NG    + +HLS++  +++G  D  L WPF   VTL + +Q+       H +  +    +   + +P  + N   G      L  L + +  +R + IFIK  V +
Sbjct:  310 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR----EHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIVDL 456          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 1.210e-20
Identity = 42/145 (28.97%), Postives = 81/145 (55.86%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G+ +W I++++   +DA++G   +++S+ FY+   GYR+C     NG  + + +HLS++  +++G +D  LPWPF+  VTL++ +Q     Q++   T++  P    + +PT + N   G    +     L  +  L+ + IFIK
Sbjct:  325 GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSD--TFKPDPASSSFRRPTSDMNIASGCPLFVS-HVALESASYLQDDTIFIK 466          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 4.453e-16
Identity = 37/145 (25.52%), Postives = 76/145 (52.41%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G+ +W I++++   ++A +G   +++S+ FY+   GY++C     NG  + + +HLS++  +++G +D  L WPF+  VTLS+ +Q      ++ T T +  P    + +P  + N   G    +     L  S  L  + +F++
Sbjct:  268 GKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPD--PASGSFRRPDGDMNVASGCPLFVS-HVALEGSSYLVDDTVFVR 409          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 68.5514 bits (166), Expect = 1.965e-12
Identity = 52/220 (23.64%), Postives = 98/220 (44.55%), Query Frame = 3
Query: 1059 KTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDL--------------HRDAINGSNTTIFSESFYSHKNGYRLCI-------------GISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQ-DTGFLQVTHTLTYESFPNHVGWTKPT--RNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKV 1628
            +  ++  K D     L      ++ LE +   + +S  ++  G F W ++ FS L              H DA       + S  FY+   GYRLC+               SP+ +   +  HL++++ +L+G +D+ LPWPFK  + +S+ +Q +   + VT  +  ++ P    + +P+  RNP    G    + +  L + S  LR + + ++C+V
Sbjct:  354 QIRELSAKTDNQQGLLAEATRLVRSLEAR---VAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDA----PAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMM--DADPQLSAFQRPSVHRNPKGF-GYMNFMDINTLHHRS-YLRDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 1.658e-7
Identity = 37/146 (25.34%), Postives = 71/146 (48.63%), Query Frame = 3
Query:  981 ELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSN--TTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFK 1412
            E   + +E +  + + S +    D  +T +++ K   +    Q    +I  L R+   +E +     +G FLW IK+  +  R+A NG+     I S +F++ + GYRL + +  +G       H+S +  +  GP+D +L WP++
Sbjct:  260 EEVAKRVERDVRVSEASTRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELENT---AYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSG------EHVSAYAMLGPGPYDATLAWPYQ 396          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 111.694 bits (278), Expect = 5.428e-26
Identity = 61/205 (29.76%), Postives = 113/205 (55.12%), Query Frame = 3
Query: 1005 NEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            N++ L+    +++  DDS+TN  K       ++    I   K  +   L I+        G FLW I  F++ + +A +G+ T+I+S  FY+H+ GY+LC  + PNG   A++++LSI++ +++G +D+ LPWPF+  +T+++ +QD G   +  + T++  P  + + +PTRN N   G  R    + +L     +  N +F+K
Sbjct:  321 NKECLLSLMKRLEVQDDSQTNPNKLNRRLSQLESSITIHKTKLFQED-LRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNG---MNISETFDPDPCSISFQRPTRNINVASGCPRFCS-QTVLRTRGYMNENCVFVK 520          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 92.8189 bits (229), Expect = 6.818e-20
Identity = 46/150 (30.67%), Postives = 78/150 (52.00%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTL--TYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKV 1628
            G ++W I  ++  +++ ++G   +I+S  FY  + GY+ C  + PNG  + K SHLS++  +++G FD  LPWPF+  VT  + +QD       H +  T+   P    + +PT N N   G    I   +L   +  +R + +FIK  V
Sbjct:  378 GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDR-----VHDIGDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRA-YVRDDTMFIKIAV 521          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 90.8929 bits (224), Expect = 2.067e-19
Identity = 47/156 (30.13%), Postives = 85/156 (54.49%), Query Frame = 3
Query: 1167 IEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVG-----WTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            +EK+ H + +W I++++   ++A  G+  T+FS +F + K+GYRLC  +  NG    K +H+S+++ +LKG FD  L WPF Y VT  + +Q+    Q  H + +   PN          +P    N   G  +  K E++++ +  ++ + IF+K
Sbjct:  296 LEKIAHSQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKH-IRFSIKPNPCADNEPFLGRPRLEKNASFGGAKFAKHEEIVSRN-YIKEDTIFLK 449          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 89.7373 bits (221), Expect = 4.580e-19
