Tektin-4

Overview
NameTektin-4
Smed IDSMED30012757
Length (bp)1457
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tektin-4 (SMED30012757) t-SNE clustered cells

Violin plots show distribution of expression levels for Tektin-4 (SMED30012757) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tektin-4 (SMED30012757) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tektin-4 (SMED30012757) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012757

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012757SMESG000068903.1 Contig2768GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30012757SMESG000068903.1 SmedASXL_019423SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30012757SMESG000068903.1 dd_Smed_v4_4872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012757SMESG000068903.1 dd_Smed_v4_4872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30012757SMESG000068903.1 dd_Smed_v4_4872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012757SMESG000068903.1 dd_Smed_v4_4872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012757SMESG000068903.1 dd_Smed_v4_4872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30012757SMESG000068903.1 dd_Smed_v4_4872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012757SMESG000068903.1 dd_Smed_v6_4872_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30012757SMESG000068903.1 OX_Smed_1.0.07704ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
oocyteSMED30012757SMESG000068903.1 Contig18250newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30012757SMESG000068903.1 Contig18250uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30012757SMESG000068903.1 Contig18250newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30012757SMESG000068903.1 Contig18250uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30012757SMESG000068903.1 dd_Smed_v4_4872_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30012757SMESG000068903.1 dd_Smed_v4_4872_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tektin-4 vs. Ensembl Human
Match: TEKT4 (tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012])

HSP 1 Score: 357.066 bits (915), Expect = 7.377e-119
Identity = 190/415 (45.78%), Postives = 266/415 (64.10%), Query Frame = 3
Query:  126 NTGCDT--GISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            NTG  T  G++T  FRT KYL EEW    Y +YHQ+  DR+ S+R R ES+ L  ET A+  + Q +ST+ + ERL D + WKSEL+RE++ +  E  LL  QK+RL+ AL AT +P  I TDN+ CR++R   + V D VE  L+KE ++I  +QELLK TI     QI+ N   K+  EMDWS+K+EA   D       + ST  Q +     +QE+ S PET A+ +  ++  A+ ER+AS  LR L++ IL DTS D+R Q DAV +   R  + L D+R KL  +L KT+ EI  QE N+  +K AI+ KE P+ VAQTRL+ R+ RPN+ELC+D AQ +LL+E+++L +SL AL  + + AE SL+NL D  ++LEK+I    NS+FID+QK +  R RYP++L+L GY
Sbjct:   20 NTGAYTSSGLATASFRTSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLKEAELIRNIQELLKRTIMQAVSQIRLNREHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHPYSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELEDARYKLHHHLHKTLREITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSLTALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHRTRYPTILQLAGY 434          
BLAST of Tektin-4 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 256.144 bits (653), Expect = 4.469e-79
Identity = 151/412 (36.65%), Postives = 247/412 (59.95%), Query Frame = 3
Query:  138 DTGISTVGFRTG---KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            +T +  V  RT    +Y P++W+  N   Y +S T R  S++LR ++  LI++    T K QA++T+ L ER++DI FWKSE+  E+ ++  E   L + K+RL+ AL+ T  PL +A + +  R++R G+D V D VE  L+ EVD I   QE +K  ++    Q+  N  ++  LE D S+K  A   D     L+N+S    ++ GV R    +S PE+WA+ +  +IL ++ ER AS +LR  I N+L  T+ +M  Q + V +     I    D++ K++ +L KT+ EI + E  I+ IK AI+ K   +KVAQTRL +R  RPNIELC+D AQ +L+ E+ ++  +++ L+ +  +AE++L++L+  + TLE ++ +K NS++IDQ+K +  R  YP+ L+L G+
Sbjct:   78 NTMLPFVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSYPNTLRLVGF 489          
BLAST of Tektin-4 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 256.144 bits (653), Expect = 4.469e-79
Identity = 151/412 (36.65%), Postives = 247/412 (59.95%), Query Frame = 3
Query:  138 DTGISTVGFRTG---KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            +T +  V  RT    +Y P++W+  N   Y +S T R  S++LR ++  LI++    T K QA++T+ L ER++DI FWKSE+  E+ ++  E   L + K+RL+ AL+ T  PL +A + +  R++R G+D V D VE  L+ EVD I   QE +K  ++    Q+  N  ++  LE D S+K  A   D     L+N+S    ++ GV R    +S PE+WA+ +  +IL ++ ER AS +LR  I N+L  T+ +M  Q + V +     I    D++ K++ +L KT+ EI + E  I+ IK AI+ K   +KVAQTRL +R  RPNIELC+D AQ +L+ E+ ++  +++ L+ +  +AE++L++L+  + TLE ++ +K NS++IDQ+K +  R  YP+ L+L G+
Sbjct:   78 NTMLPFVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSYPNTLRLVGF 489          
BLAST of Tektin-4 vs. Ensembl Human
Match: TEKT1 (tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534])

HSP 1 Score: 250.366 bits (638), Expect = 1.175e-77
Identity = 147/389 (37.79%), Postives = 228/389 (58.61%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYP 1340
            K+LP EWH  N  +YH++   R  S+RL  ES+ L+ E +  T K+Q++  K+L +RL ++ FWK EL+ +++ + +    L   K RL+ AL     PLHI    +  R++R G+D V D VE  LIKE +II  +  LL  T+E  +EQI+ N +AK  LE D  +K  A   D I  +L N+S N ++     R + N  + E W + S  ++  A+ +R  SL L+ L++ IL+ T+ D+R+Q D V+      + +  D+R KL D+L K + EIA QEKNI  ++ AI  +E P KVA TRL  R  RPN+ELC+D AQ +L+ E+Q++  ++  L+     A+  LK L   ++ L++EIQ+K+N+I+ID+   +  R   P
Sbjct:   10 KFLPSEWHIANKNQYHRADAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVQFWKKELDDKLEQLVNVTDDLLIYKIRLEKALETLKEPLHITETCLAYREKRIGIDLVHDTVEHELIKEAEIIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSLEDWLDFSSTNVEKADKQRNNSLMLKALVDRILSQTANDLRKQCDVVDTAFKNGLKDTKDARDKLADHLAKVMEEIASQEKNITALEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLMKEVQEITHNVARLKETLAQAQAELKGLHRRQLALQEEIQVKENTIYIDEVLCMQMRKSIP 398          
BLAST of Tektin-4 vs. Ensembl Human
Match: TEKT5 (tektin 5 [Source:HGNC Symbol;Acc:HGNC:26554])

HSP 1 Score: 218.779 bits (556), Expect = 6.640e-65
Identity = 134/398 (33.67%), Postives = 222/398 (55.78%), Query Frame = 3
Query:  171 GKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
             +Y P +W   N  +   +   R  + RL ++S  L+++ D +T + Q  + + L +RL DI FWKSEL  E+  +  ENQ L   KRRL+ A      PL +A + +  R++R G+D V D VE NLI+EVD++   QE ++   +  + Q++ N +A+ +LE D  +K  A   D     L+N+S    F+ G+ +    +S PETWA+ S+ +I H++  R  S++LR    ++    S  M +Q     +     I  + D + KL+  L KT+ EI + E  I  ++ +I AKE P+KVAQTRL  R  RPN+ELC+D  Q KL+ E+  +  +L+ L+ +    +++L+ L+ T+  LE E+ +K N++ ID++K +  R  +P   +L G+
Sbjct:   87 SRYSPHDWDQSNQLQVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGFWKSELSYELDRLLTENQNLETVKRRLECAANEVNCPLQVALECLYHREKRIGIDLVHDNVEKNLIREVDLLKCCQEQMRKLAQRIDIQMRDNRDAQHVLERDLEDKSSAQCIDEKCFNLRNTSDCISFFHGMEKIDGTISVPETWAKFSNDNIKHSQNMRANSIQLREEAEHLFETLSDQMWRQFTDTNLAFNARISEVTDVKNKLQTQLAKTLQEIFQAENTIMLLERSIMAKEGPLKVAQTRLECRTRRPNMELCRDIPQLKLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKCRLEHELAIKANTLCIDKEKCMGMRKTFPCTPRLVGH 484          
BLAST of Tektin-4 vs. Ensembl Celegans
Match: R02E12.4 (pep chromosome:WBcel235:X:4005314:4007634:1 gene:WBGene00019828.1 transcript:R02E12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R02E12.4)

HSP 1 Score: 124.79 bits (312), Expect = 3.347e-31
Identity = 100/377 (26.53%), Postives = 184/377 (48.81%), Query Frame = 3
Query:  267 SKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGV-DRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNK----------QFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            ++  +KE +   A+ Q ++T++L++R+ D+ +W  E++RE+ D+ +E+  L    RRL   L  TG         +  R ++  V D   D V++ L KE +++    + +K   E    Q++ N +A++ L  D + K EA   D  + A+    T             F  G     + MS    W E +  ++ +A   R+ S ++   +   + + +  +R +A AVE  L  ++ N  + +  L   +     EI   +  I+EI  ++R K  P++VA +R +QR  RP IELC D AQ  L  E+  L+ +  +LE Q   A+ S K L + R  L++++ +  +++ ID + +   R  YP  ++L G+
Sbjct:   17 ARLAVKEANMRAARMQGQTTQQLMQRVKDLKYWSGEIDRELADVKEEHDDLLRCYRRLQLCLDITGRSSRCNESCLAVRRKKVQVGDHTSDRVDMELHKEKELMTDTMKQMKEIGERVERQLEVNQSARKNLLRDLTLKQEAISLDHKSVAIGADGTKTVIRTPDGDRLDFREGAP--LQRMSEYSEWIENTGNNLNYAARARVHSRKIGQKLCQSIREMAHQLRTEAIAVEALLKDSVRNWQEWKDNLHSQVNGKDKEIKNADGAIEEISFSLRQKSGPLQVALSRQNQRGLRPGIELCNDKAQHALHQELMMLKGTFLSLENQLDKAKESRKKLDNDRDKLQRKLDICDHNLTIDNEILRQIRTSYPHEIQLSGF 391          
BLAST of Tektin-4 vs. Ensembl Fly
Match: CG32819 (gene:FBgn0052819 transcript:FBtr0070051)

HSP 1 Score: 207.223 bits (526), Expect = 1.960e-60
Identity = 122/389 (31.36%), Postives = 222/389 (57.07%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYP 1340
            +Y   EW+  N  KY +S  +R +S+R+R ++  L++ETD      Q ++ +RL ER+ D+ FW++EL  E++ +  E   + E +R+   AL+   +PLHIA + +  R+ R G ++V D VE  L+ E++ +   ++ L    E  ++Q      A+ +LE D S+K  +   DS+   L N S    +Y G+ ++  ++S  E+WA+ S +H+  ++ ER    +LR+   +++   +  +            R    + +++ +++ +L+K   E+   EK++  ++ AI+ K  P+KVAQTRL  R+ R  +ELCKD AQD+L+ E+QD+Q ++E L  + + AE + + LL TR TLE +++ K N++FID++K +  R  +P
Sbjct:  125 RYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFP 513          
BLAST of Tektin-4 vs. Ensembl Fly
Match: CG32820 (gene:FBgn0052820 transcript:FBtr0070054)

HSP 1 Score: 207.223 bits (526), Expect = 1.960e-60
Identity = 122/389 (31.36%), Postives = 222/389 (57.07%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYP 1340
            +Y   EW+  N  KY +S  +R +S+R+R ++  L++ETD      Q ++ +RL ER+ D+ FW++EL  E++ +  E   + E +R+   AL+   +PLHIA + +  R+ R G ++V D VE  L+ E++ +   ++ L    E  ++Q      A+ +LE D S+K  +   DS+   L N S    +Y G+ ++  ++S  E+WA+ S +H+  ++ ER    +LR+   +++   +  +            R    + +++ +++ +L+K   E+   EK++  ++ AI+ K  P+KVAQTRL  R+ R  +ELCKD AQD+L+ E+QD+Q ++E L  + + AE + + LL TR TLE +++ K N++FID++K +  R  +P
Sbjct:  125 RYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFP 513          
BLAST of Tektin-4 vs. Ensembl Fly
Match: CG17450 (gene:FBgn0040028 transcript:FBtr0345920)

