SMED30012754

Overview
NameSMED30012754
Smed IDSMED30012754
Length (bp)1379
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30012754 (SMED30012754) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30012754 (SMED30012754) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30012754 (SMED30012754) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30012754 (SMED30012754) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012754

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012754SMESG000051946.1 SmedASXL_010970SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012754SMESG000051946.1 SmedASXL_010970SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012754 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000536:8978..10557 -6738
Homology
BLAST of SMED30012754 vs. Ensembl Human
Match: DDX47 (DEAD-box helicase 47 [Source:HGNC Symbol;Acc:HGNC:18682])

HSP 1 Score: 346.28 bits (887), Expect = 1.034e-114
Identity = 187/407 (45.95%), Postives = 265/407 (65.11%), Query Frame = -3
Query:  181 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELP---------LLLTDRQA 1374
            +FK+LGV D LCEA +++ W  PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PIL  L++ P+  FALV TPTRELA QI  +F  LG  IGV+ A ++GG+   +Q+  +  KPHIIIATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L +PVK +V  KY    +L+++ +  P + +  +LV++L +L                        A  S ++F  T   +   A  L+ LG  A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVV+ +DIP  +K Y HR GRTARAG+ G +IT V QY+   +  I+  + K+LP         ++LT+R A
Sbjct:   25 TFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSLALAKKPHIIIATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYIFIPSKFKDTYLVYILNEL------------------------AGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVA 404          
BLAST of SMED30012754 vs. Ensembl Human
Match: DDX47 (DEAD-box helicase 47 [Source:HGNC Symbol;Acc:HGNC:18682])

HSP 1 Score: 262.692 bits (670), Expect = 6.986e-83
Identity = 128/238 (53.78%), Postives = 173/238 (72.69%), Query Frame = -3
Query:  661 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLK 1374
            +FK+LGV D LCEA +++ W  PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PIL  L++ P+  FALV TPTRELA QI  +F  LG  IGV+ A ++GG+   +Q+  +  KPHIIIATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L +PVK +V  KY    +L+++ +  P + +S  L  L K
Sbjct:   25 TFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSLALAKKPHIIIATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYIFIPSKFKSKRLGSLNK 259          

HSP 2 Score: 73.9442 bits (180), Expect = 1.431e-13
Identity = 46/106 (43.40%), Postives = 70/106 (66.04%), Query Frame = -3
Query:  181 QEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELP---------LLLTDRQA 471
            + +R  +++K K +   I++ATDVA+RG+DIP+VDVV+ +DIP  +K Y HR GRTARAG+ G +IT V QY+   +  I+  + K+LP         ++LT+R A
Sbjct:  250 KSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVA 355          
BLAST of SMED30012754 vs. Ensembl Human
Match: DDX49 (DEAD-box helicase 49 [Source:HGNC Symbol;Acc:HGNC:18684])

HSP 1 Score: 251.136 bits (640), Expect = 1.810e-77
Identity = 159/392 (40.56%), Postives = 225/392 (57.40%), Query Frame = -3
Query:  208 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLS---SQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKEL 1374
             F ELG++  L E   ++  K PT +Q   IP  LEG+D +G AKTGSGKT AF +PILQ+L +DP   F LV TPTRELA QI  +F  LGK +G+K   ++GG+    QA ++  KPH++IATPGR   H+ ++  F   ++K ++FLVMDEADR+L    + F  DL  IL  +P  R+T LFSAT TD + +LQ  +   P         +   +L +  LL P + + A+LV L+++               F     D      SII+F  T     +L   L+K       ++S M Q++R A + K K     I++ATDVA+RG+DIP V VVI ++ P   K Y HR GRTARAG++G +IT+V QY+      I+E++KK+L
Sbjct:    3 GFAELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGRLADHLRSSNTF---SIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTVEQLDQRYLLVPEKVKDAYLVHLIQR---------------FQDEHEDW-----SIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLVHAIEEQIKKKL 371          
BLAST of SMED30012754 vs. Ensembl Human
Match: DDX27 (DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:15837])

HSP 1 Score: 202.216 bits (513), Expect = 7.090e-57
Identity = 133/386 (34.46%), Postives = 209/386 (54.15%), Query Frame = -3
Query:  232 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPF---FALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELK-EFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEI 1377
            +SF+++ ++  L +AI  + +K PT IQK  IP  L GKDI   A TG+GKT AF +P+L+ L+  P+       LV  PTREL IQ+ +    L +   +     +GGL  K+Q   +   P I+IATPGR + H+     F+   L +++ L++DEADRML   F+  + +I+ +    R+T LFSAT TD+V  L   SL +PV++ V+     +  L+ EF+ + P  +     +                 +AA        +  T  +++F QT+  ++ +   L  +GL    ++ ++SQ QR   + + K  ++DI+VATDVAARG+DI  V  VI + +P + K Y HR GRTARAG+ G S+++V +       EI
Sbjct:  187 LSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFH---LSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNREGDREAI-----------------VAALLT-----RTFTDHVMLFTQTKKQAHRMHILLGLMGLQVGELHGNLSQTQRLEALRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 547          
BLAST of SMED30012754 vs. Ensembl Human
Match: DDX27 (DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:15837])

HSP 1 Score: 202.216 bits (513), Expect = 1.184e-56
Identity = 133/386 (34.46%), Postives = 209/386 (54.15%), Query Frame = -3
Query:  232 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPF---FALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELK-EFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEI 1377
            +SF+++ ++  L +AI  + +K PT IQK  IP  L GKDI   A TG+GKT AF +P+L+ L+  P+       LV  PTREL IQ+ +    L +   +     +GGL  K+Q   +   P I+IATPGR + H+     F+   L +++ L++DEADRML   F+  + +I+ +    R+T LFSAT TD+V  L   SL +PV++ V+     +  L+ EF+ + P  +     +                 +AA        +  T  +++F QT+  ++ +   L  +GL    ++ ++SQ QR   + + K  ++DI+VATDVAARG+DI  V  VI + +P + K Y HR GRTARAG+ G S+++V +       EI
Sbjct:  218 LSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGLDVKSQEAALRAAPDILIATPGRLIDHLHNCPSFH---LSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLKNPVRIFVNSNTDVAPFLRQEFIRIRPNREGDREAI-----------------VAALLT-----RTFTDHVMLFTQTKKQAHRMHILLGLMGLQVGELHGNLSQTQRLEALRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTIKHYVHRVGRTARAGRAGRSVSLVGEDERKMLKEI 578          
BLAST of SMED30012754 vs. Ensembl Celegans
Match: T26G10.1 (Putative ATP-dependent RNA helicase T26G10.1 [Source:UniProtKB/Swiss-Prot;Acc:P34580])