Identity = 48/159 (30.19%), Postives = 86/159 (54.09%), Query Frame = 3
Query: 1167 IEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVG-----WTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKV 1628
            +EK+ H + +W I++++   ++A  G+  T+FS +F + K+GYRLC  +  NG    K +H+S+++ +LKG FD  L WPF Y VT  + NQ     +  H + +   PN +        +P    N   G  + IK E++ + +  ++ + +F+K  V
Sbjct:  300 LEKIAHSQIIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFVSVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKH-VKFSIKPNPIPDNEPFLGRPRLEKNASFGGAKFIKHEEIESGN-FIKDDTVFLKVSV 456          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 85.5001 bits (210), Expect = 1.241e-17
Identity = 57/213 (26.76%), Postives = 102/213 (47.89%), Query Frame = 3
Query: 1056 SKTNKIKEKNDEITIKLQTNIDAIKYLERKC-----------LNIEKSIEKMNHGE-------FLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTL-TYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHIP 1637
            S  ++++ +   + +KLQ + D I+ LER+            L I    E++N  +        LW I N ++   +A +G  T+ +S  F++  +GY++C  I  NG  + +N H+S++  I++G FD  L WPF+  VTL + +QD     V H +  +   P+   + +P R   N+     L    + L     +R + +F+K  V  P
Sbjct:  272 SAVDELRREVGRLNVKLQESDDIIRRLERQLELHDQGTGLRNLAIADLEERLNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDN----VEHVIDAFRPDPSSSSFQRP-RAEMNIASGCPLFCSHEQLTQHAYIRDDTMFLKIIVDKP 479          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 90.5077 bits (223), Expect = 8.721e-19
Identity = 58/174 (33.33%), Postives = 91/174 (52.30%), Query Frame = 3
Query: 1149 LNIEKSIEKMN---HGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQ-DTGFLQVTH-TLTYESFPNHVGWTKPTRNPNNL------IGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHIP 1637
            L + + +E+++    G  +W + ++S   ++A   SN   FS  FY+H+ GY+L +    NG    + SHLS+++R+L G +DN L WPF Y VT SI +Q D    +  H T T+   PN   + KP    N+L       G  + I  E++   +  +R N IFIK  + IP
Sbjct:  293 LELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRN-YIRDNCIFIKASIEIP 465          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 90.1225 bits (222), Expect = 9.098e-19
Identity = 58/174 (33.33%), Postives = 91/174 (52.30%), Query Frame = 3
Query: 1149 LNIEKSIEKMN---HGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQ-DTGFLQVTH-TLTYESFPNHVGWTKPTRNPNNL------IGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHIP 1637
            L + + +E+++    G  +W + ++S   ++A   SN   FS  FY+H+ GY+L +    NG    + SHLS+++R+L G +DN L WPF Y VT SI +Q D    +  H T T+   PN   + KP    N+L       G  + I  E++   +  +R N IFIK  + IP
Sbjct:  293 LELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRN-YIRDNCIFIKASIEIP 465          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 89.7373 bits (221), Expect = 1.113e-18
Identity = 58/174 (33.33%), Postives = 91/174 (52.30%), Query Frame = 3
Query: 1149 LNIEKSIEKMN---HGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQ-DTGFLQVTH-TLTYESFPNHVGWTKPTRNPNNL------IGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHIP 1637
            L + + +E+++    G  +W + ++S   ++A   SN   FS  FY+H+ GY+L +    NG    + SHLS+++R+L G +DN L WPF Y VT SI +Q D    +  H T T+   PN   + KP    N+L       G  + I  E++   +  +R N IFIK  + IP
Sbjct:  286 LELRREMEELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRN-YIRDNCIFIKASIEIP 458          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 88.1965 bits (217), Expect = 4.834e-18
Identity = 45/146 (30.82%), Postives = 73/146 (50.00%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTL-TYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G F+W I +FS   ++A++G    +FS +FYS K GY++C+ +  NG    + +HLS++  +++  +D  L WPF   VTL + +Q+       H +  +        + +P    N   G      L  L   SP LR + IFIK
Sbjct:  367 GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNR----EHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIK 508          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 88.1965 bits (217), Expect = 5.670e-18
Identity = 45/146 (30.82%), Postives = 73/146 (50.00%), Query Frame = 3
Query: 1185 GEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTL-TYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIK 1619
            G F+W I +FS   ++A++G    +FS +FYS K GY++C+ +  NG    + +HLS++  +++  +D  L WPF   VTL + +Q+       H +  +        + +P    N   G      L  L   SP LR + IFIK
Sbjct:  374 GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNR----EHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIK 515          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000001662.1 (SMESG000001662.1)