HSP 1 Score: 207.223 bits (526), Expect = 1.960e-60
Identity = 122/389 (31.36%), Postives = 222/389 (57.07%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYP 1340
            +Y   EW+  N  KY +S  +R +S+R+R ++  L++ETD      Q ++ +RL ER+ D+ FW++EL  E++ +  E   + E +R+   AL+   +PLHIA + +  R+ R G ++V D VE  L+ E++ +   ++ L    E  ++Q      A+ +LE D S+K  +   DS+   L N S    +Y G+ ++  ++S  E+WA+ S +H+  ++ ER    +LR+   +++   +  +            R    + +++ +++ +L+K   E+   EK++  ++ AI+ K  P+KVAQTRL  R+ R  +ELCKD AQD+L+ E+QD+Q ++E L  + + AE + + LL TR TLE +++ K N++FID++K +  R  +P
Sbjct:  125 RYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFP 513          
BLAST of Tektin-4 vs. Ensembl Fly
Match: CG17450 (gene:FBgn0040028 transcript:FBtr0070056)

HSP 1 Score: 207.223 bits (526), Expect = 1.960e-60
Identity = 122/389 (31.36%), Postives = 222/389 (57.07%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYP 1340
            +Y   EW+  N  KY +S  +R +S+R+R ++  L++ETD      Q ++ +RL ER+ D+ FW++EL  E++ +  E   + E +R+   AL+   +PLHIA + +  R+ R G ++V D VE  L+ E++ +   ++ L    E  ++Q      A+ +LE D S+K  +   DS+   L N S    +Y G+ ++  ++S  E+WA+ S +H+  ++ ER    +LR+   +++   +  +            R    + +++ +++ +L+K   E+   EK++  ++ AI+ K  P+KVAQTRL  R+ R  +ELCKD AQD+L+ E+QD+Q ++E L  + + AE + + LL TR TLE +++ K N++FID++K +  R  +P
Sbjct:  125 RYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFP 513          
BLAST of Tektin-4 vs. Ensembl Fly
Match: CG32819 (gene:FBgn0052819 transcript:FBtr0070050)

HSP 1 Score: 206.453 bits (524), Expect = 1.630e-59
Identity = 122/389 (31.36%), Postives = 222/389 (57.07%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYP 1340
            +Y   EW+  N  KY +S  +R +S+R+R ++  L++ETD      Q ++ +RL ER+ D+ FW++EL  E++ +  E   + E +R+   AL+   +PLHIA + +  R+ R G ++V D VE  L+ E++ +   ++ L    E  ++Q      A+ +LE D S+K  +   DS+   L N S    +Y G+ ++  ++S  E+WA+ S +H+  ++ ER    +LR+   +++   +  +            R    + +++ +++ +L+K   E+   EK++  ++ AI+ K  P+KVAQTRL  R+ R  +ELCKD AQD+L+ E+QD+Q ++E L  + + AE + + LL TR TLE +++ K N++FID++K +  R  +P
Sbjct:  206 RYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFP 594          
BLAST of Tektin-4 vs. Ensembl Zebrafish
Match: tekt4 (tektin 4 [Source:ZFIN;Acc:ZDB-GENE-070410-98])

HSP 1 Score: 295.049 bits (754), Expect = 8.492e-95
Identity = 165/411 (40.15%), Postives = 249/411 (60.58%), Query Frame = 3
Query:  132 GCDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            G  TG++T G+R+ KY P+EW   N    +++  DR  ++ +  ES+AL  ETDA T + Q E T  L  RL DI+ W+SELER I+ ++ E  L    +RRL+ AL AT +P  IATDN+ CR++R+G D V+D VE  L+KEV++I  +Q LLK T++ T  QI+ N   K  LE+DWS+K +A   D       N ST+ Q +   A  Q+ + + E W + +  ++  AE E  AS  LR L   +L +T+ D+R Q DAV+    +    ++ ++ +LE +L + + +I  QE+NI +++ A+  KE P++VAQ+RLH R  RPN+E C+D  Q  LL E   L  ++ AL+ Q   A+ SL +L ++R+ LEK+I  K NS+ ID++K +  R RYP+V  L GY
Sbjct:   41 GTSTGLTTAGYRSAKYTPDEWFDNNSALLNRAAADRNQAENICHESRALKAETDAATLRTQTEGTTHLGARLQDIHLWRSELERLIERLSAETDLQISSRRRLEKALDATEIPFAIATDNLTCRERRFGPDLVKDAVEEELLKEVELIRSIQTLLKKTLDQTINQIRLNREVKHTLELDWSDKQQAYSLDDHCGRFSNRSTDTQRHPSSAVLQDQVCDEEVWRKFTVDNLRLAEREETASQALRRLTERVLQETTEDLRAQCDAVDRAFTQRCVEMSQAKTQLELHLAQILEQIGAQERNISQLQEAVHDKEAPLRVAQSRLHYRTLRPNMEQCRDQPQLSLLGEASKLSNTVSALQQQLYEAQKSLSDLEESRLNLEKDIACKTNSLLIDREKCMTHRTRYPTVTVLSGY 451          
BLAST of Tektin-4 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 279.256 bits (713), Expect = 2.138e-88
Identity = 149/399 (37.34%), Postives = 249/399 (62.41%), Query Frame = 3
Query:  168 TGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            + +Y+PE+W+  N   Y +S + R  ++RLR ++  LI++ + +T + Q  ++K + ERL+DI+FW+SE+  EI ++  E   L + KRRL+ AL  T  PL +A + +  R++R  +D V D VEI+LIKEVD+I   QE ++  +E    Q+  N  A+  LE D S+K+ A   D     L+N+S    +Y G+ R   ++S P++W++ +  +ILH++ ER AS +LR  I  +L  TS +M  Q ++V V     I    D++  L+ +L KT+ EI + E  I+ +K AIR KE+P+KVAQTRL +R  RPN+ELC+D    +L+ E+++++ ++  L  + + AEN+L+ L+ T++TLE ++ +K NS+F+DQ+K +  R  +PS  +L G+
Sbjct:   74 STRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSFPSTPRLVGF 472          
BLAST of Tektin-4 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 279.256 bits (713), Expect = 3.770e-88
Identity = 149/399 (37.34%), Postives = 249/399 (62.41%), Query Frame = 3
Query:  168 TGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            + +Y+PE+W+  N   Y +S + R  ++RLR ++  LI++ + +T + Q  ++K + ERL+DI+FW+SE+  EI ++  E   L + KRRL+ AL  T  PL +A + +  R++R  +D V D VEI+LIKEVD+I   QE ++  +E    Q+  N  A+  LE D S+K+ A   D     L+N+S    +Y G+ R   ++S P++W++ +  +ILH++ ER AS +LR  I  +L  TS +M  Q ++V V     I    D++  L+ +L KT+ EI + E  I+ +K AIR KE+P+KVAQTRL +R  RPN+ELC+D    +L+ E+++++ ++  L  + + AEN+L+ L+ T++TLE ++ +K NS+F+DQ+K +  R  +PS  +L G+
Sbjct:   89 STRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSFPSTPRLVGF 487          
BLAST of Tektin-4 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 279.256 bits (713), Expect = 3.770e-88
Identity = 149/399 (37.34%), Postives = 249/399 (62.41%), Query Frame = 3
Query:  168 TGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            + +Y+PE+W+  N   Y +S + R  ++RLR ++  LI++ + +T + Q  ++K + ERL+DI+FW+SE+  EI ++  E   L + KRRL+ AL  T  PL +A + +  R++R  +D V D VEI+LIKEVD+I   QE ++  +E    Q+  N  A+  LE D S+K+ A   D     L+N+S    +Y G+ R   ++S P++W++ +  +ILH++ ER AS +LR  I  +L  TS +M  Q ++V V     I    D++  L+ +L KT+ EI + E  I+ +K AIR KE+P+KVAQTRL +R  RPN+ELC+D    +L+ E+++++ ++  L  + + AEN+L+ L+ T++TLE ++ +K NS+F+DQ+K +  R  +PS  +L G+
Sbjct:   89 STRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSFPSTPRLVGF 487          
BLAST of Tektin-4 vs. Ensembl Zebrafish
Match: tekt1 (tektin 1 [Source:ZFIN;Acc:ZDB-GENE-041114-99])

HSP 1 Score: 204.142 bits (518), Expect = 2.014e-60
Identity = 138/384 (35.94%), Postives = 216/384 (56.25%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSST-----NKQF-YAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQ 1307
            ++LP EW   N E Y  S   R+ S++L  E + LI+E +    + Q ++ KRL  R+ DI FW+ EL ++ + +  E + L   K R++ AL +   P  +    +  R +R  +D V D VE  L+KE +++  V  LL+ T+E  NEQI+   + K  LE D  +K +A+  D   + L N+S      N  F Y+G A        PE W    + +I  AE E+  SL LR L++++L  T+RDMR+Q +         I+    ++ +LE+ L + + EIA QEKN D ++ A+  KE P+KVAQTRL  R+ RPN+ELC DP Q +LLA++++L   ++ L      +E+ LK L   ++ LE+EIQ+K NS++ID+
Sbjct:   10 RFLPSEWKHANQEHYRSSEAGRKHSEKLTAECERLIEECNKSNKRMQHDTQKRLERRIQDIKFWRQELVQKFEQMVQEIETLIIYKSRVEKALESCSEPFQVTLQCLAERQKRVAIDLVHDEVEEELLKEKEVVEGVMVLLQRTLEQINEQIRLIRSVKYYLEKDLQDKFQAEHIDDFCSLLTNTSPDLNEGNSSFKYSGAA------VTPEEWESLCNLNISKAEKEKNNSLSLRALVDSLLEQTARDMRRQYETTGRAFDLRIEETKTAKEQLENQLNELLAEIANQEKNQDALRLAVAEKEAPLKVAQTRLSTRSQRPNVELCHDPPQIQLLAQIKELTNHVQRLSEALELSESELKALAYNQLRLEEEIQVKTNSLYIDE 387          
BLAST of Tektin-4 vs. Ensembl Xenopus
Match: plcd1 (phospholipase C delta 1 [Source:Xenbase;Acc:XB-GENE-1013054])

HSP 1 Score: 399.823 bits (1026), Expect = 2.591e-135
Identity = 207/415 (49.88%), Postives = 294/415 (70.84%), Query Frame = 3
Query:  126 NTG--CDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            NTG    +G++T GFRT KYL EEW   N   ++++ +DR+ S+  R E+K L+ ET+A   ++QA+ TK L ERL DI+FWKSEL REI+D+  E QLL +QK RL+ AL AT +P  IATDN+ CRD+R G + V D VE+ L+KEVD+I  VQELLK T++ T +QI++N +AK+ LEMD+S+K+EA E D       N ST+ QF+   ++Y++N S PE+WA+ +H++I  AE ERMAS+ LR+LI++IL D S D+  Q+ A+ V+  +    + D++ KLE +LKKT+ EI  QEKNI  +K AI  K  P+KVAQTRLH R++RPN+ELC+D  Q +L++E+ +L  SL+AL+ +  ++E SL+NL DTR++LEK+I  K NSIFID++K +  R RYP  +KL GY
Sbjct:   45 NTGPYSSSGLATAGFRTAKYLHEEWQQGNLATFYRAFSDRDQSETGRHEAKQLVTETEARAQRSQADCTKSLGERLLDIHFWKSELAREIRDVEAETQLLVQQKGRLERALDATDIPFSIATDNLKCRDRRRGSELVRDEVELELLKEVDLIRNVQELLKRTLDQTVQQIRQNRDAKENLEMDYSDKVEAYEFDDKCGRYNNQSTDIQFHRNSSKYEDNTSTPESWAQYTHENIYKAERERMASINLRSLIDSILQDISEDLEAQSAAIAVDFEKRCREVEDAKQKLEMHLKKTLEEIGGQEKNIAALKQAINDKSPPLKVAQTRLHDRSYRPNVELCRDHVQIRLVSEVGELTDSLDALKLKLEDSEQSLRNLEDTRMSLEKDIANKANSIFIDREKCMTLRTRYPHGMKLLGY 459          
BLAST of Tektin-4 vs. Ensembl Xenopus
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:549229])