HSP 1 Score: 361.688 bits (927), Expect = 1.034e-120
Identity = 189/389 (48.59%), Postives = 260/389 (66.84%), Query Frame = -3
Query:  208 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKEL 1374
            SF ELGV+  LC+A +R+ W  P++IQ+ A+P AL+GKD+IGLA+TGSGKTGAF IP+LQ L+  P+ FF LV TPTRELA QI  +F  LG GIG+  A ++GG+    QA  +  +PHII+ATPGR + H+  TKGFN   LK LKFL+MDEADR+L+  F+ +L+KIL ++PR RRT+LFSAT T KVSKL+RASL DP +VSV  +Y     LK+  +  P + +  +LV+LL +                         A  S IVF  T   +  +A  L++LG+ A P++  MSQE+R  +++K K +  +I+V TDVAARG+DIP+VD+VI YD+P  +K Y HR GRTARAG+ G++IT+V QY+   Y +I+  + K+L
Sbjct:   45 SFAELGVSQPLCDACQRLGWMKPSKIQQAALPHALQGKDVIGLAETGSGKTGAFAIPVLQSLLDHPQAFFCLVLTPTRELAFQIGQQFEALGSGIGLIAAVIVGGVDMAAQAMALARRPHIIVATPGRLVDHLENTKGFN---LKALKFLIMDEADRILNMDFEVELDKILKVIPRERRTYLFSATMTKKVSKLERASLRDPARVSVSSRYKTVDNLKQHYIFVPNKYKETYLVYLLNE------------------------HAGNSAIVFCATCATTMQIAVMLRQLGMQAVPLHGQMSQEKRLGSLNKFKSKAREILVCTDVAARGLDIPHVDMVINYDMPSQSKDYVHRVGRTARAGRSGIAITVVTQYDVEAYQKIEANLGKKL 406          
BLAST of SMED30012754 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4332507:1 gene:WBGene00019219.1 transcript:H20J04.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 249.21 bits (635), Expect = 3.238e-77
Identity = 141/390 (36.15%), Postives = 226/390 (57.95%), Query Frame = -3
Query:  208 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESS--ELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKEL 1371
            F +LGV   + + ++ ++ K  T +Q   IP  LEG DI+G A+TG+GKT AF IPILQ+L  DP   +AL+ TPTRELA QI  +F  LGK I +KC+ ++GG     QA ++  +PH+++ATPGR    + +      +  K ++F V+DEADRML  Q++  L  I   +   R+T L SAT T+ ++ L R S   P       K  ES+   L++  ++CP   + A+LV+++K                 NY + + K    S+++F QT      LAY  + LG     ++S + Q+QR A +   + + + +++ TDVA+RG+DIP+VD+V+ +++P+  KTY HR GR+ARAG+ G +++ V QY+      +++ + K+L
Sbjct:   91 FSQLGVCSWITQQLQTMQIKTATPVQAACIPKILEGSDILGCARTGTGKTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLIHQARELSERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPYFFEDKGKDDESTVDRLEQKYVVCPVAVKDAYLVYVVK-----------------NYSEKNPK---SSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAFRSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFVTQYDVELLQAVEQVIGKKL 460          
BLAST of SMED30012754 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4334091:1 gene:WBGene00019219.1 transcript:H20J04.4b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 248.44 bits (633), Expect = 4.743e-76
Identity = 141/390 (36.15%), Postives = 226/390 (57.95%), Query Frame = -3
Query:  208 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESS--ELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKEL 1371
            F +LGV   + + ++ ++ K  T +Q   IP  LEG DI+G A+TG+GKT AF IPILQ+L  DP   +AL+ TPTRELA QI  +F  LGK I +KC+ ++GG     QA ++  +PH+++ATPGR    + +      +  K ++F V+DEADRML  Q++  L  I   +   R+T L SAT T+ ++ L R S   P       K  ES+   L++  ++CP   + A+LV+++K                 NY + + K    S+++F QT      LAY  + LG     ++S + Q+QR A +   + + + +++ TDVA+RG+DIP+VD+V+ +++P+  KTY HR GR+ARAG+ G +++ V QY+      +++ + K+L
Sbjct:   91 FSQLGVCSWITQQLQTMQIKTATPVQAACIPKILEGSDILGCARTGTGKTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLIHQARELSERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPYFFEDKGKDDESTVDRLEQKYVVCPVAVKDAYLVYVVK-----------------NYSEKNPK---SSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAFRSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFVTQYDVELLQAVEQVIGKKL 460          
BLAST of SMED30012754 vs. Ensembl Celegans
Match: H20J04.4 (pep chromosome:WBcel235:II:4329023:4334484:1 gene:WBGene00019219.1 transcript:H20J04.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:H20J04.4)

HSP 1 Score: 248.44 bits (633), Expect = 4.743e-76
Identity = 141/390 (36.15%), Postives = 226/390 (57.95%), Query Frame = -3
Query:  208 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESS--ELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKEL 1371
            F +LGV   + + ++ ++ K  T +Q   IP  LEG DI+G A+TG+GKT AF IPILQ+L  DP   +AL+ TPTRELA QI  +F  LGK I +KC+ ++GG     QA ++  +PH+++ATPGR    + +      +  K ++F V+DEADRML  Q++  L  I   +   R+T L SAT T+ ++ L R S   P       K  ES+   L++  ++CP   + A+LV+++K                 NY + + K    S+++F QT      LAY  + LG     ++S + Q+QR A +   + + + +++ TDVA+RG+DIP+VD+V+ +++P+  KTY HR GR+ARAG+ G +++ V QY+      +++ + K+L
Sbjct:   91 FSQLGVCSWITQQLQTMQIKTATPVQAACIPKILEGSDILGCARTGTGKTLAFAIPILQKLSVDPYGIYALILTPTRELAFQIAEQFTALGKPITLKCSVIVGGRSLIHQARELSERPHVVVATPGRLADLIESDPDTIAKVFKKIQFFVLDEADRMLEGQYNDQLKPIFESISEKRQTLLLSATITNNINMLHRVSTRKPYFFEDKGKDDESTVDRLEQKYVVCPVAVKDAYLVYVVK-----------------NYSEKNPK---SSVMIFAQTCRECQALAYMFEGLGFRVGSLHSQIPQKQRLAALSAFRSKTLQVIICTDVASRGLDIPHVDLVVNHNVPQCPKTYIHRVGRSARAGRFGSALSFVTQYDVELLQAVEQVIGKKL 460          
BLAST of SMED30012754 vs. Ensembl Celegans
Match: ddx-27 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q95XM9])

HSP 1 Score: 198.749 bits (504), Expect = 4.041e-56
Identity = 134/378 (35.45%), Postives = 209/378 (55.29%), Query Frame = -3
Query:  259 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFF---ALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELK-EFM-LLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQ 1377
            +SF+++ ++  + +A     +  PT IQ+  IP AL GKDI   A TG+GKT AF +PIL+ ++  PK       LV  PTRELAIQ+   F  L   I ++     GGL  K Q   + + P +++ATPGR + H+  +  FN   L N++ LV+DEADRML   F   +N+++ +  + R+T LFSAT T+++ +L   SL  PVK+ ++E    + +L+ EF+ +    E     +V  L   T ++                       + IVFV+T+     +   L  LG+    + S ++Q QR  ++ K K  ++D++V+TD+A+RG+DI  V  VI  ++P+S K Y HR GRTARAGK G SI++V +
Sbjct:  148 VSFEQMNLSRQILKACSGAGYSDPTPIQQACIPVALTGKDICACAATGTGKTAAFVLPILERMIYRPKGASCTRVLVLVPTRELAIQVFQVFRKLSTFIQLEVCLCAGGLDLKAQEAALRSGPDVVVATPGRLIDHLHNSPSFN---LSNIEVLVLDEADRMLEEAFRDQMNELIRLCAQNRQTLLFSATMTEEIDELASMSLQKPVKIFINENTDTALKLRQEFIRIRAGRETDREAMVAALVTRTFQT-----------------------NTIVFVRTKKDCQRMQILLGLLGIKVGQMQSSLTQGQRIESLSKFKKAEIDVLVSTDLASRGLDIEGVQTVINMNMPKSIKQYIHRVGRTARAGKAGRSISLVGE 499          
BLAST of SMED30012754 vs. Ensembl Fly
Match: CG9253 (gene:FBgn0032919 transcript:FBtr0081468)

HSP 1 Score: 362.459 bits (929), Expect = 1.194e-120
Identity = 191/392 (48.72%), Postives = 264/392 (67.35%), Query Frame = -3
Query:  202 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPL 1377
            +++K+LG+N+ LC+A + +KWK P++IQ++AIP AL+GKD+IGLA+TGSGKTGAF +PIL  L+++P+ +FALV TPTRELA QI  +F  LG GIG+KC  ++GG+    Q  Q+  KPHIIIATPGR + H+   KGFN   LK +K+LVMDEADR+L+  F+ +L+KIL +LPR RRTFLFSAT T KV KLQRASL DPVKV V  KY    +L++  L  P + +  +LV +L +L                        A  S ++F  T   +   A  L+ LGL A P++  MSQ +R A ++K K +   I+++TDVA+RG+DIP+VDVV+ +DIP  +K Y HR GRTARAG+ G +IT+V+QY+   Y  I+  + K+L L
Sbjct:   61 LTWKDLGLNEALCQACDELKWKAPSKIQREAIPVALQGKDVIGLAETGSGKTGAFALPILHALLENPQRYFALVLTPTRELAFQIGEQFEALGSGIGIKCCVVVGGMDMVAQGLQLAKKPHIIIATPGRLVDHLENMKGFN---LKAIKYLVMDEADRILNMDFEVELDKILKVLPRERRTFLFSATMTKKVKKLQRASLKDPVKVEVSNKYQTVEQLQQSYLFIPVKYKDVYLVHILNEL------------------------AGNSFMIFCSTCNNTVKTALMLRALGLAAIPLHGQMSQNKRLAALNKFKAKNRSILISTDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITLVSQYDIELYQRIEHLLGKQLTL 425          
BLAST of SMED30012754 vs. Ensembl Fly
Match: Dbp45A (gene:FBgn0010220 transcript:FBtr0088564)