HSP 1 Score: 501.13 bits (1289), Expect = 0.000e+0
Identity = 245/246 (99.59%), Postives = 245/246 (99.59%), Query Frame = 3
Query:  903 SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHIPL 1640
            SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDL NDSPLLRGNEIFIKCKVHIPL
Sbjct:  314 SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLWNDSPLLRGNEIFIKCKVHIPL 559          

HSP 2 Score: 218.779 bits (556), Expect = 0.000e+0
Identity = 103/107 (96.26%), Postives = 103/107 (96.26%), Query Frame = 2
Query:  317 CTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLSLSENIKFDQSADIRLSIIEVKCPEESCDYQGKLINMEDHLRVCKFQRIQCPFFNVSAK 637
            CTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKL LSENIKFDQSADIRLSIIEVKCPEESCDYQGKLI MEDHLRVCKFQRIQCPFFNV  K
Sbjct:  134 CTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLILSENIKFDQSADIRLSIIEVKCPEESCDYQGKLITMEDHLRVCKFQRIQCPFFNVGCK 240          

HSP 3 Score: 107.842 bits (268), Expect = 0.000e+0
Identity = 73/81 (90.12%), Postives = 74/81 (91.36%), Query Frame = 1
Query:  613 PIFQCECKERNVETHKLNDHLMSENYSHFKLLITFNDNIQNEVETLKYLVVELKTENQXXXXXXXXXXXXXXXXXNYEINH 855
            P F   CKERNVET KLNDHLMSENYSHFKLL+TF DNIQNEVETLKYLVVELKTENQILKEEIKDIKEI KVTENYEINH
Sbjct:  233 PFFNVGCKERNVETDKLNDHLMSENYSHFKLLMTFIDNIQNEVETLKYLVVELKTENQILKEEIKDIKEIKKVTENYEINH 313          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000001662.1 (SMESG000001662.1)

HSP 1 Score: 501.13 bits (1289), Expect = 0.000e+0
Identity = 245/246 (99.59%), Postives = 245/246 (99.59%), Query Frame = 3
Query:  903 SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHIPL 1640
            SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDL NDSPLLRGNEIFIKCKVHIPL
Sbjct:  326 SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLWNDSPLLRGNEIFIKCKVHIPL 571          