HSP 1 Score: 278.1 bits (710), Expect = 1.518e-87
Identity = 163/432 (37.73%), Postives = 254/432 (58.80%), Query Frame = 3
Query:   84 LSETNYSVGSCYQGNTGCDTG--ISTVGFRTG---KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            ++  N S+    + + G +    +S    RT    +Y P++W+  N   Y  S + R  ++RLR ++  LI+E D  T K Q+++ K L ER++DI+FWKSE+  EI  +  E   L E KRR++ AL+ T  PL ++ + +  R++R  +D V D VE  LI+EVD I   QE ++  ++  + Q+  N  A+  LE D S+K  A   D     L+NSS    ++ GV R    +S PETWA+ S  +IL ++ +R+AS +LR     IL  TS DM  Q +AV V     I    D++ KL+++L KT+ EI + E  I+ IK AI+ K  P+KVAQTRL +R  RPN+ELC+D  Q +L+ E+QD+  +++AL+ +   AE++L+ L+ T+  LE ++ +K NS+FIDQ+K +  R  +PS  +L GY
Sbjct:   58 VASANPSLAPLSKSSPGLNPSQILSFPSNRTALFTRYTPDDWYKSNQVNYRDSESSRRSAERLRVDTSRLIQEKDQKTRKVQSDTNKDLGERVNDISFWKSEIIHEIDQMIGETNALSEMKRRMERALMETEGPLQVSQECLYHREKRMSIDLVHDDVEKQLIQEVDCIKSCQEKMRRHLQKISAQLASNRAAQHELERDISDKQTALRIDDKCQNLRNSSDGIGYFRGVERMDATVSIPETWAKYSDDNILRSQSDRVASTKLREDAETILASTSNDMWGQFNAVNVNFTSRISETADAKNKLQNHLAKTLQEIFQTEMTIEAIKKAIKDKSAPLKVAQTRLDERTRRPNVELCRDSVQMRLIQEVQDIDNTIQALQLRLREAEDALQMLIHTKSILEHDLAIKANSLFIDQEKCMGMRKSFPSTPRLVGY 489          
BLAST of Tektin-4 vs. Ensembl Xenopus
Match: gdf10 (growth differentiation factor 10 [Source:Xenbase;Acc:XB-GENE-5998698])

HSP 1 Score: 252.292 bits (643), Expect = 1.278e-78
Identity = 149/378 (39.42%), Postives = 231/378 (61.11%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQ 1307
            K+LP+EW+  N   Y ++ + R  S+RL  ES+ L+ E +  T  +Q +  K+L +RL +I FWK EL+ +++D  ++   L   K RL+ AL +   PL IA   +  R++R G+D V D  E  LIKEV++I  V  LL+ TIE   EQI+ + +AK  LE D  +K +A + D+  A L N+S +  + A   R + N   P  W   ++ +IL AE +R  ++ LR+LI+ IL++T+ D+ +Q D     L   I    D++ KLE++L K + EI+ QEKNI+ +K A+  KE P+K+AQTRL  R  RPN+ELC+DP Q +L+ E+Q++  ++E L      AE  LK L   +++LE+EIQ+K+NSI+ID+
Sbjct:   10 KFLPKEWNIANKTCYARAESQRSRSERLVAESQRLVDEIEKTTQNSQKDVNKKLDQRLEEIQFWKKELDSKLEDTVNDIAQLLAYKIRLEKALESCKEPLSIAQQCLIEREKRVGIDLVHDEAERELIKEVEVIQGVMTLLERTIEQITEQIRMSRSAKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIDYSANTVRIEANSVTPIEWENYTNTNILKAEKQRNNAIALRSLIDGILSETASDICKQCDTATYALKNRIQETKDAKNKLEEHLAKVMDEISSQEKNIEILKKALADKEGPMKMAQTRLDTRTLRPNVELCRDPVQYRLINEVQEITTNVERLRETLAQAEAELKALNRNQLSLEEEIQVKENSIYIDE 387          
BLAST of Tektin-4 vs. Ensembl Xenopus
Match: fam168a (family with sequence similarity 168 member A [Source:Xenbase;Acc:XB-GENE-5856038])

HSP 1 Score: 146.362 bits (368), Expect = 1.795e-39
Identity = 102/307 (33.22%), Postives = 169/307 (55.05%), Query Frame = 3
Query:  252 RLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQ 1172
            RL  ES+ L+ E++  T K+Q +  K+L +RL +I FWK EL+ +++D  ++   L   K RL+ +L     PL +A   +  +++R G+D V D  E  LIK VD+I  V  LL+              N+K  LE D  +K +A + D+  A L N+S +  + A   R + N   P  W + ++ +I+ AE  R  ++ LR+LI+ IL++T+ D+           A+N         KLE++L K ++EI+ QEKNI+ +K A+  KE P+K+ Q RL  R  RPN+EL ++   + L+++++
Sbjct:   18 RLVAESQRLVDESEKTTQKSQKDFNKKLDQRLEEIQFWK-ELDSKLEDTVNDIAQLLACKFRLEKSLERCKEPLSLAQQCLIKQEKRVGIDLVHDEAEQELIKAVDVIQGVMTLLE----------YNRTNSKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIGYSANTVRIEANSVTPIEWEDFTNTNIVKAEKRRNNAVALRSLIDGILSETASDI----------YAKN---------KLEEHLAKVISEISSQEKNIEILKKALADKEGPMKMEQIRLDTRTLRPNVELFQEITTNALISDLE 294          
BLAST of Tektin-4 vs. Ensembl Xenopus
Match: fam168a (family with sequence similarity 168 member A [Source:Xenbase;Acc:XB-GENE-5856038])

HSP 1 Score: 138.658 bits (348), Expect = 8.800e-37
Identity = 96/277 (34.66%), Postives = 152/277 (54.87%), Query Frame = 3
Query:  300 TAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIEL 1130
            T K+Q +  K+L +RL +I FWK EL+ +++D  ++   L   K RL+ +L     PL +A   +  +++R G+D V D  E  LIK VD+I  V  LL           + +L+AK  LE D  +K +A + D+  A L N+S +  + A   R + N   P  W + ++ +I+ AE  R  ++ LR+LI+ IL++T+ D+           A+N         KLE++L K ++EI+ QEKNI+ +K A+  KE P+K+ Q RL  R  RPN+EL
Sbjct:    1 TQKSQKDFNKKLDQRLEEIQFWK-ELDSKLEDTVNDIAQLLACKFRLEKSLERCKEPLSLAQQCLIKQEKRVGIDLVHDEAEQELIKAVDVIQGVMTLL-----------EMSLSAKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIGYSANTVRIEANSVTPIEWEDFTNTNIVKAEKRRNNAVALRSLIDGILSETASDI----------YAKN---------KLEEHLAKVISEISSQEKNIEILKKALADKEGPMKMEQIRLDTRTLRPNVEL 246          
BLAST of Tektin-4 vs. Ensembl Mouse
Match: Tekt4 (tektin 4 [Source:MGI Symbol;Acc:MGI:1919090])

HSP 1 Score: 393.275 bits (1009), Expect = 4.181e-133
Identity = 201/415 (48.43%), Postives = 287/415 (69.16%), Query Frame = 3
Query:  126 NTGCDT--GISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            NTG  T  G++T GFRT KYL +EW   +Y +YHQ+  DR+ S+R R ES  L+ ET A+  + Q +ST+++ ERL D++ WKSEL+REI +++ E  L+  QK RL  AL AT +P  IATDN+ CR++R   D V D VE+ L+KE ++I  +QELLK TI    +QI+ N   K+  EM+WS+K+E    D   +   N ST  QFY   ++++E+ S PETWA+ +H ++L AE ER+AS+ LR LI+ IL DT+ D+R Q DAV    +     L+DS  KL+ +L+KT+TEI  QE  I  +K AI+ KE P++VAQTRL+QR+ RPN+ELC+D AQ +LL+E+++L +SL AL+ +  +AE +L+NL D+R++LEK+I +K NS+FID+QK +  RNRYPSVL+L GY
Sbjct:   32 NTGAYTSSGLATAGFRTAKYLRDEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVEVELLKETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTHRNRYPSVLQLAGY 446          
BLAST of Tektin-4 vs. Ensembl Mouse
Match: Tekt4 (tektin 4 [Source:MGI Symbol;Acc:MGI:1919090])

HSP 1 Score: 382.104 bits (980), Expect = 1.056e-128
Identity = 199/415 (47.95%), Postives = 283/415 (68.19%), Query Frame = 3
Query:  126 NTGCDT--GISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            NTG  T  G++T GFRT KYL +EW   +Y +YHQ+  DR+ S+R R ES  L+ ET A+  + Q +ST+++ ERL D++ WKSEL+REI +++ E  L+  QK RL  AL AT +P  IATDN+ CR++R   D V D VE     E ++I  +QELLK TI    +QI+ N   K+  EM+WS+K+E    D   +   N ST  QFY   ++++E+ S PETWA+ +H ++L AE ER+AS+ LR LI+ IL DT+ D+R Q DAV    +     L+DS  KL+ +L+KT+TEI  QE  I  +K AI+ KE P++VAQTRL+QR+ RPN+ELC+D AQ +LL+E+++L +SL AL+ +  +AE +L+NL D+R++LEK+I +K NS+FID+QK +  RNRYPSVL+L GY
Sbjct:   32 NTGAYTSSGLATAGFRTAKYLRDEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVE-----ETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTHRNRYPSVLQLAGY 441          
BLAST of Tektin-4 vs. Ensembl Mouse
Match: Tekt4 (tektin 4 [Source:MGI Symbol;Acc:MGI:1919090])

HSP 1 Score: 316.62 bits (810), Expect = 6.274e-104
Identity = 163/343 (47.52%), Postives = 229/343 (66.76%), Query Frame = 3
Query:  126 NTGCDT--GISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQ 1148
            NTG  T  G++T GFRT KYL +EW   +Y +YHQ+  DR+ S+R R ES  L+ ET A+  + Q +ST+++ ERL D++ WKSEL+REI +++ E  L+  QK RL  AL AT +P  IATDN+ CR++R   D V D VE+ L+KE ++I  +QELLK TI    +QI+ N   K+  EM+WS+K+E    D   +   N ST  QFY   ++++E+ S PETWA+ +H ++L AE ER+AS+ LR LI+ IL DT+ D+R Q DAV    +     L+DS  KL+ +L+KT+TEI  QE  I  +K AI+ KE P++VAQTRL+QR+ RPN+ELC+D AQ
Sbjct:   32 NTGAYTSSGLATAGFRTAKYLRDEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVEVELLKETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQ 374          
BLAST of Tektin-4 vs. Ensembl Mouse
Match: Tekt3 (tektin 3 [Source:MGI Symbol;Acc:MGI:1918312])