HSP 1 Score: 213.772 bits (543), Expect = 3.340e-63
Identity = 139/399 (34.84%), Postives = 226/399 (56.64%), Query Frame = -3
Query:  190 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPV-----KVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTD 1371
            F+ LG+   L + + ++  K  T IQ+K IP  L G+D IG AKTGSGKT AF +PIL+ L ++P   FALV TPT ELA QI  +F   G+ +GV+   + GG  +  ++ +++ +PHI++A PGR   H+     F   +  NLK+LV+DEADRML+  FD  L+ I   LP+TR+   FSAT  D +    + S I P+     + S D   A    L +  LLC    +   L+  L++                 Y + +      ++++F  T+    LL+  L+ + ++   ++  M Q++R A + + K  ++  ++ATDVAARG+DIP+V++V+ + +P + K Y HR GRTARAG++G+SI++   +  P+ +E+   +++E+   LT+
Sbjct:    9 FQILGLRPWLVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILERLSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQMVESQKLMQRPHIVVAMPGRLADHLTGCDTF---SFDNLKYLVVDEADRMLNGDFDESLSIIERCLPKTRQNLFFSATMKDFI----KESSIFPIASDCFEWSQDSDVATVETLDQRYLLCADYDRDMVLIEALRK-----------------YREEN---ENANVMIFTNTKKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTLIATDVAARGLDIPSVELVMNHMLPRTPKEYIHRVGRTARAGRKGMSISI---FRFPRDLELLAAIEEEINTKLTE 377          
BLAST of SMED30012754 vs. Ensembl Fly
Match: CG32344 (gene:FBgn0052344 transcript:FBtr0072576)

HSP 1 Score: 192.2 bits (487), Expect = 2.123e-53
Identity = 131/386 (33.94%), Postives = 209/386 (54.15%), Query Frame = -3
Query:  229 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELM-KDP-KPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPV--KVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQ 1374
             F+ +G+   L + I +  +K+PT IQ+K IP  LEG+D++ +AKTGSGKT  F IP+ ++L  ++P K   AL+ +PTRELA+Q       LG+ + +K   ++GG    +Q + I   P +I+ATPGRFL H+          L +++++V DEADR+    F   LN+ L+ LP +R+T +FSAT    + +  RA L DPV  ++ V+ K  ++  LK   L C  + +   LV LLK +      P +                    +VF  T+    L++Y L + G++   + S +    R     K   +KV +++ TDVAARGIDIP++D V+    P   K + HR GR ARAG+ G + ++V+  +T   +++ 
Sbjct:   40 GFQSMGLGFELIKGITKRGYKVPTPIQRKTIPLILEGRDVVAMAKTGSGKTACFLIPLFEKLQRREPTKGARALILSPTRELAVQTYKFIKELGRFMELKSILVLGGDSMDSQFSAIHTCPDVIVATPGRFL-HLCVEMDLK---LNSIEYVVFDEADRLFEMGFGEQLNETLHRLPSSRQTVMFSATLPKLLVEFARAGLNDPVLIRLDVESKLPDALALK--FLYCRPDDRYTALVVLLKYVI-----PVQ-----------------SQTVVFAGTQHHVELISYILTEAGISNASVYSSLDPAARKINTAKFVNKKVSVLIVTDVAARGIDIPSLDFVVNLHFPGKPKLFVHRVGRCARAGRTGTAYSIVSTDDTAHLLDLH 397          
BLAST of SMED30012754 vs. Ensembl Fly
Match: Rs1 (gene:FBgn0021995 transcript:FBtr0345935)

HSP 1 Score: 191.045 bits (484), Expect = 4.646e-53
Identity = 133/377 (35.28%), Postives = 205/377 (54.38%), Query Frame = -3
Query:  259 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFA----LVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELK-EFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQ 1374
            SF ++ ++  L  AI  + +  PT IQ   IP AL G+DI G A TG+GKT A+ +P L+ L+  P    A    LV  PTREL  Q+      L +   +     IGGL  K Q   +   P I+IATPGR + H+  T  F   TL +++ L++DEADRML   F   + +I+    +TR+T LFSAT +++V  L   SL  P+KV V+     +  L+ EF+ +   E +      +L  L C++            + D          +VFVQT+  ++ L   L  LG+ A  ++ +++Q+QR  ++ K K  ++D+++ATDVAARG+DI  V  VI + +P + + Y HR GRTARAG+ G+S+++  +
Sbjct:  158 SFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALLGRDICGCAATGTGKTAAYMLPTLERLLYRPLNNKAITRVLVLVPTRELGAQVYQVTKQLCQFTTIDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSF---TLDSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVKDLAAVSLDKPIKVFVNNNQQVAFNLRQEFIRI--REDKEGDREPILASLICRT------------FHDH--------CMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQRLESLKKFKEEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAGISVSLAGE 509          
BLAST of SMED30012754 vs. Ensembl Fly
Match: Rs1 (gene:FBgn0021995 transcript:FBtr0088788)

HSP 1 Score: 191.045 bits (484), Expect = 4.646e-53
Identity = 133/377 (35.28%), Postives = 205/377 (54.38%), Query Frame = -3
Query:  259 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFA----LVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELK-EFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQ 1374
            SF ++ ++  L  AI  + +  PT IQ   IP AL G+DI G A TG+GKT A+ +P L+ L+  P    A    LV  PTREL  Q+      L +   +     IGGL  K Q   +   P I+IATPGR + H+  T  F   TL +++ L++DEADRML   F   + +I+    +TR+T LFSAT +++V  L   SL  P+KV V+     +  L+ EF+ +   E +      +L  L C++            + D          +VFVQT+  ++ L   L  LG+ A  ++ +++Q+QR  ++ K K  ++D+++ATDVAARG+DI  V  VI + +P + + Y HR GRTARAG+ G+S+++  +
Sbjct:  158 SFYQMNLSRPLMRAIGVLGYIYPTPIQASTIPVALLGRDICGCAATGTGKTAAYMLPTLERLLYRPLNNKAITRVLVLVPTRELGAQVYQVTKQLCQFTTIDVGLAIGGLDVKAQEAVLRQNPDIVIATPGRLIDHIKNTPSF---TLDSIEVLILDEADRMLDEYFAEQMKEIINSCCKTRQTMLFSATMSEQVKDLAAVSLDKPIKVFVNNNQQVAFNLRQEFIRI--REDKEGDREPILASLICRT------------FHDH--------CMVFVQTKKQAHRLHILLGLLGVRAGELHGNLTQQQRLESLKKFKEEQIDVLIATDVAARGLDIVGVKTVINFVMPITTEHYIHRVGRTARAGRAGISVSLAGE 509          
BLAST of SMED30012754 vs. Ensembl Zebrafish
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 247.284 bits (630), Expect = 2.450e-76
Identity = 157/397 (39.55%), Postives = 225/397 (56.68%), Query Frame = -3
Query:  202 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLS---SQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMK---KELPL 1374
            +F+ LG+++ L +  +++    PT +Q+K IP  L+G+D +G AKTGSGKT AF +P+LQ+L +DP   F LV TPTRELA QI  +F  LGK +G+K   ++GG+   TQ  ++  KPH+++ATPGR   H+ ++   N   L  ++FL+MDEADR+L    + F +DL  IL  +P  R+T LFSAT TD + +LQ  ++  P             EL +  +L P + + A+LV L               I  F     D      SII+F  T     +L   L++       ++S M Q QR A + K K     I++ATDVAARG+DIP V VVI ++ P   K Y HR GRTARAG+ GVSIT+V QY+      I+E+ +   KE P+
Sbjct:    3 TFESLGLSEWLIQQCKQMGISRPTAVQEKCIPAILDGRDCMGCAKTGSGKTAAFVLPVLQKLSEDPYGVFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVTQGLELSKKPHVVVATPGRLADHIRSSDTIN---LNRIQFLIMDEADRLLEQGCTDFTKDLEVILSAVPVKRQTLLFSATLTDTLQQLQSIAMNRPFFWEHKSDVQTVKELDQRFILTPEKVKDAYLVHL---------------IQTFQDEHDDW-----SIIIFTNTCKSCQILTMMLREFNFPTISLHSMMKQRQRFANLAKFKSNVFKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDIHLINAIEEQNQTKLKEFPI 376          
BLAST of SMED30012754 vs. Ensembl Zebrafish
Match: ddx27 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:ZFIN;Acc:ZDB-GENE-031001-8])