HSP 2 Score: 218.779 bits (556), Expect = 0.000e+0
Identity = 103/107 (96.26%), Postives = 103/107 (96.26%), Query Frame = 2
Query:  317 CTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLSLSENIKFDQSADIRLSIIEVKCPEESCDYQGKLINMEDHLRVCKFQRIQCPFFNVSAK 637
            CTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKL LSENIKFDQSADIRLSIIEVKCPEESCDYQGKLI MEDHLRVCKFQRIQCPFFNV  K
Sbjct:  146 CTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLILSENIKFDQSADIRLSIIEVKCPEESCDYQGKLITMEDHLRVCKFQRIQCPFFNVGCK 252          

HSP 3 Score: 107.842 bits (268), Expect = 0.000e+0
Identity = 73/81 (90.12%), Postives = 74/81 (91.36%), Query Frame = 1
Query:  613 PIFQCECKERNVETHKLNDHLMSENYSHFKLLITFNDNIQNEVETLKYLVVELKTENQXXXXXXXXXXXXXXXXXNYEINH 855
            P F   CKERNVET KLNDHLMSENYSHFKLL+TF DNIQNEVETLKYLVVELKTENQILKEEIKDIKEI KVTENYEINH
Sbjct:  245 PFFNVGCKERNVETDKLNDHLMSENYSHFKLLMTFIDNIQNEVETLKYLVVELKTENQILKEEIKDIKEIKKVTENYEINH 325          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000001662.1 (SMESG000001662.1)

HSP 1 Score: 500.745 bits (1288), Expect = 0.000e+0
Identity = 245/246 (99.59%), Postives = 245/246 (99.59%), Query Frame = 3
Query:  903 SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHIPL 1640
            SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDL NDSPLLRGNEIFIKCKVHIPL
Sbjct:  317 SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLWNDSPLLRGNEIFIKCKVHIPL 562          

HSP 2 Score: 218.779 bits (556), Expect = 0.000e+0
Identity = 103/107 (96.26%), Postives = 103/107 (96.26%), Query Frame = 2
Query:  317 CTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLSLSENIKFDQSADIRLSIIEVKCPEESCDYQGKLINMEDHLRVCKFQRIQCPFFNVSAK 637
            CTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKL LSENIKFDQSADIRLSIIEVKCPEESCDYQGKLI MEDHLRVCKFQRIQCPFFNV  K
Sbjct:  137 CTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLILSENIKFDQSADIRLSIIEVKCPEESCDYQGKLITMEDHLRVCKFQRIQCPFFNVGCK 243          

HSP 3 Score: 107.842 bits (268), Expect = 0.000e+0
Identity = 73/81 (90.12%), Postives = 74/81 (91.36%), Query Frame = 1
Query:  613 PIFQCECKERNVETHKLNDHLMSENYSHFKLLITFNDNIQNEVETLKYLVVELKTENQXXXXXXXXXXXXXXXXXNYEINH 855
            P F   CKERNVET KLNDHLMSENYSHFKLL+TF DNIQNEVETLKYLVVELKTENQILKEEIKDIKEI KVTENYEINH
Sbjct:  236 PFFNVGCKERNVETDKLNDHLMSENYSHFKLLMTFIDNIQNEVETLKYLVVELKTENQILKEEIKDIKEIKKVTENYEINH 316          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000001662.1 (SMESG000001662.1)

HSP 1 Score: 500.36 bits (1287), Expect = 0.000e+0
Identity = 245/246 (99.59%), Postives = 245/246 (99.59%), Query Frame = 3
Query:  903 SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKVHIPL 1640
            SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDL NDSPLLRGNEIFIKCKVHIPL
Sbjct:  295 SNQKEKLLIIGHEYVNQELFQEKMLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNIDAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLWNDSPLLRGNEIFIKCKVHIPL 540          