HSP 1 Score: 254.218 bits (648), Expect = 2.126e-78
Identity = 152/429 (35.43%), Postives = 250/429 (58.28%), Query Frame = 3
Query:   96 NYSVGSCYQGNTG--CD-TGISTVGFRTG---KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            NY   + Y   +   C+ T +  V  RT    +Y P++W+  N   + +S + R  S+RLR ++  LI++      K QA ST+ L ER++D+ FWKSE+  E+ ++  E   L + KRRL+  LI T  PL ++ + +  R++R G+D V D  E  L+ EVD I   QE ++  ++  N Q+  + +A+  LE D S+K  A   D     L+N+S    ++ GV R    +S PETWA+ +  ++L ++ ER AS +LR    N+L  T+ +M  Q + V +     I    D++ K+  +L KT+ EI + E  I+ IK AI+ K   +KVAQTRL +R  RPN+ELC+D AQ +L+ E+ ++  +++ L+ +  ++E++L++L  T+ TLE ++ +K N+++IDQ+K +  RN YPS L+L GY
Sbjct:   61 NYPTLAPYSSRSQRVCESTMLPFVSNRTTFFTRYTPDDWYRSNLVSFQESNSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEITHELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLVHDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQHELEKDLSDKQAALRIDDKCQHLRNTSEGVSYFRGVERVDATVSVPETWAKFTDDNVLRSQSERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIHTHLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELCRDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSYPSTLRLVGY 489          
BLAST of Tektin-4 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 249.595 bits (636), Expect = 1.436e-77
Identity = 150/412 (36.41%), Postives = 238/412 (57.77%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGYNA*AYESHFTVNIVC 1409
            ++LPEEW+  N  +YH++   R  S+RL  ES+ L++E +  T K+Q++  K+L +RL ++ FWK EL+ +++ + ++   L   K RL+ +L +   PLHI    +  R++R G+D V D VE  L KE DII+ V  LL  T+E + EQI+ N +AK  LE D  +K  A   D +  +L N+S N  F   V R + N  + E W + S+ ++  A+ +   S  L+TL++ IL+ T+ D+R+Q + V+      +    D+R KL D+L K + EIA QEKNI  ++ AI  +E P KVA TRL  R  RPN+ELC+D AQ +L+ E+Q++  ++  L+     A+  LK L   ++ L++EIQ+K+N+I+IDQ   +  R   P      G +  A+E       +C
Sbjct:   10 RFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIPP---RDGDDHGAWEGGIRAEAIC 418          
BLAST of Tektin-4 vs. UniProt/SwissProt
Match: sp|Q5PPV2|TEKT4_XENLA (Tektin-4 OS=Xenopus laevis OX=8355 GN=tekt4 PE=2 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 6.966e-138
Identity = 209/415 (50.36%), Postives = 293/415 (70.60%), Query Frame = 3
Query:  126 NTG--CDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            NTG    +G++T GFRT KYL EEW   N   ++Q+ +DR+ S++ R ESK L+ ET+A   ++QA+ TK L ERL DI+FWKSEL REI+D+  E QLL +QK RL+ AL AT +P  IATDN+ CRD+R G + V D VE+ L+KEVD+I  VQELLK T++   +QI++N +AK+ LEMD+S+K EA E D       N ST+ QF+   ++Y++N S PE+WA+ +H++I  AE ERMAS+ LR+LI++IL D S D++ Q DA+ V+  +    L D++ KLE +LKKT+ EI  QEKNI  +K AI  K  P+KVAQTRLH+R++RPN+ELC+D  Q +L++E+ +L  S +AL+ +   +E SL+NL DTR++LEK+I  K NSIFID++K +  R RYP  +KL GY
Sbjct:   31 NTGPHSSSGLATAGFRTAKYLHEEWQQGNLTTFYQAFSDRDQSEKGRHESKQLVAETEARAQRSQADCTKSLGERLLDIHFWKSELSREIRDVGAETQLLVQQKVRLERALDATDIPFTIATDNLKCRDRRRGSELVRDDVEMQLLKEVDLIRNVQELLKRTLDQAAQQIRQNRDAKEALEMDYSDKAEAYEFDDKCGRYNNQSTDIQFHLNSSKYEDNTSTPESWAQYTHENIYKAERERMASINLRSLIDSILQDISEDLQAQFDAIAVDFEKRCRELEDAKQKLEMHLKKTLEEIGGQEKNIAALKQAINDKSPPLKVAQTRLHERSYRPNVELCRDHVQIRLVSEVGELTDSFDALKLKLEESEQSLRNLEDTRMSLEKDIANKANSIFIDREKCMTHRTRYPHGMKLLGY 445          
BLAST of Tektin-4 vs. UniProt/SwissProt
Match: sp|Q2TA38|TEKT4_BOVIN (Tektin-4 OS=Bos taurus OX=9913 GN=TEKT4 PE=2 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 7.133e-136
Identity = 204/415 (49.16%), Postives = 287/415 (69.16%), Query Frame = 3
Query:  126 NTGCDT--GISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            NTG  T  G++T GFRT KYL +EW    Y +YHQ+  DR+ S+R R ES+ L  ET+A+  + Q +ST+++ ERL D++ WKSEL+R+++++  E +LL  QK+RL+ AL AT  P  I TDN+ CR++R   D V D VEI L+KE ++I  +QELLK TI+    QI+ N   K+  EMDWS+K+EA   D       N ST+ QFY   A+++E+ S PETWA+ + +H+  AE ER+AS+ LR LI+ IL DTS D+R Q DAV +   R  + L D+R KLE +L+KT+ EI+ QE NI  +K AI+ KE P+KVAQTRL+QR+ RPN+ELC+D AQ +L +E+++L LSL AL+ + + AE SL+NL DTR++LEK+I +K NS+FID+ K +  R  YP+VL+L GY
Sbjct:   32 NTGAHTSSGLATSGFRTAKYLLDEWFQNCYARYHQAFADRDQSERQRHESQQLAAETEALAQRTQQDSTRKVGERLQDMHGWKSELQRQVEELVSETELLLAQKQRLERALDATAGPFSIVTDNLQCRERRQHPDLVRDCVEIELLKEAELIRNIQELLKRTIKQAVSQIRLNWEHKETCEMDWSDKVEAYNIDEACCRYNNQSTDVQFYPHSAKFEESASTPETWAKFTQEHLYRAERERLASVNLRNLIDCILQDTSEDLRLQCDAVNLAFGRRCEELEDARHKLEHHLRKTLREISDQEHNIAALKQAIKDKEAPLKVAQTRLYQRSHRPNVELCRDAAQFRLASEVEELNLSLAALKEKLLEAEQSLRNLEDTRMSLEKDIAIKTNSLFIDRHKCMAHRAHYPTVLQLAGY 446          
BLAST of Tektin-4 vs. UniProt/SwissProt
Match: sp|Q149S1|TEKT4_MOUSE (Tektin-4 OS=Mus musculus OX=10090 GN=Tekt4 PE=1 SV=2)

HSP 1 Score: 393.275 bits (1009), Expect = 2.924e-132
Identity = 201/415 (48.43%), Postives = 287/415 (69.16%), Query Frame = 3
Query:  126 NTGCDT--GISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            NTG  T  G++T GFRT KYL +EW   +Y +YHQ+  DR+ S+R R ES  L+ ET A+  + Q +ST+++ ERL D++ WKSEL+REI +++ E  L+  QK RL  AL AT +P  IATDN+ CR++R   D V D VE+ L+KE ++I  +QELLK TI    +QI+ N   K+  EM+WS+K+E    D   +   N ST  QFY   ++++E+ S PETWA+ +H ++L AE ER+AS+ LR LI+ IL DT+ D+R Q DAV    +     L+DS  KL+ +L+KT+TEI  QE  I  +K AI+ KE P++VAQTRL+QR+ RPN+ELC+D AQ +LL+E+++L +SL AL+ +  +AE +L+NL D+R++LEK+I +K NS+FID+QK +  RNRYPSVL+L GY
Sbjct:   32 NTGAYTSSGLATAGFRTAKYLRDEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVEVELLKETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTHRNRYPSVLQLAGY 446          
BLAST of Tektin-4 vs. UniProt/SwissProt
Match: sp|Q6AXV2|TEKT4_RAT (Tektin-4 OS=Rattus norvegicus OX=10116 GN=Tekt4 PE=2 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 2.795e-126
Identity = 197/429 (45.92%), Postives = 285/429 (66.43%), Query Frame = 3
Query:   84 LSETNYSVGSCYQGNTGCDT--GISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            L +  Y V      NTG  T  G++T GFRT KYL +EW   +Y +YHQ+  DR+ S+R R ESK L  ET  +  + Q +ST+R+ ERL D++ WKSEL+REI +++ E   +  QK RL  AL A  +P  IATDN+ CR++R   D V D VE+ L+KE ++I  +QELLK T+     QI+ N   K+  E++WS+K+E    D   A   N ST  QFY   ++++E+ S PETW + +   +L AE ER+AS+ LR LI+ IL DT+ D+R Q DAV +  +   + LND+R KL+ +L K ++EI  QE  I  +K AI+ KE P++VAQTRL+QR+ RPN+ELC+D AQ +L++E+++L +SL+ L+ +  +AE +L+NL D+R++LEK+I +K NS+FID+QK +  RNRYPSVL+L GY
Sbjct:   22 LPQKKYEVAC----NTGAYTSAGLATAGFRTAKYLMDEWFQNSYARYHQAFADRDYSERQRHESKQLAAETGELAYRTQLDSTRRVGERLEDMHCWKSELQREIDELSSETDQMMAQKLRLQRALDALSVPFSIATDNLQCRERRQHPDLVRDYVEVELLKETELIRNIQELLKRTMGQAVGQIRLNREHKENCEINWSDKVEVYNIDDTCARYTNESTQVQFYPHSSKFEESASTPETWGKFTQDVLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNLAFSNRCEELNDARQKLQYHLLKILSEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLMSEVEELNMSLKVLKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTHRNRYPSVLQLAGY 446          
BLAST of Tektin-4 vs. UniProt/SwissProt
Match: sp|Q8WW24|TEKT4_HUMAN (Tektin-4 OS=Homo sapiens OX=9606 GN=TEKT4 PE=1 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 3.542e-118
Identity = 190/415 (45.78%), Postives = 266/415 (64.10%), Query Frame = 3
Query:  126 NTGCDT--GISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            NTG  T  G++T  FRT KYL EEW    Y +YHQ+  DR+ S+R R ES+ L  ET A+  + Q +ST+ + ERL D + WKSEL+RE++ +  E  LL  QK+RL+ AL AT +P  I TDN+ CR++R   + V D VE  L+KE ++I  +QELLK TI     QI+ N   K+  EMDWS+K+EA   D       + ST  Q +     +QE+ S PET A+ +  ++  A+ ER+AS  LR L++ IL DTS D+R Q DAV +   R  + L D+R KL  +L KT+ EI  QE N+  +K AI+ KE P+ VAQTRL+ R+ RPN+ELC+D AQ +LL+E+++L +SL AL  + + AE SL+NL D  ++LEK+I    NS+FID+QK +  R RYP++L+L GY
Sbjct:   20 NTGAYTSSGLATASFRTSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLKEAELIRNIQELLKRTIMQAVSQIRLNREHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHPYSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELEDARYKLHHHLHKTLREITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSLTALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHRTRYPTILQLAGY 434          
BLAST of Tektin-4 vs. TrEMBL
Match: A0A267EH03 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025843g1 PE=4 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 267/416 (64.18%), Postives = 341/416 (81.97%), Query Frame = 3
Query:  117 YQGNTGCDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            Y+GNTG   GISTVGFR+ K  P EW   NY+KY+QS  DRE SQ++R++++++IKET+A+T KNQA+STK+L ERLHDINFWK+ELEREIQD+ DE  LLC QK RL+NAL+AT +PLHIATDN+NCR +RYGVD VED VE+ L+KEVDIINKVQ+LLK TIE +++QI+ N  AK+ LEMDWS+K EADE D++ A L+N +TNKQF+AGVAR+QE  S PE+WA+ SH +I+ AE ERMAS +LR LI+NIL DTSRDMR+QAD VEV   R I+ L D++ KLEDNLKKT  EIA+QEKNI+E++AAI+AK+DP+KVAQTRL+ R  RPN++LC+DPAQ  L+ E+QD+  S++AL  +   +EN LK+L+DTR+ LEKEIQ+KKNSIFID+ K +P R+RYP+ LKLQGY
Sbjct:   26 YRGNTGNTMGISTVGFRSEKRNPGEWQDSNYQKYYQSFVDRENSQKVRKDTQSMIKETEALTQKNQAQSTKKLKERLHDINFWKTELEREIQDVLDETDLLCAQKVRLENALMATEIPLHIATDNLNCRRRRYGVDLVEDDVELGLLKEVDIINKVQDLLKRTIEQSDKQIKLNRAAKESLEMDWSDKKEADEIDAVCANLRNGNTNKQFHAGVARFQEIQSTPESWAQNSHDNIVRAEHERMASQQLRQLIDNILVDTSRDMREQADIVEVAFQRRIEELIDAKAKLEDNLKKTCGEIAQQEKNIEELRAAIKAKDDPLKVAQTRLYNRQSRPNVDLCRDPAQYNLIGEVQDISNSMDALTQELTMSENQLKDLMDTRMALEKEIQMKKNSIFIDKDKCVPHRDRYPTTLKLQGY 441          
BLAST of Tektin-4 vs. TrEMBL
Match: A0A1I8IVP9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 266/416 (63.94%), Postives = 341/416 (81.97%), Query Frame = 3
Query:  117 YQGNTGCDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            Y+GNTG   GISTVGFR+ K  P EW   NY+KY+QS  DRE SQ++R++++++IKET+A+T KNQA+STK+L ERLHDINFWK+ELEREIQD+ DE  LLC QK RL+NAL+AT +PLHIATDN+NCR +RYGVD VED VE+ L+KEVDIINKVQ+LLK TIE +++QI+ N  AK+ LEMDWS+K EADE D++ A L+N +TNKQF+AGVAR+QE  S PE+WA+ SH +I+ AE ERMAS +LR LI+NIL DTSRDMR+QAD VEV   R I+ L D++ KLEDNLKKT  EIA+QEKNI++++AAI+AK+DP+KVAQTRL+ R  RPN++LC+DPAQ  L+ E+QD+  S++AL  +   +EN LK+L+DTR+ LEKEIQ+KKNSIFID+ K +P R+RYP+ LKLQGY
Sbjct:   16 YRGNTGNTMGISTVGFRSEKRNPGEWQDSNYQKYYQSFVDRENSQKVRKDTQSMIKETEALTQKNQAQSTKKLKERLHDINFWKTELEREIQDVLDETDLLCAQKVRLENALMATEIPLHIATDNLNCRRRRYGVDLVEDDVELGLLKEVDIINKVQDLLKRTIEQSDKQIKLNRAAKESLEMDWSDKKEADEIDAVCANLRNGNTNKQFHAGVARFQEIQSTPESWAQNSHDNIVRAEHERMASQQLRQLIDNILVDTSRDMREQADIVEVAFQRRIEELIDAKAKLEDNLKKTCGEIAQQEKNIEDLRAAIKAKDDPLKVAQTRLYNRQSRPNVDLCRDPAQYNLIGEVQDISNSMDALTQELTMSENQLKDLMDTRMALEKEIQMKKNSIFIDKDKCVPHRDRYPTTLKLQGY 431          
BLAST of Tektin-4 vs. TrEMBL
Match: A0A267EN10 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026600g1 PE=4 SV=1)