HSP 1 Score: 199.134 bits (505), Expect = 7.006e-56
Identity = 133/394 (33.76%), Postives = 212/394 (53.81%), Query Frame = -3
Query:  217 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKP---FFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELK-EFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAF---NYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMK 1377
            ++F+++ ++  L +AI  + +K PT IQK  +P  L GKDI   A TG+GKT AF +P+L+ L+  P+       LV  PTREL IQ+ T    L +   +     +GGL  K+Q   +   P ++IATPGR + H+  T  F    L  ++ L++DEADRML   F+  + +I+ +    R+T LFSAT +++V  L   SL  PV++ V+     +  L+ EF+ + P ++     +                 +AA     + D         +++F QT+  ++ +   L  +GL    ++ ++SQ QR  ++ + K  ++DI+VATDVAARG+DI  V  VI + +P + K Y HR GRTARAGK G S+++V +       EI +K K
Sbjct:  201 LTFQDMNLSRPLLKAISTMGFKQPTPIQKACVPVGLLGKDICACAATGTGKTAAFMLPVLERLIYKPRETQVTRVLVLVPTRELGIQVHTVARQLAQFTTISTCLAVGGLDLKSQEAALRAGPDVLIATPGRLIDHLHNTPSFE---LSQIEILILDEADRMLDEYFEEQMKEIIRMCAYQRQTMLFSATMSEEVKDLASVSLKQPVRIFVNSNTDVAPYLRQEFVRIRPNKEGDREAI-----------------VAALLTRTFQD--------HVMLFTQTKKQAHRMHILLGLMGLKVGELHGNLSQTQRLESLRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGKVGRSVSLVGETERKMLKEIVKKAK 566          
BLAST of SMED30012754 vs. Ensembl Zebrafish
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 191.045 bits (484), Expect = 1.483e-52
Identity = 132/380 (34.74%), Postives = 197/380 (51.84%), Query Frame = -3
Query:  250 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELM--KDPKPF---FALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNT 1374
            SF   G ++ L   I + ++  PT IQ + +P AL G+D IG+AKTGSGKT AF  PIL  +M  K+ +P     A++  PTREL  QI  E    GK  G++   + GG     QA  +     I++ TPGR + HV         +L+ + FLV DEADRM    F+  +  I   +   R+T LFSAT   K+ KL R  L+DP++V   +    + ++ + + +    Q      WL ++L        EF  A              S++VFV  +     LA  L + G +   ++ DM Q +R   I   K + + ++VATDVAARG+DIP++  V+ YD+     T+THR GRT RAG++GV+ T++   +T
Sbjct:  256 SFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPIALSGRDAIGIAKTGSGKTAAFIWPILVHIMDQKELEPGEGPIAVIVCPTRELCQQIHAECKRFGKAYGLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK----KATSLQRVTFLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDILVDPIRVVQGDIGEANEDITQIVEVLQSGQDK--WGWLTRRLV-------EFTSAG-------------SVLVFVTKKANCEELATNLIQEGYSLGLLHGDMDQSERNKVIADFKKKNLPVLVATDVAARGLDIPSIRTVVNYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTTKDT 609          
BLAST of SMED30012754 vs. Ensembl Zebrafish
Match: ddx54 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [Source:ZFIN;Acc:ZDB-GENE-021220-2])

HSP 1 Score: 189.119 bits (479), Expect = 4.970e-52
Identity = 127/357 (35.57%), Postives = 190/357 (53.22%), Query Frame = -3
Query:  319 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKP---FFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPV--KVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTH 1374
             F+ +G++  + + I +  +K+PT IQ+K IP  L+GKD++ +A+TGSGKT AF +P+ ++L K P+      AL+ TPTRELA+Q       LGK  G++ A ++GG     Q   +   P III TPGR + HV          L++++++V DEADR+    F   L +I+  LP  R+T LFSAT    + +  RA L +PV  ++ VD K +E  +L  F L    + + A L+ LL+ +     KP E                    +VFV T+     L   L   G++   I S + Q  R  +I +   RKV +++ TDVAARGIDIP +D VI Y+ P   K + H
Sbjct:   79 GFQSMGLSYPVYKGIMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTAAFLVPLFEKL-KAPQAQTGARALILTPTRELALQTMKFTKELGKFTGLRTALILGGDSMDDQFAALHENPDIIIGTPGRLM-HVIQEMNLK---LQSVEYVVFDEADRLFEMGFAEQLQEIIRRLPDARQTLLFSATLPKLIVEFARAGLTEPVLIRLDVDTKLSEQLKLSFFSLRL--DDKPALLLHLLRNVV----KPQE------------------QTVVFVATKHHVEYLKELLSAEGVDCSCIYSALDQTARKISIGRFVHRKVMLLLVTDVAARGIDIPLLDNVINYNFPCKPKLFLH 406          
BLAST of SMED30012754 vs. Ensembl Zebrafish
Match: ddx18 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:ZFIN;Acc:ZDB-GENE-030131-9685])

HSP 1 Score: 182.57 bits (462), Expect = 1.728e-50
Identity = 121/353 (34.28%), Postives = 182/353 (51.56%), Query Frame = -3
Query:  319 VNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMK---DPKPFFA-LVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLI-DPVKVSVDEK--YAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTH 1356
            V++   + ++ + +   TEIQ K I P LEG+D++  AKTGSGKT AF IP ++ + K    P+     +V +PTRELA+Q       L          ++GG     +A ++ N  +I++ATPGR L H+  T GF     KNL+ L++DEADR+L   F+ +L +I+ +LP+ R++ LFSAT T KV  L R SL  +P+ V VD+    A    L++  ++CP E++   L   LK                        K   K ++VF  + M        L  + L    I+    Q +RT T  +       I++ TDVAARG+DIP VD ++Q+D P+  K Y H
Sbjct:  168 VSENTLKGVKEMGFDTMTEIQHKTIRPLLEGRDVLAAAKTGSGKTLAFLIPSIELIYKLKFMPRNGTGVIVLSPTRELAMQTYGVLKELMTHHVHTYGLIMGGSNRSAEAQKLANGVNILVATPGRLLDHLQNTPGF---MFKNLQCLIIDEADRILEVGFEEELKQIIKLLPKKRQSMLFSATQTRKVEDLARISLKKEPLYVGVDDNKDTATVEGLEQGYVVCPSEKRFLLLFTFLK------------------------KNRKKKLMVFFSSCMSVKFHYELLNYIDLPVMAIHGKQKQTKRTTTFFQFCNADSGILLCTDVAARGLDIPEVDWIVQFDPPDDPKEYIH 493          
BLAST of SMED30012754 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 354.755 bits (909), Expect = 3.405e-118
Identity = 187/397 (47.10%), Postives = 264/397 (66.50%), Query Frame = -3
Query:  184 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQ 1374
            +F+ELGV D LCE  E++ WK PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PILQ L++ P+  +ALV TPTRELA QI  +F  LG  IGVK A ++GG+   +Q+  +  KPH++IATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L DPVK +V  KY    +L++F +  P + + ++LV++L +L                        A  S ++F  T   +  +A  L+ LG  A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVVI +DIP  +K Y HR GRTARAG+ G +IT V+QY+   +  I+  + K+LP   T  +
Sbjct:   20 TFRELGVTDVLCETCEQLGWKQPTKIQIEAIPVALQGRDIIGLAETGSGKTGAFALPILQTLLESPQRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQSLALAKKPHVVIATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKDPVKCAVSSKYQTVEKLQQFYVFIPSKFKDSYLVYILNEL------------------------AGNSFMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQYDVELFQRIEHLIGKKLPAFPTQEE 389          
BLAST of SMED30012754 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 347.821 bits (891), Expect = 1.294e-115
Identity = 185/393 (47.07%), Postives = 260/393 (66.16%), Query Frame = -3
Query:  184 LGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQ 1362
            LGV D LCE  E++ WK PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PILQ L++ P+  +ALV TPTRELA QI  +F  LG  IGVK A ++GG+   +Q+  +  KPH++IATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L DPVK +V  KY    +L++F +  P + + ++LV++L +L                        A  S ++F  T   +  +A  L+ LG  A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVVI +DIP  +K Y HR GRTARAG+ G +IT V+QY+   +  I+  + K+LP   T  +
Sbjct:   20 LGVTDVLCETCEQLGWKQPTKIQIEAIPVALQGRDIIGLAETGSGKTGAFALPILQTLLESPQRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQSLALAKKPHVVIATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKDPVKCAVSSKYQTVEKLQQFYVFIPSKFKDSYLVYILNEL------------------------AGNSFMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQYDVELFQRIEHLIGKKLPAFPTQEE 385          
BLAST of SMED30012754 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 346.665 bits (888), Expect = 2.913e-115
Identity = 184/392 (46.94%), Postives = 259/392 (66.07%), Query Frame = -3
Query:  184 GVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQ 1359
            GV D LCE  E++ WK PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PILQ L++ P+  +ALV TPTRELA QI  +F  LG  IGVK A ++GG+   +Q+  +  KPH++IATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L DPVK +V  KY    +L++F +  P + + ++LV++L +L                        A  S ++F  T   +  +A  L+ LG  A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVVI +DIP  +K Y HR GRTARAG+ G +IT V+QY+   +  I+  + K+LP   T  +
Sbjct:    9 GVTDVLCETCEQLGWKQPTKIQIEAIPVALQGRDIIGLAETGSGKTGAFALPILQTLLESPQRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQSLALAKKPHVVIATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKDPVKCAVSSKYQTVEKLQQFYVFIPSKFKDSYLVYILNEL------------------------AGNSFMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQYDVELFQRIEHLIGKKLPAFPTQEE 373          
BLAST of SMED30012754 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 346.665 bits (888), Expect = 5.254e-115
Identity = 184/392 (46.94%), Postives = 259/392 (66.07%), Query Frame = -3
Query:  184 GVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQ 1359
            GV D LCE  E++ WK PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PILQ L++ P+  +ALV TPTRELA QI  +F  LG  IGVK A ++GG+   +Q+  +  KPH++IATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L DPVK +V  KY    +L++F +  P + + ++LV++L +L                        A  S ++F  T   +  +A  L+ LG  A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVVI +DIP  +K Y HR GRTARAG+ G +IT V+QY+   +  I+  + K+LP   T  +
Sbjct:   27 GVTDVLCETCEQLGWKQPTKIQIEAIPVALQGRDIIGLAETGSGKTGAFALPILQTLLESPQRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQSLALAKKPHVVIATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKDPVKCAVSSKYQTVEKLQQFYVFIPSKFKDSYLVYILNEL------------------------AGNSFMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQYDVELFQRIEHLIGKKLPAFPTQEE 391          
BLAST of SMED30012754 vs. Ensembl Xenopus
Match: mki67 (marker of proliferation Ki-67 [Source:Xenbase;Acc:XB-GENE-6457930])