HSP 2 Score: 199.904 bits (507), Expect = 0.000e+0
Identity = 93/97 (95.88%), Postives = 93/97 (95.88%), Query Frame = 2
Query:  347 SHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLSLSENIKFDQSADIRLSIIEVKCPEESCDYQGKLINMEDHLRVCKFQRIQCPFFNVSAK 637
            SHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKL LSENIKFDQSADIRLSIIEVKCPEESCDYQGKLI MEDHLRVCKFQRIQCPFFNV  K
Sbjct:  125 SHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLILSENIKFDQSADIRLSIIEVKCPEESCDYQGKLITMEDHLRVCKFQRIQCPFFNVGCK 221          

HSP 3 Score: 108.227 bits (269), Expect = 0.000e+0
Identity = 73/81 (90.12%), Postives = 74/81 (91.36%), Query Frame = 1
Query:  613 PIFQCECKERNVETHKLNDHLMSENYSHFKLLITFNDNIQNEVETLKYLVVELKTENQXXXXXXXXXXXXXXXXXNYEINH 855
            P F   CKERNVET KLNDHLMSENYSHFKLL+TF DNIQNEVETLKYLVVELKTENQILKEEIKDIKEI KVTENYEINH
Sbjct:  214 PFFNVGCKERNVETDKLNDHLMSENYSHFKLLMTFIDNIQNEVETLKYLVVELKTENQILKEEIKDIKEIKKVTENYEINH 294          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000026628.1 (SMESG000026628.1)

HSP 1 Score: 157.918 bits (398), Expect = 4.874e-42
Identity = 66/171 (38.60%), Postives = 110/171 (64.33%), Query Frame = 3
Query: 1119 DAIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSESFYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNVTLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLEDLLNDSPLLRGNEIFIKCKVH 1631
            D +   +R+   IE  +E +N GEF+W +K+FS    +A    NT  +S+SF++HKNGY++C+ + P GI+  K SHL+I+  +++GPFDN L WP K++VT ++ +Q TG++ +  T  ++  P++  W KPT N     G ++ I++E+LL +  + + + IFIKC VH
Sbjct:  272 DKLSRFDRQLWKIEDKLETVNFGEFVWIVKDFSQKINEARKSINTEFYSDSFFTHKNGYKMCLRVDPIGISFGKGSHLAIYFCLMQGPFDNILSWPMKFDVTFALIDQSTGYVHMCRTARFDDHPDNFAWNKPTTNKKIGYGYHKFIEIEELLKNPSIFQEDRIFIKCTVH 442          