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 266/416 (63.94%), Postives = 341/416 (81.97%), Query Frame = 3
Query:  117 YQGNTGCDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            Y+GNTG   GISTVGFR+ K  P EW   NY+KY+QS  DRE SQ++R++++++IKET+A+T KNQA+STK+L ERLHDINFWK+ELEREIQD+ DE  LLC QK RL+NAL+AT +PLHIATDN+NCR +RYGVD VED VE+ L+KEVDIINKVQ+LLK TIE +++QI+ N  AK+ LEMDWS+K EADE D++ A L+N +TNKQF+AGVAR+QE  S PE+WA+ SH +I+ AE ERMAS +LR LI+NIL DTSRDMR+QAD VEV   R I+ L D++ KLEDNLKKT  EIA+QEKNI++++AAI+AK+DP+KVAQTRL+ R  RPN++LC+DPAQ  L+ E+QD+  S++AL  +   +EN LK+L+DTR+ LEKEIQ+KKNSIFID+ K +P R+RYP+ LKLQGY
Sbjct:   25 YRGNTGNTMGISTVGFRSEKRNPGEWQDSNYQKYYQSFVDRENSQKVRKDTQSMIKETEALTQKNQAQSTKKLKERLHDINFWKTELEREIQDVLDETDLLCAQKVRLENALMATEIPLHIATDNLNCRRRRYGVDLVEDDVELGLLKEVDIINKVQDLLKRTIEQSDKQIKLNRAAKESLEMDWSDKKEADEIDAVCANLRNGNTNKQFHAGVARFQEIQSTPESWAQNSHDNIVRAEHERMASQQLRQLIDNILVDTSRDMREQADIVEVAFQRRIEELIDAKAKLEDNLKKTCGEIAQQEKNIEDLRAAIKAKDDPLKVAQTRLYNRQSRPNVDLCRDPAQYNLIGEVQDISNSMDALTQELTMSENQLKDLMDTRMALEKEIQMKKNSIFIDKDKCVPHRDRYPTTLKLQGY 440          
BLAST of Tektin-4 vs. TrEMBL
Match: A0A1I8FZ59 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 266/416 (63.94%), Postives = 341/416 (81.97%), Query Frame = 3
Query:  117 YQGNTGCDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            Y+GNTG   GISTVGFR+ K  P EW   NY+KY+QS  DRE SQ++R++++++IKET+A+T KNQA+STK+L ERLHDINFWK+ELEREIQD+ DE  LLC QK RL+NAL+AT +PLHIATDN+NCR +RYGVD VED VE+ L+KEVDIINKVQ+LLK TIE +++QI+ N  AK+ LEMDWS+K EADE D++ A L+N +TNKQF+AGVAR+QE  S PE+WA+ SH +I+ AE ERMAS +LR LI+NIL DTSRDMR+QAD VEV   R I+ L D++ KLEDNLKKT  EIA+QEKNI++++AAI+AK+DP+KVAQTRL+ R  RPN++LC+DPAQ  L+ E+QD+  S++AL  +   +EN LK+L+DTR+ LEKEIQ+KKNSIFID+ K +P R+RYP+ LKLQGY
Sbjct:   16 YRGNTGNTMGISTVGFRSEKRNPGEWQDSNYQKYYQSFVDRENSQKVRKDTQSMIKETEALTQKNQAQSTKKLKERLHDINFWKTELEREIQDVLDETDLLCAQKVRLENALMATEIPLHIATDNLNCRRRRYGVDLVEDDVELGLLKEVDIINKVQDLLKRTIEQSDKQIKLNRAAKESLEMDWSDKKEADEIDAVCANLRNGNTNKQFHAGVARFQEIQSTPESWAQNSHDNIVRAEHERMASQQLRQLIDNILVDTSRDMREQADIVEVAFQRRIEELIDAKAKLEDNLKKTCGEIAQQEKNIEDLRAAIKAKDDPLKVAQTRLYNRQSRPNVDLCRDPAQYNLIGEVQDISNSMDALTQELTMSENQLKDLMDTRMALEKEIQMKKNSIFIDKDKCVPHRDRYPTTLKLQGY 431          
BLAST of Tektin-4 vs. TrEMBL
Match: A0A2T7PN25 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06115 PE=4 SV=1)

HSP 1 Score: 491.5 bits (1264), Expect = 2.226e-168
Identity = 248/446 (55.61%), Postives = 325/446 (72.87%), Query Frame = 3
Query:   66 MACTKVLS-------------ETNYSVGSCYQGNTGCDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            MAC  ++S             ETN  +   Y GNTG D GIST+GFR+ KY P EWH  NY KY+QS  DR+ ++R+R ESK    ET+A T   QA+ TK+L ER  DI FWK+ELEREI+D+ DE  LL + K+RL+NAL  T +PLHIATDN+NCR +R G+D V+D VEI+L+KEV+IIN VQ+LL+N I    +QI+ N +AKQILEMDWS+K EA E D+ +  L+N  TNKQF+ G A+++E  S PETWA+ +H +I  AE ERMAS++LRTLI N+  DTSRDMR+Q D V V   + +  + D++ KLE+NLKK   EIA+QEKNID++KAAIRAKEDP+KVAQTRL+ R +RPN++LC+DPAQ  L+AE+ ++  S++AL+ +   AENSLK+L D R++LEKEI +KKNSIFID+ K +  R RYPS +KLQGY
Sbjct:    1 MACATLMSREIPPERPPVASLETNPQMEITYTGNTGNDMGISTMGFRSAKYNPSEWHEGNYSKYYQSFVDRDNAERVRHESKRTRNETEATTNNTQADVTKKLAERCKDIQFWKNELEREIRDVIDETALLLDLKKRLENALRTTEIPLHIATDNLNCRQRRQGLDLVQDDVEISLLKEVEIINNVQDLLRNCIAQAEKQIRLNRDAKQILEMDWSDKKEALEIDTASGTLRNHHTNKQFHDGAAKFEEIQSTPETWAQYTHDNIARAEHERMASIQLRTLIENVFEDTSRDMREQCDTVNVNFQKRLVEMEDAKNKLEENLKKVCGEIAQQEKNIDDLKAAIRAKEDPMKVAQTRLYNRTYRPNVDLCRDPAQYALVAEVNEICQSIDALKNRLNLAENSLKDLQDNRMSLEKEISIKKNSIFIDRDKCVALRMRYPSSIKLQGY 446          
BLAST of Tektin-4 vs. Ensembl Cavefish
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:103034475])

HSP 1 Score: 276.174 bits (705), Expect = 9.909e-88
Identity = 161/407 (39.56%), Postives = 243/407 (59.71%), Query Frame = 3
Query:  144 GISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            G++T GFR+ KY P EW   N     ++LTD + +QR+   S+AL  E  A T   Q+  T  L  RL D++  ++EL+R  + +  E +LL + KRRL+ AL+ T LPL I+TDN+ CR+ R+G D V+D VE  L+KEV++I  VQ LLK T++   +QI+ N  AKQ LE+DWS+K EA   D       N ST+ Q +   AR  + + +   W + +  ++  AE +   S+ LR L + +L +T+ D+R Q   V+    +    L+ ++ +LE  L++ + EI  QE+NI  ++ A+  K+ P++VAQ+RLH R  RPN+ELC+D  Q  L +E++ +  S+  L+ Q   A  SL  L ++R+ LEK I  K NS+FID+ K L  R RYP+VL L GY
Sbjct:   27 GLATAGFRSAKYSPREWQENNSATLQRALTDHQHAQRVLRASRALSAEAAAGTQDAQSRGTLLLGARLQDVHSRRTELQRGAERLQAETELLQDHKRRLEKALLTTDLPLTISTDNLTCRENRFGPDLVQDPVEEELLKEVELIRNVQALLKKTLQQAVDQIRLNREAKQTLELDWSDKHEAYILDDQCGRYGNRSTDTQHHPSSARLHDQVCDERAWLKFTQVNLEEAERQYRCSVSLRELCDRVLQETAEDLRAQCAVVDQSFNQRCLELSQAKNQLELQLQRVLDEIGSQERNISTLQQAVYDKDTPLRVAQSRLHYRAQRPNMELCRDQPQISLESEVEQISGSVGVLQQQLSEARQSLAQLEESRLMLEKNISCKTNSLFIDRDKCLTHRTRYPTVLTLSGY 433          
BLAST of Tektin-4 vs. Ensembl Cavefish
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:103037718])