HSP 1 Score: 345.895 bits (886), Expect = 7.816e-115
Identity = 184/392 (46.94%), Postives = 259/392 (66.07%), Query Frame = -3
Query:  184 GVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQ 1359
            GV D LCE  E++ WK PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PILQ L++ P+  +ALV TPTRELA QI  +F  LG  IGVK A ++GG+   +Q+  +  KPH++IATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L DPVK +V  KY    +L++F +  P + + ++LV++L +L                        A  S ++F  T   +  +A  L+ LG  A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVVI +DIP  +K Y HR GRTARAG+ G +IT V+QY+   +  I+  + K+LP   T  +
Sbjct:   20 GVTDVLCETCEQLGWKQPTKIQIEAIPVALQGRDIIGLAETGSGKTGAFALPILQTLLESPQRLYALVLTPTRELAFQISEQFEALGSTIGVKSAVIVGGIDMMSQSLALAKKPHVVIATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKDPVKCAVSSKYQTVEKLQQFYVFIPSKFKDSYLVYILNEL------------------------AGNSFMIFCSTCNNTQRVALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKAKSRSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQYDVELFQRIEHLIGKKLPAFPTQEE 384          
BLAST of SMED30012754 vs. Ensembl Mouse
Match: Ddx47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:MGI Symbol;Acc:MGI:1915005])

HSP 1 Score: 351.288 bits (900), Expect = 5.737e-117
Identity = 187/400 (46.75%), Postives = 264/400 (66.00%), Query Frame = -3
Query:  178 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLT-DRQAM 1374
            +FK+LGV D LCEA +++ W  PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PIL  L++ P+  FALV TPTRELA QI  +F  LG  IGV+CA ++GG+   +Q+  +  KPHI+IATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L +PVK +V  KY    +L+++ L  P + +  +LV++L +L                        A  S ++F  T   +   A  L+ LG  A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVV+ +DIP  +K Y HR GRTARAG+ G +IT V QY+   +  I+  + K+LP+  T D + M
Sbjct:   25 TFKDLGVTDVLCEACDQLGWAKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQCAVIVGGIDSMSQSLALAKKPHIVIATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYLFIPSKFKDTYLVYILNEL------------------------AGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPVFPTQDEEVM 397          
BLAST of SMED30012754 vs. Ensembl Mouse
Match: Ddx47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:MGI Symbol;Acc:MGI:1915005])

HSP 1 Score: 317.005 bits (811), Expect = 1.563e-104
Identity = 178/400 (44.50%), Postives = 248/400 (62.00%), Query Frame = -3
Query:  178 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLT-DRQAM 1374
            +FK+LGV D LCEA +++ W  PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PIL  L++ P+  FALV TPTRELA QI  +F  LG  IGV+C                        ATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L +PVK +V  KY    +L+++ L  P + +  +LV++L +L                        A  S ++F  T   +   A  L+ LG  A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVV+ +DIP  +K Y HR GRTARAG+ G +IT V QY+   +  I+  + K+LP+  T D + M
Sbjct:   25 TFKDLGVTDVLCEACDQLGWAKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQC------------------------ATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYLFIPSKFKDTYLVYILNEL------------------------AGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPVFPTQDEEVM 373          
BLAST of SMED30012754 vs. Ensembl Mouse
Match: Ddx47 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:MGI Symbol;Acc:MGI:1915005])

HSP 1 Score: 267.7 bits (683), Expect = 1.563e-85
Identity = 129/238 (54.20%), Postives = 174/238 (73.11%), Query Frame = -3
Query:  661 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLK 1374
            +FK+LGV D LCEA +++ W  PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PIL  L++ P+  FALV TPTRELA QI  +F  LG  IGV+CA ++GG+   +Q+  +  KPHI+IATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L +PVK +V  KY    +L+++ L  P + +S  L  L K
Sbjct:   22 TFKDLGVTDVLCEACDQLGWAKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQCAVIVGGIDSMSQSLALAKKPHIVIATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYLFIPSKFKSKRLGSLNK 256          

HSP 2 Score: 74.7146 bits (182), Expect = 3.870e-14
Identity = 45/99 (45.45%), Postives = 68/99 (68.69%), Query Frame = -3
Query:  178 QEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLT-DRQAM 471
            + +R  +++K K +   I++ATDVA+RG+DIP+VDVV+ +DIP  +K Y HR GRTARAG+ G +IT V QY+   +  I+  + K+LP+  T D + M
Sbjct:  247 KSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPVFPTQDEEVM 345          
BLAST of SMED30012754 vs. Ensembl Mouse
Match: Ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:MGI Symbol;Acc:MGI:2136689])

HSP 1 Score: 251.521 bits (641), Expect = 7.997e-78
Identity = 162/407 (39.80%), Postives = 232/407 (57.00%), Query Frame = -3
Query:  163 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLS---SQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQAMESELL 1374
             F E+G++  L E   ++  K PT +Q   IP  LEG+D +G AKTGSGKT AF +PILQ+L +DP   F LV TPTRELA QI  +F  LGK +G+K   ++GG+    QA ++  KPH++IATPGR   H+ ++  FN   +K ++FLVMDEADR+L    + F  DL  IL  +P  R+T LFSAT TD + +LQ  +  +P             +L +  LL P + + A+LV L++                F     D      SII+F  T     +L   L+K       ++S M Q++R A + K K     I++ATDVA+RG+DIP V VVI ++ P   K Y HR GRTARAG++G +IT+V QY+      I+E++K++L  L+ +    E+E+L
Sbjct:    3 GFAEIGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGRLADHLRSSNTFN---MKKIQFLVMDEADRLLEQGCTDFTTDLETILAAVPARRQTLLFSATLTDTLKELQGLATNEPFFWEAQATVRTVEQLDQRYLLVPEKVKDAYLVHLVQ---------------TFQDQLEDC-----SIIIFTNTCKTCQILCMMLRKFNFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLLHAIEEQIKQQLAELVVE----EAEVL 382          
BLAST of SMED30012754 vs. Ensembl Mouse
Match: Ddx18 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:MGI Symbol;Acc:MGI:1914192])