HSP 2 Score: 60.4622 bits (145), Expect = 1.908e-9
Identity = 33/108 (30.56%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  317 CTICKKLLIESHSGPCGCRYCYHCIKGLVEKNENICPGQQAYCFNEKLSLSENIKFDQSADIRLSIIEVKCPEESCDYQGKLINMEDHLRVCKFQRIQCPFFNVSAKN 640
            C IC  + I   S  CGC+YC+ CI+  +   +  CPG    C N+ L++  +I  DQS   R+S + VK PE++  +   +  +++ +   K     CPF  +  +N
Sbjct:   30 CVICNNIPINLCSSLCGCKYCWDCIENYLNGKDKCCPGLLVDCENQILNIENDILLDQSLTSRISRVIVKYPEQAGQFSDDIKRIQNRIISIKSNPSDCPFSYIGCRN 137          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF54.238e-1929.61TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF54.238e-1929.61TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF54.238e-1929.61TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF13.149e-1828.02TNF receptor associated factor 1 [Source:HGNC Symb... [more]
TRAF31.346e-1728.97TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.629e-1031.00TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-22.883e-1029.77TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Traf46.917e-1528.19gene:FBgn0026319 transcript:FBtr0334401[more]
Traf48.158e-1528.19gene:FBgn0026319 transcript:FBtr0077429[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf54.489e-1926.16Tnf receptor-associated factor 5 [Source:ZFIN;Acc:... [more]
traf2b8.374e-1932.88Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b8.374e-1932.88Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b8.701e-1932.45Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf4a1.706e-1832.76tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl21.663e-1931.31synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
hspb68.638e-1831.17heat shock protein family B (small) member 6 [Sour... [more]
ssh29.977e-1728.28slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh21.150e-1628.28slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
slc12a11.551e-1631.97solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf51.376e-1927.37TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf51.376e-1927.37TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf55.153e-1827.37TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf55.153e-1827.37TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf39.766e-1828.97TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O00463|TRAF5_HUMAN2.035e-1829.61TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|P70191|TRAF5_MOUSE2.672e-1727.37TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|Q60803|TRAF3_MOUSE8.550e-1728.97TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN1.126e-1628.97TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q13077|TRAF1_HUMAN1.940e-1628.02TNF receptor-associated factor 1 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7SM273.925e-2229.76Predicted protein (Fragment) OS=Nematostella vecte... [more]
X1ZK622.491e-2130.24Uncharacterized protein OS=Capitella teleta OX=283... [more]
D5JG598.453e-2133.78TNF receptor-associated factor-2-like protein A OS... [more]
T1IJI52.596e-2032.37Uncharacterized protein OS=Strigamia maritima OX=1... [more]
Q1RPY51.328e-1928.92Zinc finger protein OS=Ciona intestinalis OX=7719 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b1.111e-1831.79TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf4a4.837e-1834.59TNF receptor associated factor 4 [Source:NCBI gene... [more]
ENSAMXT00000035169.12.184e-1727.70pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf52.065e-1631.33TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2a4.141e-1629.80TNF receptor-associated factor 2-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.11.210e-2028.97pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.14.453e-1625.52pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf61.965e-1223.64TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.11.658e-725.34pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352375.428e-2629.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494646.818e-2030.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328512.067e-1930.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328494.580e-1930.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388731.241e-1726.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a8.721e-1933.33TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a9.098e-1933.33TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a1.113e-1833.33TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf2b4.834e-1830.82TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b5.670e-1830.82TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001662.10.000e+099.59SMESG000001662.1[more]
SMESG000001662.10.000e+099.59SMESG000001662.1[more]
SMESG000001662.10.000e+099.59SMESG000001662.1[more]
SMESG000001662.10.000e+099.59SMESG000001662.1[more]
SMESG000026628.14.874e-4238.60SMESG000026628.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012770 ID=SMED30012770|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1828bp
TTGCTGTGATAAAGTTCAAATATTTACTTGTTTTAATTCATTTCGATGAA
AGTAAGATAAGATCTGGATACAAAATTTTCTATTTTTATAATAAGTCATG
TGTATGGTCTTATCGACTTTGCCAAATATAGTATTGGTCGAAATTTTATA
ACTTCTATCAGAAAAGTATTTATGCAGTTTTTATTTCATGTTATTTATTG
TTTAAATAAATAAATAAATTCGCCAACAAATGTTTAATTCACTTCATCAC
ATTCTCCATAAAATTCGAAAATATCCAGAATTCGAATCCGAAAATGAAAT
TAACAATGAATTTATTTGTACGATTTGTAAAAAACTTCTAATAGAGTCCC
ACAGTGGACCGTGTGGCTGCCGATATTGCTATCATTGCATTAAAGGTTTG
GTTGAAAAGAATGAAAACATTTGTCCTGGTCAACAGGCTTATTGTTTCAA
TGAAAAGTTGAGTCTGAGCGAAAATATAAAGTTTGATCAGTCAGCAGATA
TAAGGCTTTCTATAATAGAGGTAAAATGTCCAGAAGAGTCCTGTGATTAT
CAAGGCAAATTGATTAATATGGAAGACCACTTAAGGGTTTGTAAATTCCA
ACGGATTCAGTGCCCATTTTTCAATGTGAGTGCAAAGAACGCAACGTTGA
GACGCATAAACTTAATGATCATTTAATGTCGGAAAATTATTCACATTTTA
AGTTGTTAATAACTTTCAATGACAACATACAGAACGAAGTAGAGACCTTA
AAATATTTGGTTGTAGAATTGAAAACAGAAAATCAAATTCTAAAAGAAGA
GATTAAAGACATCAAAGAAATTTAAAAAGTTACAGAAAATTATGAAATCA
ATCATGTAGAAACTATTAAATCTTTTTAATTTAATTTTTGTTTTAATTGA
AGTCGAATCAAAAAGAAAAATTACTTATTATTGGCCATGAATATGTAAAT
CAAGAATTATTCCAAGAAAAAATGCTTTCAGAATTATCAGGCCAATCAAT
TGAAAATGAAAAGCCTCTTATACAAAAATCATATAAAATACAAAAAAATG
ATGATTCAAAGACCAATAAAATTAAAGAAAAAAATGATGAAATTACCATA
AAATTGCAGACCAATATCGATGCAATTAAATATCTGGAAAGAAAATGTTT
AAACATAGAGAAAAGTATCGAAAAAATGAATCACGGTGAATTTCTTTGGA
ATATTAAAAATTTCTCCGATTTACACAGAGACGCAATCAACGGATCAAAC
ACCACAATTTTCAGTGAATCTTTCTATTCGCATAAGAATGGTTATAGACT
TTGTATAGGAATAAGTCCAAATGGTATTAATATCGCCAAGAATTCTCATT
TATCTATTTGGTTACGGATTTTGAAGGGTCCATTCGACAATTCATTGCCA
TGGCCGTTCAAATACAACGTAACTCTATCAATTACCAATCAAGACACCGG
ATTTCTACAGGTCACTCACACCCTAACGTACGAATCCTTTCCAAACCATG
TCGGGTGGACTAAACCAACTAGAAATCCTAATAATCTAATAGGAGTTTAC
AGGCTTATAAAACTGGAAGATTTGTTGAATGATTCTCCCTTACTTAGAGG
CAATGAAATATTTATCAAATGTAAAGTTCACATTCCATTATGAAAAACTA
TCAATCCTATCAAAACCATTCAAATCATTTCACTTCCACTTTCATGTGAA
TATTTCATTGAAAATTTATCAAATTTACGTTGAATTTTGTCAATATTTTC
TTTTGATAAAAACTCTAAAACAAATATTATTCATAAATAATTAAATAAAT
TTGACAACGATTTAATTAAAAGATAACG
back to top