HSP 1 Score: 274.633 bits (701), Expect = 1.992e-86
Identity = 148/399 (37.09%), Postives = 245/399 (61.40%), Query Frame = 3
Query:  168 TGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            + +Y+P++W   NY  Y +S + R  ++RLR ++  LI++ D +T   Q  ++K L ERL+DI FW+SEL  EI ++  E   L E KRRL+ AL  T  PL  + + +  R++R  +D V DGVE +LIKEV++I   QE ++ +++    Q+  N  A+  LE D ++K+ A   D     ++N+S    +Y G+ R   ++S P++W++ +  +IL ++ ER  S +LR  I  +L  T+ +M  Q ++  V     I  + +++  L+ +L KT+ EI + E  I+ +K AIR KE+P+KVAQTRL +R  RPN+ELC+D    +L+ E+++++ S+  L  +   AEN+L+NL+ T+VTLE +I +K NS+F+DQ+K +  R  +PS  +L GY
Sbjct:   90 STRYMPDDWFKSNYNNYRESESSRNSAERLRRDTLRLIQDRDQITRWTQESTSKNLGERLNDITFWRSELHHEIDNMVSEIAALTEVKRRLERALAETEGPLQTSQECLFHREKRMSIDLVHDGVEKDLIKEVEVIKSCQERMRRSLDKAIAQLASNRAAQHELERDLNDKVTAQRIDDRCHQMRNTSDGISYYRGIDRLDPSLSLPDSWSKFTDDNILLSQSERSTSHKLRDEIEVLLNTTANEMWNQFNSANVSFTNRISEMAEAKNSLQTHLAKTLQEIFQTEMLIETLKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLVGEVREIEDSIYKLRERLAEAENTLQNLVKTKVTLEHDISVKANSLFLDQEKCMSMRRSFPSTPRLVGY 488          
BLAST of Tektin-4 vs. Ensembl Cavefish
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:103026688])

HSP 1 Score: 151.754 bits (382), Expect = 1.088e-40
Identity = 110/378 (29.10%), Postives = 193/378 (51.06%), Query Frame = 3
Query:  237 REVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGYNA 1370
            R VS  +R+E +AL  ET   T+ ++ +S++RL +R+ D+  WK  LE  +QD+  E   L   K   + AL AT LPL +  +    R+ R G + V D VE  L KEVD+I+  Q +L+  I+ + EQ+     A   L +D  +K EA + D    +L  +S          R     + P+ W + SH +++ A+ E   SL+LR  I+        ++  Q  A E  L +   ++  +  +++  LK T  EI + E++I  ++  ++AK  P+K+  TRL  R  RP ++LC+D  Q  L+ E + L  +++ L+ +   A +SL++L      + +++  K+ ++ ++Q+    R     + L L G +A
Sbjct:   32 RHVSHEIRQEGRALRNETANKTSWDEYDSSRRLNDRISDVTRWKKSLEACVQDVNAEIDALTLAKEETERALAATVLPLEVTAECQTLREGRRGSELVSDPVEAELKKEVDVIDGAQRVLQQLIDQSFEQLCLLQEAHHQLTLDLQHKTEALDVDMSCLSLTVTSPEISLKPNPIRVPPGSTTPQQWEQFSHHNVIRAKEEMQTSLQLRENISITRAQVQNELEAQRIATEFALRKRTHHMEQALQEVQWQLKTTQDEITEMERDIRGLERDMQAKMAPLKLVHTRLENRTKRPGVDLCRDEVQFGLVEEAKQLDSTIQTLKQKLAQALDSLQSLQHHEAQMLEDLSRKQEALALEQRTAQTR-----TRLSLTGQSA 404          
BLAST of Tektin-4 vs. Ensembl Sea Lamprey
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 86.6557 bits (213), Expect = 8.023e-20
Identity = 64/197 (32.49%), Postives = 100/197 (50.76%), Query Frame = 3
Query:  144 GISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSST 734
            G+S    R  ++   EWH         + + R+VS+ +R+E++ L  +++  T  +Q +S  RL ER+  +  W   L+  + D   E   L + K   + AL A  +PL +AT+ +  RD R GVD V D VE  L +EV  I + +E L  +I     Q+ +   A+Q L+ D  +K EA E DS   AL N+S 
Sbjct:    3 GVSVKPGR--RFTVGEWHDSGERVSSGAQSRRDVSRSVRQEARHLRDQSNNQTKWDQHDSNTRLEERMSSVQRWVERLQHTLDDTDAEINALAKTKDDAERALQAKAVPLQVATECLFLRDARRGVDLVHDPVEDELHREVKAIERAKEALTRSINDAFLQVCQLQEARQQLQGDVRDKEEALEIDSTCRALNNASA 197          
BLAST of Tektin-4 vs. Ensembl Sea Lamprey
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 78.5666 bits (192), Expect = 5.872e-17
Identity = 51/183 (27.87%), Postives = 97/183 (53.01%), Query Frame = 3
Query:  780 SNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRR 1328
            S+P TW E S +++  A  E  AS  LR  I   +  T+ ++  Q ++ +    +    L+  + +LE   K    EI+  E +I  ++A +RAK  P+KVA TRL  R +R  +ELC+D  Q  +  E+  ++ ++  L+ +  ++ N+L  L  +   +E+++  K  ++ ++++ V  RR
Sbjct:    2 SSPRTWDEFSRRNVERAMAEMRASSALREAITATIAQTTNELEAQKNSTDFAFRKRSHELDKVKAELEWQKKNNKQEISVLEGDIAHLEADVRAKMLPLKVAHTRLETRTYRSGVELCRDEPQYGITTEVHQIEATIATLKKKLSDSYNALTGLRCSLERVERDLASKALALGLERRCVDVRR 184          
BLAST of Tektin-4 vs. Ensembl Nematostella
Match: EDO39292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAK1])

HSP 1 Score: 265.003 bits (676), Expect = 2.878e-84
Identity = 154/391 (39.39%), Postives = 242/391 (61.89%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSV 1346
            KY+PEEWH  N+ +Y  +  +R  ++RLR+ES+ L  E +  T + Q +  K+L +R+ DINFWKSEL+R   +  +E  ++   K RL+ AL  T LPL IA   +  R++R  +D V D VE+ L+KEV++I  VQ LLK TIE   EQI+   +A+  LE D  +K  A++ D+  AALKN S    +     + ++N   P+ W + S+K++L AE E+ +S  LR++I+ +L  T  D+  Q  AV +   + I+    ++ KLED+L K   EIA  E+NI  ++ AI  K  P+KVAQTR+  R FRPNIELC+D  Q +L+ E+ ++  ++E L+ +   AE+SLK L+  +++LE++I++K+NS+FID+ + +  R +   V
Sbjct:   10 KYVPEEWHASNHLQYFTAEKERAAAERLRDESERLRVEIEVRTVETQEDVNKKLDQRITDINFWKSELDRNQSETEEEINMMLNFKARLERALADTELPLMIAQQCLMNREKRIKIDLVHDNVEMQLLKEVEVIEGVQALLKRTIEQATEQIRLLRSARYYLEKDRKDKFHANKIDNTCAALKNDSPGLVYARDAVKIEKNSVTPDEWEDFSNKNMLKAEREKNSSTSLRSIIDGLLVQTLNDLMNQCRAVNLAFEKRIEETLKAKTKLEDHLMKVKEEIAAMEENIATLQRAIALKIAPMKVAQTRVENRTFRPNIELCRDRVQYRLIDEVVEISTNIERLQEKLYEAESSLKALIRRQLSLEEDIEVKENSLFIDRDQCMELRKQITHV 400          
BLAST of Tektin-4 vs. Ensembl Nematostella
Match: EDO40681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M2])

HSP 1 Score: 221.09 bits (562), Expect = 1.548e-67
Identity = 135/371 (36.39%), Postives = 212/371 (57.14%), Query Frame = 3
Query:  234 DREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSV 1346
            +R  ++RLR+E   L  ET  +T + Q +  K+L  RLHDIN+WK+ELE++  +   E + L     RL+ AL AT  PL+I+   +  R++R  +D V D VE +L KEV++I  VQ LLK T++  +EQ+    +AK  LE D  +K  A   D   + L N S +  F       Q++   P+ W   S ++I  AE ER AS+ LR+ IN IL  T  D+R   + V  E  + I++   ++  LE  L + + E+A  + NI  +  AI  KE P+KVA TRL +R+ RPN+ELC+DP Q +L+ E+ ++  S++ L  +   A+ S++ LL  +  LE +I++K NS+FID+ + +  R +   +
Sbjct:   10 ERATAERLRDECSRLRTETSLLTHRTQMDVNKKLDHRLHDINYWKAELEKQHSETVAEIKALQAFIGRLEKALAATEKPLNISQQCLGYRERRVKIDLVHDNVETHLSKEVEMIENVQALLKKTMDQAHEQLWLLRSAKTQLEKDLGDKYGALGIDGKCSTLNNHSKDIHFAPHAVTIQQHSFTPDEWEAYSSENIAKAERERKASVALRSEINGILMQTYVDLRNIYETVNNEFHKRIEDTVGAKKSLEKELSRVMDELASMDNNIRTLTQAIADKEAPLKVAHTRLDKRSIRPNVELCRDPVQYRLVGEVGEINTSIDRLRMRLAEAQASMQALLRNKENLEDDIEVKTNSLFIDRDQCMVVRQQVKHI 380          
BLAST of Tektin-4 vs. Ensembl Nematostella
Match: EDO37357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG13])

HSP 1 Score: 191.045 bits (484), Expect = 9.506e-56
Identity = 131/377 (34.75%), Postives = 198/377 (52.52%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFID 1304
            ++   +WHT N      +   RE S R+R+ES+ L  ETD  T   Q +S  +L +R+ DIN WK  LER + +  +E  LL  +K R + AL A  +PL I  + +  R+ R  +D V D VE  L KEV++I   + LL+  ++ + EQ+     A+  L +D ++K    + D    A+ N STN  +     R  +    PETW   S+ + L AE E  AS  LR  I   L  T+ D+  Q  A E    + I   + ++ +LE   K T+ EIA  E +I  +K AI AK  P+ VAQTRL  R +RPN+ELC+D  Q +L  E+ ++  S+ AL  +   A+NSL+ L      + +++  K NS+ +D
Sbjct:   11 RFAVSDWHTSNQIIRTNAERQREASHRVRQESRFLRNETDNHTRWTQHDSNTKLEKRIDDINDWKRSLERCLAETDNEIALLTREKERTERALEAKKVPLDITLECLMLRENRQSIDLVRDEVEAQLHKEVEVIEGTKALLQQKVDESFEQLCLLQEARHQLHLDITDKFTTLQIDGDCYAMNNMSTNIGYQVNPTRTVKGSVTPETWDSFSNYNKLRAEAEMKASKHLREAIFATLQQTANDLEAQRKASEYSFRKRIHETDQAKSELEWQQKNTMKEIATLEDDIKGLKEAIDAKNAPMMVAQTRLENRTYRPNVELCRDQPQYQLCHEVAEIAGSMRALTEKLREAQNSLEALRSNLSRINEDLAFKNNSLALD 387          
BLAST of Tektin-4 vs. Ensembl Medaka
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:101173527])

HSP 1 Score: 276.559 bits (706), Expect = 1.002e-87
Identity = 161/407 (39.56%), Postives = 248/407 (60.93%), Query Frame = 3
Query:  150 STVGFRTGKYLPEEWHTLNYEKYH-QSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVN-AENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            + VG R+ KY P EW + NY+    ++  D   ++ +++ S+ L ++++ VT + QAE T+ L ERL +I+ W+SEL R I+ +  + + L   + RL+ AL AT  P  IATDN+NCR +R G D V+D VE  L+KEV +I  +Q LLK TI     QI+RN++AKQ+LEMDWS+K EA   D       N S + Q +   A   E + NP TW + +  ++L A  E  AS  LR L+  +L +T+ D+  Q   V+   ++    L +++ +L+  L + + +I +QEKNI  ++ AI  KE P++V Q+RLH R+ RPN+ELC+DPAQ  L AE   ++ +L +L+ QK+N A  SL NL ++R+ L+K+I  K  S+FI+ +K + +R   PS  +L GY
Sbjct:   41 AGVG-RSTKYSPAEWFS-NYQTILVRAGADNLEAESIQQLSRTLNRDSEGVTLQTQAEGTRLLGERLQEIHHWRSELLRHIEQLQADMEALQAARTRLERALEATDTPYAIATDNLNCRAKRPGPDLVQDSVEEELLKEVGLIRNIQALLKRTIAQVASQIRRNMDAKQVLEMDWSDKQEAYNLDERGGGHSNRSPDTQLHPSSAANHEQVCNPTTWTKFTQDNLLQAAQEEEASRRLRALVEEMLRETTEDLINQRSTVDGAFSQRCQELLEAKTELQIKLTQVLQQIGEQEKNIVGLQKAIHLKEAPLRVVQSRLHLRSLRPNMELCRDPAQLSLEAEAAQIETTLNSLK-QKLNEARISLSNLEESRMELQKDISCKSQSLFIEGEKCMTQRRHLPSTSRLSGY 444          
BLAST of Tektin-4 vs. Ensembl Medaka
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:101160513])