HSP 1 Score: 194.512 bits (493), Expect = 8.900e-55
Identity = 130/353 (36.83%), Postives = 187/353 (52.97%), Query Frame = -3
Query:  319 VNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMK---DPKPFFA-LVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLI-DPVKVSVDE--KYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTH 1356
            VN+   +AIE + +K  TEIQ K+I P LEG+D++  AKTGSGKT AF IP+++ ++K    P+     L+ +PTRELA+Q       L          ++GG     +  ++LN  +II+ATPGR L H+  T GF     KNL+ LV+DEADR+L   F+ +L +I+ +LP  R+T LFSAT T KV  L R SL  +P+ V VD+  + A    L++  ++CP E++   L   LK                        K   K ++VF  + M        L  + L    I+    Q +RT T  +       I++ TDVAARG+DIP VD ++QYD P+  K Y H
Sbjct:  176 VNENTLKAIEEMGFKRMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPVIELIVKLKFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEVQKLLNGINIIVATPGRLLDHMQNTPGF---MYKNLQCLVIDEADRILDVGFEEELKQIIKLLPARRQTMLFSATQTRKVEDLARISLKKEPLYVGVDDDKEVATVDGLEQGYVVCPSEKRFLLLFTFLK------------------------KNRKKKVMVFFSSCMSVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGILLCTDVAARGLDIPEVDWIVQYDPPDDPKEYIH 501          
BLAST of SMED30012754 vs. UniProt/SwissProt
Match: sp|P34580|DDX47_CAEEL (Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans OX=6239 GN=T26G10.1 PE=3 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 1.315e-119
Identity = 189/389 (48.59%), Postives = 260/389 (66.84%), Query Frame = -3
Query:  208 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKEL 1374
            SF ELGV+  LC+A +R+ W  P++IQ+ A+P AL+GKD+IGLA+TGSGKTGAF IP+LQ L+  P+ FF LV TPTRELA QI  +F  LG GIG+  A ++GG+    QA  +  +PHII+ATPGR + H+  TKGFN   LK LKFL+MDEADR+L+  F+ +L+KIL ++PR RRT+LFSAT T KVSKL+RASL DP +VSV  +Y     LK+  +  P + +  +LV+LL +                         A  S IVF  T   +  +A  L++LG+ A P++  MSQE+R  +++K K +  +I+V TDVAARG+DIP+VD+VI YD+P  +K Y HR GRTARAG+ G++IT+V QY+   Y +I+  + K+L
Sbjct:   45 SFAELGVSQPLCDACQRLGWMKPSKIQQAALPHALQGKDVIGLAETGSGKTGAFAIPVLQSLLDHPQAFFCLVLTPTRELAFQIGQQFEALGSGIGLIAAVIVGGVDMAAQAMALARRPHIIVATPGRLVDHLENTKGFN---LKALKFLIMDEADRILNMDFEVELDKILKVIPRERRTYLFSATMTKKVSKLERASLRDPARVSVSSRYKTVDNLKQHYIFVPNKYKETYLVYLLNE------------------------HAGNSAIVFCATCATTMQIAVMLRQLGMQAVPLHGQMSQEKRLGSLNKFKSKAREILVCTDVAARGLDIPHVDMVINYDMPSQSKDYVHRVGRTARAGRSGIAITVVTQYDVEAYQKIEANLGKKL 406          
BLAST of SMED30012754 vs. UniProt/SwissProt
Match: sp|Q6CH58|RRP3_YARLI (ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=RRP3 PE=3 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 5.100e-119
Identity = 186/409 (45.48%), Postives = 268/409 (65.53%), Query Frame = -3
Query:  148 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQAMESELLADFAD 1374
            +FK+LGV D++CE  E +K+  PT IQ ++IP ALEG+DIIGLA+TGSGKT AF IP+LQ L ++P+P + +V  PTRELA QI   F  LG  +G++ A ++GG+   TQA  +  KPH+I+ATPGR + H+  TKGF   +L+ LKFLVMDEADR+L  +F   L+KIL ++PR R T+LFSAT T KV KLQRASL+DPV+V+V  KY  +  L ++M+ CP++ +  HLV+L+ +                         A  S+I+F +T+  +  ++  L+ LG  A P++ D+SQ  R   ++K K    +I++ATDVA+RG+DIP VD+VI YDIP  +K+Y HR GRTARAG+ G S+ +V+QY+   Y+ I+  + K+L     D   +ESE +  F++
Sbjct:   65 TFKDLGVIDSICETCEELKFTKPTPIQAQSIPYALEGRDIIGLAQTGSGKTAAFAIPVLQSLYENPQPLYCVVLAPTRELAYQISETFEALGSAMGLRTAVVVGGMNMMTQAVALSKKPHVIVATPGRLVDHLENTKGF---SLRTLKFLVMDEADRLLDMEFGPSLDKILKVIPRQRNTYLFSATMTSKVEKLQRASLVDPVRVAVSTKYQTADNLLQYMVFCPFKHKDTHLVYLVSE------------------------NAGNSMIIFARTKSDTQRISLLLRNLGYGAIPLHGDLSQTARLGALNKFKSGSRNILIATDVASRGLDIPAVDLVINYDIPSDSKSYIHRVGRTARAGRAGKSVALVSQYDLELYLRIEGALGKKL-----DSYPLESEAVMLFSE 441          
BLAST of SMED30012754 vs. UniProt/SwissProt
Match: sp|Q5B5E7|RRP3_EMENI (ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rrp3 PE=3 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 5.940e-118
Identity = 189/390 (48.46%), Postives = 253/390 (64.87%), Query Frame = -3
Query:  205 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELP 1374
            SFKELG+ D LCEA E + +K PT IQ +AIP ALEG+D+IGLA+TGSGKT AF +P+LQ LM+ P+  F LV  PTRELA QI   F  LG  IGV+CA ++GG+    Q+  +  KPHII+ATPGR L H+  TKGF   +L+NLK+L +DEADR+L   F   L+KI+ ILPRTR T+LFSAT + KV  LQRASL +PV+VSV  KY   S L+   +  P++ ++ +LV+LL +   +SA                        I+F  T   +  +A+ L+ LG  A P++  +SQ  R   + K + R  DI+VATDVAARG+DIP+VDVV  +D+P  +KTY HR GRTARAGK GV+I+ V QY+   ++ I+  + K+LP
Sbjct:   47 SFKELGIIDQLCEACENMGYKAPTPIQSQAIPLALEGRDVIGLAETGSGKTAAFALPMLQALMEAPQTLFGLVLAPTRELAYQISQAFETLGSTIGVRCAVIVGGMDMVAQSIALGKKPHIIVATPGRLLDHLENTKGF---SLRNLKYLAIDEADRLLDMDFGESLDKIIRILPRTRHTYLFSATMSTKVESLQRASLSNPVRVSVSSKYQTVSTLQSSYICIPHKHKNLYLVYLLNEFAGQSA------------------------IIFTTTVHETQRVAFMLRALGFGAIPLHGQLSQSARLGALGKFRSRSRDILVATDVAARGLDIPSVDVVFNFDLPMDSKTYIHRVGRTARAGKSGVAISFVTQYDVEVWLRIEHALSKKLP 409          
BLAST of SMED30012754 vs. UniProt/SwissProt
Match: sp|Q29S22|DDX47_BOVIN (Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus OX=9913 GN=DDX47 PE=2 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 3.632e-116
Identity = 185/394 (46.95%), Postives = 261/394 (66.24%), Query Frame = -3
Query:  193 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLT 1374
            +FK+LGV D LCEA +++ W  PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PIL  L++ P+  FALV TPTRELA QI  +F  LG  IGV+CA ++GG+   +Q+  +  KPHI+IATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L +PVK +V  KY    +L+++ L  P + +  +LV++L +L                        A  S ++F  T   +   A  L+ LG  A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVV+ +DIP  +K Y HR GRTARAG+ G +IT V QY+   +  I+  + K+LP+  T
Sbjct:   27 TFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQCAVIVGGIDSMSQSLALAKKPHIVIATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYLFIPSKFKDTYLVYILNEL------------------------AGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPVFPT 393          
BLAST of SMED30012754 vs. UniProt/SwissProt
Match: sp|Q9CWX9|DDX47_MOUSE (Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus OX=10090 GN=Ddx47 PE=2 SV=2)