protein sequence of SMED30012770-orf-1

>SMED30012770-orf-1 ID=SMED30012770-orf-1|Name=SMED30012770-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=224bp
MLSELSGQSIENEKPLIQKSYKIQKNDDSKTNKIKEKNDEITIKLQTNID
AIKYLERKCLNIEKSIEKMNHGEFLWNIKNFSDLHRDAINGSNTTIFSES
FYSHKNGYRLCIGISPNGINIAKNSHLSIWLRILKGPFDNSLPWPFKYNV
TLSITNQDTGFLQVTHTLTYESFPNHVGWTKPTRNPNNLIGVYRLIKLED
LLNDSPLLRGNEIFIKCKVHIPL*
back to top

protein sequence of SMED30012770-orf-2

>SMED30012770-orf-2 ID=SMED30012770-orf-2|Name=SMED30012770-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=149bp
MFNSLHHILHKIRKYPEFESENEINNEFICTICKKLLIESHSGPCGCRYC
YHCIKGLVEKNENICPGQQAYCFNEKLSLSENIKFDQSADIRLSIIEVKC
PEESCDYQGKLINMEDHLRVCKFQRIQCPFFNVSAKNATLRRINLMII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0042981regulation of apoptotic process
GO:0046330positive regulation of JNK cascade
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 95..142
e-value: 1.2E-5
score: 27.4
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 3..94
e-value: 4.2E-9
score: 37.9
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 17..129
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 17..129
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 22..74
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 30..66
score: 8.86