HSP 1 Score: 269.626 bits (688), Expect = 1.455e-84
Identity = 150/399 (37.59%), Postives = 244/399 (61.15%), Query Frame = 3
Query:  168 TGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGY 1364
            T +Y P++W+  N   Y +S + R+ ++RLR+++  LI++ D +T + Q  ++K + ERL+DI FWKSEL  EI ++  E   L E KRRL+ AL  T  PL +A + +  R++R  +D V DGVE +LIK +++I   QE ++  ++    Q+  N  A+  LE D S+KL A   D     L+N+S    +Y G+ R    +S P++W+  +  +IL ++ ER  S +LR  I  +L  TS +M  Q + V V     I    D++  L+ +L KT+ EI + E  I+ +K AIR KE+P+KVAQTRL +R  RPNIELC+D    +L+ E+++++ +++ L  + + AEN+L+ L+ T+V LE ++ +K NS+F+DQ+K +  R  +PS+ +L GY
Sbjct:   88 TNRYTPDDWYKSNQSHYWESESSRKSAERLRKDTMRLIQDKDQLTRRTQENTSKNISERLNDIRFWKSELSHEIDNMVTEIAALTEVKRRLERALAETQGPLQVAQECLYHREKRMSIDLVHDGVEKDLIK-IEVIKSCQERMRLHLDRATSQLASNRAAQHELEKDLSDKLTAQRIDDRCHHLRNTSDGIGYYRGIDRQDHAVSLPDSWSRFTDDNILRSQSERATSHKLRDEIEILLNTTSNEMWNQFNNVNVAFTNRISETTDAKSSLQAHLAKTMQEIFQTEMLIESLKKAIRDKENPLKVAQTRLEERTRRPNIELCRDNPYHRLVTEVREIEDTIQKLHERLMEAENTLQALVKTKVKLENDLSIKANSLFLDQEKCMSMRKTFPSMPRLVGY 485          
BLAST of Tektin-4 vs. Ensembl Medaka
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:101164907])

HSP 1 Score: 156.377 bits (394), Expect = 2.766e-42
Identity = 111/385 (28.83%), Postives = 203/385 (52.73%), Query Frame = 3
Query:  189 EWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPS 1343
            EW+  N + + ++   R VS  +R+E K+L  ET   T  ++ E+++RL ER+ D++ W+  L+   Q + +E   L   K   + AL AT  PL ++T+ +  R+ R G + V D V+  L KEV++I +VQ+ L+  I+   +Q+     A+  L  D  NK+EA + D     L  +S N        R     S P+ W + S+ +++ AE     S ++R  ++        ++  +  A E  L +   +   +R +L+  ++    EIA+ E +I E+ A ++AK  P+K+A TRL  R  RP ++LC+D  Q  L+AE++ L+ ++ AL+ +   A++SL+N+      + +++  K+ ++ ++ Q+ L  R R  S
Sbjct:   14 EWNNNNLQLWAEAQQQRLVSSEIRQECKSLRNETHCKTVWDEKETSRRLTERVWDVSRWRDLLDSCAQKVDEEMDALTLSKELTEQALAATATPLEVSTECMMLREGRRGYELVTDPVQEQLQKEVELIERVQQTLQQHIDEAFQQLCVLQEARHQLTGDLQNKMEALDIDKSCLTLTITSPNISLKTNPTRIPSGASTPQEWVQLSNHNVVQAEEAMRVSQQMREDMSLSRAQLQNELEAERRATEFALRKRSHHEEQARDELQWQIRNMEAEIAEMESDIRELDADLQAKTAPLKLAHTRLENRTHRPGMDLCRDEVQYSLVAEVEQLEATVLALQLKLSKAQHSLQNMRLHHGQMLQDLSRKQEALSLE-QRSLNTRTRLTS 397          
BLAST of Tektin-4 vs. Ensembl Medaka
Match: tekt1 (tektin-1 [Source:NCBI gene;Acc:101161072])

HSP 1 Score: 140.969 bits (354), Expect = 5.790e-37
Identity = 104/363 (28.65%), Postives = 190/363 (52.34%), Query Frame = 3
Query:  246 SQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMS--NPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRR 1328
            S+R R E K LIKET  +  + Q +  ++  ++L  I F K ELE ++ ++  E   L   + R+  AL A   PL +    +  R +R   +R  D V+  L+KE + + +V+ LL+   E  +EQ++ N +AK  +E D   K EA   D+    +   S + +         E  S    + W   S+ ++  AE ++  S  L+ L+ ++L  T+ DM++Q  A    +  N+  + +++ ++ED L K  +EI+ Q K  ++++ A+   E+ + + Q RL  R+ RP  E  +DPAQ KLLA++Q +   ++ L+ +   +E+  + LL+ ++ L++ I  K N ++ID+   + RR
Sbjct:   23 SERFRAECKELIKETKQICKRMQEDENQQFDQKLRRIQFLKKELELKLDEVNLEIDDLVVLQSRVTKALDACKEPLEVTDLCMKERLKRPNSERFHDEVDGELLKESEGLKRVESLLQRVTEQISEQLRLNRSAKYGIEKDLKEKSEAQNVDNFCTLMATLSMSHRHRPKTHSTPEPSSVLTLDQWENISYANMAKAEQQKTNSRSLQVLVQSVLDQTAADMQKQVQATTTAIQLNVQKMKNAKNQMEDELVKIQSEISSQRKTREDLRVAVAENEEFLSLTQARLALRHERPGKEQWRDPAQRKLLADVQKITEHIKQLQQEVDRSEDEERRLLNWKLRLQESIDSKANCLYIDEVVCMQRR 385          
BLAST of Tektin-4 vs. Planmine SMEST
Match: SMESG000068903.1 (SMESG000068903.1)

HSP 1 Score: 889.412 bits (2297), Expect = 0.000e+0
Identity = 434/435 (99.77%), Postives = 434/435 (99.77%), Query Frame = 3
Query:   66 MACTKVLSETNYSVGSCYQGNTGCDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGYNA 1370
            MACTKVLSETNYSVGSCYQGNTGCDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTV EIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGYNA
Sbjct:    1 MACTKVLSETNYSVGSCYQGNTGCDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVAEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGYNA 435          
BLAST of Tektin-4 vs. Planmine SMEST
Match: SMESG000016881.1 (SMESG000016881.1)

HSP 1 Score: 460.685 bits (1184), Expect = 9.804e-160
Identity = 228/417 (54.68%), Postives = 306/417 (73.38%), Query Frame = 3
Query:  117 YQGNTGCDTGISTVGFRTGKYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGYN 1367
            YQG+TG D GIST GFRTGKY P +  T  Y K++Q+   R+ S++ R ++++ IKETDA +   Q +STK+L +RLHD+ FWK ELEREIQD+ D    L ++K  L+ AL+AT L LHI TDN+NCRD+RYGVD+VED VE+NLIKE+D++NKVQ+L+K TIE  N+QI+RN  +K+ LEMDWSNKLEA+E D  +  L N STNKQFY GVARYQE  S PE+WA+ SH +I+ AE ERMAS +L TL  N++ D + D+R+QADA ++   + +D   D R K+++NLKKT  EIA+QE NID +K AIR KED +KV QTRLH R FRP ++LC+D  QD+L++E  +L+ S++AL+ Q   +E  LK++ D+R++LEK+  +K NSIFID+ K L  R RYPS  K  GY+
Sbjct:   32 YQGSTGNDCGISTAGFRTGKYNPTDGETQLYNKFYQAFVSRDNSEKARNDAESTIKETDATSKDEQEKSTKKLKDRLHDVRFWKGELEREIQDVVDVTDKLVDKKNHLERALMATELGLHIVTDNLNCRDRRYGVDKVEDEVEMNLIKELDVLNKVQQLIKKTIEEFNKQIRRNRESKENLEMDWSNKLEAEEYDEKSKQLNNMSTNKQFYNGVARYQELQSTPESWAQHSHDNIVRAEHERMASEQLLTLCANLVNDAATDIRRQADATDISFQKRVDQYIDQRNKIKENLKKTCKEIAEQENNIDNLKKAIREKEDFLKVNQTRLHNRTFRPGVDLCRDTPQDQLISESAELEKSIDALKNQLSMSEACLKDMHDSRMSLEKDFAMKNNSIFIDKDKCLTHRMRYPSHNKFLGYH 448          
BLAST of Tektin-4 vs. Planmine SMEST
Match: SMESG000020792.1 (SMESG000020792.1)

HSP 1 Score: 231.491 bits (589), Expect = 4.243e-70
Identity = 139/389 (35.73%), Postives = 227/389 (58.35%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYP 1340
            +Y P +W       Y+ S   R  ++++R ++  + +E D  T + Q +S K+L +RL DINF ++E+  EI  +  E++ L   KR  + +L  T  PLH+  + +  R++R G+D V D VE NL+ EVD+I K Q+ +   +   N Q+  N  ++  LE D  +K +A++ DS A +LKNSS    +Y GV      +S PETW + ++ ++  +  ER AS  LR  I  +L  T RDM ++   V   L++      D+R K++++L K + EI   EKNI+ IK +I+ KE P+KVAQTRLH R  RPN+E C+D  + +L+ E+ +++ S+  L  Q   AE ++++LL ++  LE ++ +K NS+FID++K L  R  +P
Sbjct:   91 RYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQRSAAEREASRRLREEIEQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACRDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFP 479          
BLAST of Tektin-4 vs. Planmine SMEST
Match: SMESG000021346.1 (SMESG000021346.1)

HSP 1 Score: 224.942 bits (572), Expect = 1.684e-67
Identity = 136/389 (34.96%), Postives = 221/389 (56.81%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYP 1340
            +Y P++W T   + +  +   R+  +R+R ++  L +ETD  T + Q +  K++ +RL D NFWK+EL+ EI  +  EN  L E KR  +  L  T   LHI  + +  R++R G+D V D VE +LI E+D + + Q+ ++N I   N Q+  N  A+   E+D  +K  A + D  A  +KNSS    F+ GV      +S PETWA+ S  ++  ++ ER  S ++R  I   L   + DM ++ + V   L   I    D+R K++ +L K + EI   EKNI+ +K  I+ KED +KVAQTRLH R  RP +ELC+D    +L+ E+ +++  +  L  +   AE +L++LLD +  LE+++ +K N++F+D++K L  R  +P
Sbjct:  101 RYTPKDWMTAAMKTFQSADRVRDYGERIRFDTNRLGRETDDQTKRAQEDVGKKIGDRLSDTNFWKTELDDEIDKMITENNNLNEMKRVAEKMLGETENQLHIGEECLYTREKRQGIDLVHDNVEKSLIGEIDTVKQAQDDIRNIISKANAQMSLNRAAQHENELDSRDKFIAQQIDENAHQIKNSSAGINFHNGVETIDNCVSTPETWAKYSDDNVKRSQAERENSTKVREEIEATLDKAANDMWKRWNNVNTALTERIQETIDARNKIQAHLAKILQEIFDMEKNIEYLKKCIKDKEDYMKVAQTRLHFRLRRPGMELCRDQPNHRLVEEVDEIREVVAMLMRELREAETALQHLLDNKAVLEQDLNIKNNTLFLDREKCLGLRKTFP 489          
BLAST of Tektin-4 vs. Planmine SMEST
Match: SMESG000021346.1 (SMESG000021346.1)