HSP 1 Score: 351.288 bits (900), Expect = 4.013e-116
Identity = 187/400 (46.75%), Postives = 264/400 (66.00%), Query Frame = -3
Query:  178 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLT-DRQAM 1374
            +FK+LGV D LCEA +++ W  PT+IQ +AIP AL+G+DIIGLA+TGSGKTGAF +PIL  L++ P+  FALV TPTRELA QI  +F  LG  IGV+CA ++GG+   +Q+  +  KPHI+IATPGR + H+  TKGFN   L+ LK+LVMDEADR+L+  F+ +++KIL ++PR R+TFLFSAT T KV KLQRA+L +PVK +V  KY    +L+++ L  P + +  +LV++L +L                        A  S ++F  T   +   A  L+ LG  A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVV+ +DIP  +K Y HR GRTARAG+ G +IT V QY+   +  I+  + K+LP+  T D + M
Sbjct:   25 TFKDLGVTDVLCEACDQLGWAKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQCAVIVGGIDSMSQSLALAKKPHIVIATPGRLIDHLENTKGFN---LRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQRAALKNPVKCAVSSKYQTVEKLQQYYLFIPSKFKDTYLVYILNEL------------------------AGNSFMIFCSTCNNTQRTALLLRNLGFTAIPLHGQMSQSKRLGSLNKFKAKARSILLATDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPVFPTQDEEVM 397          
BLAST of SMED30012754 vs. TrEMBL
Match: S8BZF6 (Uncharacterized protein (Fragment) OS=Genlisea aurea OX=192259 GN=M569_17255 PE=3 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 1.255e-122
Identity = 193/387 (49.87%), Postives = 267/387 (68.99%), Query Frame = -3
Query:  214 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKK 1374
            SF++LGVN+ L EA + + WK+PT+IQ +AIP ALEGKDIIGLA+TGSGKTGAF IPILQ L++ P+PFFA V +PTRELAIQI  +F  LG GIGVKCA L+GG+ +  Q+  +  +PHI++ATPGR L H+  TKGF   +L+NLK+LV+DEADR+L+ +F++ +++IL ++PR RRTFLFSAT T KV KLQR SL +PVK+    KY+    LK+     P + +  +LV++L  ++  ++                        +VF +T   + LLAY L+ LG  A PIN  MSQ +R   ++K K  +  I++ TDVA+RG+DIP+VDVVI YDIP ++K Y HR GRTARAG+ GV+I++VNQY    Y++I++ + K
Sbjct:    4 SFRDLGVNNELAEACDSLGWKMPTKIQVEAIPLALEGKDIIGLAQTGSGKTGAFAIPILQSLLQTPQPFFACVLSPTRELAIQISEQFEALGSGIGVKCAVLVGGVDQVQQSIALGKRPHIVVATPGRLLDHLTNTKGF---SLRNLKYLVLDEADRLLNEEFEKAIDEILNVIPRERRTFLFSATMTKKVKKLQRTSLKNPVKIEAASKYSTVDTLKQQYRFLPAKYKDCYLVYILNGVSGSTS------------------------MVFCRTCDATMLLAYLLRNLGFGAIPINGHMSQPKRLGALNKFKAGECKILLCTDVASRGLDIPSVDVVINYDIPTNSKDYIHRVGRTARAGRSGVAISLVNQYELEWYLQIEKLIGK 363          
BLAST of SMED30012754 vs. TrEMBL
Match: L8AZT4 (Vasa-like gene-2 (Fragment) OS=Pinctada fucata OX=50426 GN=vlg2 PE=2 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 2.305e-122
Identity = 198/398 (49.75%), Postives = 268/398 (67.34%), Query Frame = -3
Query:  184 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQ 1377
            +SFK LGV D LCEA ER+KWK P++IQ++AIP AL+G DIIGLA+TGSGKTGAF IPILQ+L+  P+  +AL+ TPTRELA QI  +F  LG  IGVKCA ++GG+   +Q+  +  KPHIIIATPGR + H+  TKGFN   L+ LKFLVMDEADR+L+  F+++++KIL ++PR R T+L+SAT T KV+KLQRASL +PVKV V  KY    +L+++ L  P + +  +LV +L +L                        A  S +VF  T   +   A  L+ LGL A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVVI +DIP  +K Y HR GRTARAG+ G +IT V+QY+   Y  I+  + K+LPL  T+ Q
Sbjct:   22 VSFKSLGVVDVLCEACERLKWKSPSKIQREAIPVALQGSDIIGLAETGSGKTGAFAIPILQKLLDSPQRLYALILTPTRELAFQISEQFEALGSAIGVKCAVVVGGIDMMSQSLMLAKKPHIIIATPGRLIDHLENTKGFN---LRALKFLVMDEADRILNMDFEQEVDKILKVIPRERSTYLYSATMTKKVAKLQRASLQNPVKVEVSSKYQTVDKLQQYYLFVPAKFKDVYLVSVLNEL------------------------AGNSFMVFTSTCANTQRTALMLRNLGLTAIPLHGQMSQSKRLGSLNKFKSKSRSILIATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAITFVSQYDVELYQRIEHLIGKKLPLYKTEEQ 392          
BLAST of SMED30012754 vs. TrEMBL
Match: A0A0M4EQU0 (CG9253 OS=Drosophila busckii OX=30019 GN=Dbus_chr2Lg1510 PE=3 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 1.042e-121
Identity = 201/406 (49.51%), Postives = 273/406 (67.24%), Query Frame = -3
Query:  160 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQAMESELLA 1377
            +++K+LG+NDTLC+A E +KWK P++IQK+AIP AL+GKD+IGLA+TGSGKTGAF +PIL  L+++P+ +FALV TPTRELA QI  +F  LG GIG+KC  ++GG+    Q  Q+  KPH+IIATPGR + H+   KGFN   LK +K+LVMDEADR+L+  F+ +L+KIL +LPR RRTFLFSAT T KV KLQRASL DPVKV V  KY    +L+++ L  P + +  +LV +L +L                        A  S ++F  T   +   A  L+ LGL A P++  MSQ +R A ++K K +   I+++TDVA+RG+DIP+VDVVI +DIP  +K Y HR GRTARAG+ G +ITMV+QY+   Y  I+  + K+LPL     +  E E+LA
Sbjct:   70 LTWKDLGLNDTLCQACEELKWKAPSKIQKEAIPVALQGKDVIGLAETGSGKTGAFALPILHALLENPQRYFALVLTPTRELAFQIGEQFEALGVGIGIKCCVIVGGMDMVAQGLQLAKKPHVIIATPGRLVDHLENLKGFN---LKAIKYLVMDEADRILNMDFEVELDKILKVLPRERRTFLFSATMTKKVKKLQRASLKDPVKVEVSNKYQTVDQLQQYYLFIPVKYKDVYLVHILNEL------------------------AGNSFMIFCSTCNNTVKTALMLRALGLAAIPLHGQMSQNKRLAALNKFKAKNRSILISTDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGQAITMVSQYDIELYQRIEHLLGKQLPLY----KCEEDEVLA 444          
BLAST of SMED30012754 vs. TrEMBL
Match: A0A433TKW7 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_010076 PE=3 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 2.438e-121
Identity = 199/394 (50.51%), Postives = 264/394 (67.01%), Query Frame = -3
Query:  193 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLT 1374
            SFK+LGV D LCEA ER+KWK P++IQK++IP ALEGKD+IGLA+TGSGKTGAF +PILQ L++ P+  FALV TPTRELA QI  +FN LG  IG+KCA ++GG+    QA  +  KPH+I+ATPGR + H+  TKGF   +L+ +K+LVMDEADR+L+  F+++++KIL ++P+ RRTFLFSAT T KV KLQRA L DP KV V+ KY     L +  L  P + +  +LV +L +L                        A  + I+F  T   +  LA  L+ LGL A P++  MSQE+R   ++K K +  +I++ATDVA+RG+DIP+VDVVI +DIP  +K Y HR GRTARAG+ G SIT V QY    Y  I+E + K+LPL  T
Sbjct:   10 SFKDLGVVDVLCEACERLKWKEPSKIQKESIPLALEGKDVIGLAETGSGKTGAFALPILQALLEKPQRLFALVLTPTRELAYQIAEQFNALGSTIGIKCAVIVGGIDMYDQALMLAKKPHVIVATPGRLVDHLENTKGF---SLRAVKYLVMDEADRILNMDFEQEVDKILKVIPKERRTFLFSATMTKKVQKLQRACLRDPAKVEVNTKYKTVDNLVQSYLFIPVKFKDVYLVHILNEL------------------------AGNTFIIFSSTCNNTQRLALMLRNLGLKAIPLHGQMSQEKRLGALNKFKSKNSNILIATDVASRGLDIPHVDVVINFDIPSHSKDYIHRVGRTARAGRAGKSITFVTQYEVELYKRIEELINKQLPLYAT 376          
BLAST of SMED30012754 vs. TrEMBL
Match: B4N7D0 (Uncharacterized protein OS=Drosophila willistoni OX=7260 GN=Dwil\GK21047 PE=3 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 3.013e-121
Identity = 197/392 (50.26%), Postives = 267/392 (68.11%), Query Frame = -3
Query:  202 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPL 1377
            +++K+LG+N+TLC+A E +KWK P++IQK+AIP AL+GKD+IGLA+TGSGKTGAF +PILQ L+++P+ +FALV TPTRELA QI  +F  LG GIG+KC  ++GG+    Q  Q+  KPHIIIATPGR + H+   KGFN   LK +K+LVMDEADR+L+  F+ +L+KIL +LPR RRTFLFSAT T KV KLQRASL DPVKV V  KY    +L++  L  P + +  +LV +L +L                        A  S ++F  T   +   A  L+ LGL A P++  MSQ +R A ++K K +   I+++TDVA+RG+DIP+VDVV+ +DIP  +K Y HR GRTARAG+ G +ITMV+QY+   Y  I+  + K+LPL
Sbjct:   55 LTWKDLGLNETLCQACEELKWKAPSKIQKEAIPVALQGKDVIGLAETGSGKTGAFALPILQALLENPQRYFALVLTPTRELAFQIGEQFEALGSGIGIKCCVVVGGMDMVAQGLQLAKKPHIIIATPGRLVDHLENMKGFN---LKAIKYLVMDEADRILNMDFEVELDKILKVLPRERRTFLFSATMTKKVKKLQRASLKDPVKVEVSNKYQTVEQLQQSYLFIPVKYKDVYLVHILNEL------------------------AGNSFMIFCSTCNNTVKTALMLRALGLAAIPLHGQMSQNKRLAALNKFKAKNRSILISTDVASRGLDIPHVDVVVNFDIPTHSKDYIHRVGRTARAGRSGRAITMVSQYDIELYQRIEHLLGKQLPL 419          
BLAST of SMED30012754 vs. Ensembl Cavefish
Match: ddx47 (DEAD-box helicase 47 [Source:NCBI gene;Acc:103034543])