HSP 1 Score: 224.942 bits (572), Expect = 2.117e-67
Identity = 136/389 (34.96%), Postives = 221/389 (56.81%), Query Frame = 3
Query:  174 KYLPEEWHTLNYEKYHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFWKSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRYGVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEMDWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHKHILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLNDSRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFRPNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLEKEIQLKKNSIFIDQQKVLPRRNRYP 1340
            +Y P++W T   + +  +   R+  +R+R ++  L +ETD  T + Q +  K++ +RL D NFWK+EL+ EI  +  EN  L E KR  +  L  T   LHI  + +  R++R G+D V D VE +LI E+D + + Q+ ++N I   N Q+  N  A+   E+D  +K  A + D  A  +KNSS    F+ GV      +S PETWA+ S  ++  ++ ER  S ++R  I   L   + DM ++ + V   L   I    D+R K++ +L K + EI   EKNI+ +K  I+ KED +KVAQTRLH R  RP +ELC+D    +L+ E+ +++  +  L  +   AE +L++LLD +  LE+++ +K N++F+D++K L  R  +P
Sbjct:  113 RYTPKDWMTAAMKTFQSADRVRDYGERIRFDTNRLGRETDDQTKRAQEDVGKKIGDRLSDTNFWKTELDDEIDKMITENNNLNEMKRVAEKMLGETENQLHIGEECLYTREKRQGIDLVHDNVEKSLIGEIDTVKQAQDDIRNIISKANAQMSLNRAAQHENELDSRDKFIAQQIDENAHQIKNSSAGINFHNGVETIDNCVSTPETWAKYSDDNVKRSQAERENSTKVREEIEATLDKAANDMWKRWNNVNTALTERIQETIDARNKIQAHLAKILQEIFDMEKNIEYLKKCIKDKEDYMKVAQTRLHFRLRRPGMELCRDQPNHRLVEEVDEIREVVAMLMRELREAETALQHLLDNKAVLEQDLNIKNNTLFLDREKCLGLRKTFP 501          
The following BLAST results are available for this feature:
BLAST of Tektin-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TEKT47.377e-11945.78tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012][more]
TEKT34.469e-7936.65tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT34.469e-7936.65tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT11.175e-7737.79tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534][more]
TEKT56.640e-6533.67tektin 5 [Source:HGNC Symbol;Acc:HGNC:26554][more]
back to top
BLAST of Tektin-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R02E12.43.347e-3126.53pep chromosome:WBcel235:X:4005314:4007634:1 gene:W... [more]
back to top
BLAST of Tektin-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG328191.960e-6031.36gene:FBgn0052819 transcript:FBtr0070051[more]
CG328201.960e-6031.36gene:FBgn0052820 transcript:FBtr0070054[more]
CG174501.960e-6031.36gene:FBgn0040028 transcript:FBtr0345920[more]
CG174501.960e-6031.36gene:FBgn0040028 transcript:FBtr0070056[more]
CG328191.630e-5931.36gene:FBgn0052819 transcript:FBtr0070050[more]
back to top
BLAST of Tektin-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tekt48.492e-9540.15tektin 4 [Source:ZFIN;Acc:ZDB-GENE-070410-98][more]
tekt32.138e-8837.34tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt33.770e-8837.34tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt33.770e-8837.34tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt12.014e-6035.94tektin 1 [Source:ZFIN;Acc:ZDB-GENE-041114-99][more]
back to top
BLAST of Tektin-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plcd12.591e-13549.88phospholipase C delta 1 [Source:Xenbase;Acc:XB-GEN... [more]
tekt31.518e-8737.73tektin 3 [Source:NCBI gene;Acc:549229][more]
gdf101.278e-7839.42growth differentiation factor 10 [Source:Xenbase;A... [more]
fam168a1.795e-3933.22family with sequence similarity 168 member A [Sour... [more]
fam168a8.800e-3734.66family with sequence similarity 168 member A [Sour... [more]
back to top
BLAST of Tektin-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tekt44.181e-13348.43tektin 4 [Source:MGI Symbol;Acc:MGI:1919090][more]
Tekt41.056e-12847.95tektin 4 [Source:MGI Symbol;Acc:MGI:1919090][more]
Tekt46.274e-10447.52tektin 4 [Source:MGI Symbol;Acc:MGI:1919090][more]
Tekt32.126e-7835.43tektin 3 [Source:MGI Symbol;Acc:MGI:1918312][more]
Tekt11.436e-7736.41tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
back to top
BLAST of Tektin-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5PPV2|TEKT4_XENLA6.966e-13850.36Tektin-4 OS=Xenopus laevis OX=8355 GN=tekt4 PE=2 S... [more]
sp|Q2TA38|TEKT4_BOVIN7.133e-13649.16Tektin-4 OS=Bos taurus OX=9913 GN=TEKT4 PE=2 SV=1[more]
sp|Q149S1|TEKT4_MOUSE2.924e-13248.43Tektin-4 OS=Mus musculus OX=10090 GN=Tekt4 PE=1 SV... [more]
sp|Q6AXV2|TEKT4_RAT2.795e-12645.92Tektin-4 OS=Rattus norvegicus OX=10116 GN=Tekt4 PE... [more]
sp|Q8WW24|TEKT4_HUMAN3.542e-11845.78Tektin-4 OS=Homo sapiens OX=9606 GN=TEKT4 PE=1 SV=... [more]
back to top
BLAST of Tektin-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EH030.000e+064.18Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8IVP90.000e+063.94Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EN100.000e+063.94Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8FZ590.000e+063.94Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2T7PN252.226e-16855.61Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Tektin-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tekt49.909e-8839.56tektin 4 [Source:NCBI gene;Acc:103034475][more]
tekt31.992e-8637.09tektin 3 [Source:NCBI gene;Acc:103037718][more]
tekt21.088e-4029.10tektin 2 [Source:NCBI gene;Acc:103026688][more]
back to top
BLAST of Tektin-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TEKT28.023e-2032.49tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
TEKT25.872e-1727.87tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
back to top
BLAST of Tektin-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tektin-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO392922.878e-8439.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406811.548e-6736.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373579.506e-5634.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tektin-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tekt41.002e-8739.56tektin 4 [Source:NCBI gene;Acc:101173527][more]
tekt31.455e-8437.59tektin 3 [Source:NCBI gene;Acc:101160513][more]
tekt22.766e-4228.83tektin 2 [Source:NCBI gene;Acc:101164907][more]
tekt15.790e-3728.65tektin-1 [Source:NCBI gene;Acc:101161072][more]
back to top
BLAST of Tektin-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068903.10.000e+099.77SMESG000068903.1[more]
SMESG000016881.19.804e-16054.68SMESG000016881.1[more]
SMESG000020792.14.243e-7035.73SMESG000020792.1[more]
SMESG000021346.11.684e-6734.96SMESG000021346.1[more]
SMESG000021346.12.117e-6734.96SMESG000021346.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012757 ID=SMED30012757|Name=Tektin-4|organism=Schmidtea mediterranea sexual|type=transcript|length=1457bp
CTAAAGTTACATTTTTGAAAGATTTAGTTAATCAAAATTGAATAAATAAT
ATTCAAATTAAAGGAATGGCTTGCACAAAAGTTTTATCAGAAACAAATTA
TTCCGTTGGCTCCTGTTATCAAGGCAATACCGGTTGTGACACAGGAATTT
CTACTGTGGGCTTTCGGACCGGGAAATATTTACCCGAGGAGTGGCACACA
CTCAATTATGAAAAATATCATCAATCTCTAACTGACAGAGAAGTTTCACA
AAGATTGAGAGAAGAAAGCAAAGCTCTTATTAAAGAAACTGACGCGGTCA
CAGCTAAAAATCAGGCGGAATCCACGAAACGGCTCGTTGAGAGATTACAC
GATATAAATTTCTGGAAATCTGAATTGGAACGGGAAATTCAAGATATAAC
GGATGAAAATCAACTGCTTTGTGAGCAAAAGAGGCGCCTCGATAATGCTC
TTATTGCTACTGGCTTACCGTTGCATATAGCGACTGACAATATTAACTGT
AGAGATCAAAGATATGGAGTTGACAGAGTTGAAGATGGCGTGGAAATTAA
TCTAATAAAGGAAGTTGATATCATCAATAAAGTTCAAGAACTATTGAAAA
ACACAATTGAACACACGAATGAACAAATTCAACGAAATCTCAATGCAAAA
CAAATCTTGGAAATGGACTGGAGTAACAAACTTGAAGCGGATGAAAACGA
TTCGATTGCTGCGGCATTGAAAAATAGTTCTACGAATAAGCAATTCTACG
CTGGCGTTGCGAGATATCAAGAAAATATGTCGAATCCAGAAACCTGGGCA
GAGGAATCCCACAAACACATATTGCACGCAGAGGGAGAACGGATGGCCAG
TCTTGAACTAAGAACTCTGATTAACAATATTCTTACCGACACGTCGAGAG
ATATGAGACAACAAGCCGATGCCGTCGAGGTGGAACTTGCTAGGAATATT
GACAACTTGAACGACTCTAGGTGTAAACTCGAAGACAACTTGAAAAAGAC
AGTCACTGAAATTGCTAAACAAGAGAAAAATATCGATGAAATCAAGGCAG
CAATCAGAGCTAAAGAAGACCCAATAAAAGTCGCTCAAACAAGACTTCAC
CAAAGAAATTTCAGACCGAATATTGAATTGTGCAAAGATCCAGCTCAAGA
TAAATTATTGGCTGAAATGCAAGACCTACAATTGTCTTTGGAAGCCTTAG
AAACACAGAAAGTCAATGCTGAGAATTCCTTGAAGAACCTTTTAGATACT
CGCGTGACACTTGAGAAAGAGATTCAATTAAAGAAGAATTCTATATTTAT
TGACCAACAGAAGGTTTTGCCAAGACGAAATCGCTATCCGAGTGTATTGA
AACTTCAAGGTTACAATGCTTAAGCTTACGAATCACATTTTACAGTTAAT
ATTGTCTGTTGTGATTAATTAGAAAGAAAATAAATATATTGTACTTTTGA
AAAAAAA
back to top

protein sequence of SMED30012757-orf-1

>SMED30012757-orf-1 ID=SMED30012757-orf-1|Name=SMED30012757-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=436bp
MACTKVLSETNYSVGSCYQGNTGCDTGISTVGFRTGKYLPEEWHTLNYEK
YHQSLTDREVSQRLREESKALIKETDAVTAKNQAESTKRLVERLHDINFW
KSELEREIQDITDENQLLCEQKRRLDNALIATGLPLHIATDNINCRDQRY
GVDRVEDGVEINLIKEVDIINKVQELLKNTIEHTNEQIQRNLNAKQILEM
DWSNKLEADENDSIAAALKNSSTNKQFYAGVARYQENMSNPETWAEESHK
HILHAEGERMASLELRTLINNILTDTSRDMRQQADAVEVELARNIDNLND
SRCKLEDNLKKTVTEIAKQEKNIDEIKAAIRAKEDPIKVAQTRLHQRNFR
PNIELCKDPAQDKLLAEMQDLQLSLEALETQKVNAENSLKNLLDTRVTLE
KEIQLKKNSIFIDQQKVLPRRNRYPSVLKLQGYNA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0030030cell projection organization
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005929cilium
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000435Tektin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 101..128
NoneNo IPR availableCOILSCoilCoilcoord: 309..329
NoneNo IPR availableCOILSCoilCoilcoord: 361..409
NoneNo IPR availablePFAMPF03148Tektincoord: 43..425
e-value: 2.1E-123
score: 411.9
NoneNo IPR availablePANTHERPTHR19960:SF12MAFF-INTERACTING PROTEIN-RELATEDcoord: 25..433
IPR000435TektinPRINTSPR00511TEKTINcoord: 401..413
score: 65.38
coord: 347..367
score: 57.14
coord: 328..344
score: 61.76
coord: 370..386
score: 26.47
IPR000435TektinPANTHERPTHR19960TEKTINcoord: 25..433