HSP 1 Score: 351.673 bits (901), Expect = 6.461e-117
Identity = 189/397 (47.61%), Postives = 259/397 (65.24%), Query Frame = -3
Query:  184 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQ 1374
            SFKELGV + LCEA E++ WK PT+IQ +AIP ALEG+D+IGLA+TGSGKTGAF +PILQ L+  P+    LV TPTRELA QI  +F  LG  IGVK A ++GG+   +QA  +  KPHI+IATPGR + H+  TKGFN   L+ L+FLVMDEADR+L+  F+ +++KIL ++PR R TFLFSAT T KV KLQRA+L DPVK +V  KYA   +L+++ +  P + +  +LV +L +L                        A  S ++F  T   +  +A  L+ LG+ A P++  MSQ +R  +++K K +   +++ATDVA+RG+DIP+VD VI +DIP  +K Y HR GRTARAG+ G SIT V QY+   +  I+  + K+LP   T  +
Sbjct:   29 SFKELGVTEVLCEACEQLGWKQPTKIQIEAIPVALEGRDVIGLAETGSGKTGAFALPILQTLLSHPQRLHTLVLTPTRELAFQIAEQFEALGSSIGVKTAVVVGGIDMMSQAMVLAKKPHIVIATPGRLIDHLENTKGFN---LRALRFLVMDEADRILNMDFESEVDKILKVIPRERHTFLFSATMTKKVQKLQRAALKDPVKCAVSTKYATVDKLQQYYIFIPAKYKDCYLVSILNEL------------------------AGNSFMIFCGTCNNAQRVALLLRNLGITAIPLHGQMSQNKRLGSLNKFKAKSRSVLLATDVASRGLDIPHVDCVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVTQYDVELFQRIEALIGKKLPAFPTQEE 398          
BLAST of SMED30012754 vs. Ensembl Cavefish
Match: ddx49 (DEAD-box helicase 49 [Source:NCBI gene;Acc:103043246])

HSP 1 Score: 249.21 bits (635), Expect = 4.169e-77
Identity = 151/392 (38.52%), Postives = 229/392 (58.42%), Query Frame = -3
Query:  208 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLS---SQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKEL 1374
            +F  LG++D L +  +++    PT +Q+  +P  L G+D +G AKTGSGKT AF +P+LQ+L +DP   F LV TPTRELA QI  +F  LGK +G++   ++GG+    Q  ++  KPHI++ATPGR   H+ ++  FN   +K +KFL++DEADR+L    + F +DL  IL ++P  R+T LFSAT TD + +L+  ++ +P       +     EL +  +L P + + A+LV L++++        E D                S+++F  T     +L   L++    A  ++S M Q QR A + K K     I++ATDVAARG+DIP V VVI ++ P   K Y HR GRTARAG+ GVSIT+V QY+      I+E+++ +L
Sbjct:    3 AFAALGLSDWLIQQCKQMGITRPTPVQQSCVPAILAGRDCMGCAKTGSGKTAAFVLPVLQKLAEDPYGIFCLVLTPTRELAYQIAEQFRALGKPLGLRDCIIVGGMDMVAQGLELSKKPHIVVATPGRLADHIRSSDTFN---MKRIKFLILDEADRLLEQGCTDFTKDLEVILSVVPAKRQTLLFSATLTDTLQELKTIAMNEPFFWENKSEVRTVDELDQRYILTPEKVKDAYLVHLIQKIQ------DEHD--------------DWSVMIFTNTCKNCQILTMMLREFKFPAISLHSMMKQRQRFANLAKFKSNVFKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDIHLVNAIEEQIQTKL 371          
BLAST of SMED30012754 vs. Ensembl Cavefish
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:103032272])

HSP 1 Score: 197.978 bits (502), Expect = 1.158e-55
Identity = 132/394 (33.50%), Postives = 211/394 (53.55%), Query Frame = -3
Query:  217 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKP---FFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELK-EFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAF---NYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMK 1377
            ++F+++ ++  L +AI  + +K PT +QK  +P  L GKDI   A TG+GKT AF +P+L+ L+  P+       LV  PTREL IQ+ +    L +   +     +GGL  K+Q   +   P I+IATPGR + H+  T  F    L  ++ L++DEADRML   F+  + +I+ +    R+T LFSAT +++V  L   SL  PV++ V+     +  L+ EF+ + P  +     +                 +AA     + D         +++F QT+  ++ +   L  +GL    ++ ++SQ QR  ++ + K  ++DI+VATDVAARG+DI  V  VI + +P + K Y HR GRTARAGK G S+++V +       EI +K K
Sbjct:  166 LTFQDMNLSRPLLKAITTMGFKQPTPVQKACVPVGLLGKDICACAATGTGKTAAFMLPVLERLLYKPRETQVTRVLVLVPTRELGIQVHSVARQLSQFTTISTCLAVGGLDLKSQEAALRAGPDILIATPGRLIDHLHNTPSFE---LSQIEVLILDEADRMLDEYFEEQMKEIIRLCAYQRQTMLFSATMSEEVKDLASVSLKQPVRIFVNSNTDVAPYLRQEFVRIRPAREGDREAI-----------------VAALLTRTFQD--------HVMLFTQTKKQAHRMHILLGLMGLKVGELHGNLSQTQRLESLRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGKVGRSVSLVGETERKMLKEIVKKAK 531          
BLAST of SMED30012754 vs. Ensembl Cavefish
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:103032272])

HSP 1 Score: 197.978 bits (502), Expect = 1.645e-55
Identity = 132/394 (33.50%), Postives = 211/394 (53.55%), Query Frame = -3
Query:  217 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKP---FFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELK-EFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAF---NYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMK 1377
            ++F+++ ++  L +AI  + +K PT +QK  +P  L GKDI   A TG+GKT AF +P+L+ L+  P+       LV  PTREL IQ+ +    L +   +     +GGL  K+Q   +   P I+IATPGR + H+  T  F    L  ++ L++DEADRML   F+  + +I+ +    R+T LFSAT +++V  L   SL  PV++ V+     +  L+ EF+ + P  +     +                 +AA     + D         +++F QT+  ++ +   L  +GL    ++ ++SQ QR  ++ + K  ++DI+VATDVAARG+DI  V  VI + +P + K Y HR GRTARAGK G S+++V +       EI +K K
Sbjct:  196 LTFQDMNLSRPLLKAITTMGFKQPTPVQKACVPVGLLGKDICACAATGTGKTAAFMLPVLERLLYKPRETQVTRVLVLVPTRELGIQVHSVARQLSQFTTISTCLAVGGLDLKSQEAALRAGPDILIATPGRLIDHLHNTPSFE---LSQIEVLILDEADRMLDEYFEEQMKEIIRLCAYQRQTMLFSATMSEEVKDLASVSLKQPVRIFVNSNTDVAPYLRQEFVRIRPAREGDREAI-----------------VAALLTRTFQD--------HVMLFTQTKKQAHRMHILLGLMGLKVGELHGNLSQTQRLESLRRFKDEQIDILVATDVAARGLDIEGVKTVINFTMPNTVKHYVHRVGRTARAGKVGRSVSLVGETERKMLKEIVKKAK 561          
BLAST of SMED30012754 vs. Ensembl Cavefish
Match: ddx42 (DEAD-box helicase 42 [Source:NCBI gene;Acc:103044432])

HSP 1 Score: 197.208 bits (500), Expect = 9.925e-55
Identity = 132/381 (34.65%), Postives = 203/381 (53.28%), Query Frame = -3
Query:  250 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPIL------QELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNT 1374
            SF     ++ L   I + ++  PT IQ + +P AL G+D+IG+AKTGSGKT AF  P+L      +EL +   P  A++  PTREL  QI TE    GK  G++   + GG     QA  +     I++ TPGR + HV         +L+ + +LV DEADRM    F+  +  I   +   R+T LFSAT   K+ KL R  LIDP++V   +    + ++ + + + P    +   VWL ++L        EF              ++ S+++FV  +   + LA  LQ+ G +   ++ DM Q +R   I   K + + ++VATDVAARG+DIP++  V+ YD+     T+THR GRT RAG++GV+ T++ Q +T
Sbjct:  258 SFAHFNFDEQLMNQIRKSEYTKPTPIQCQGVPIALGGRDMIGIAKTGSGKTAAFIWPMLVHIMDQKELEQGDGPI-AVIVCPTRELCQQIHTECKRFGKVYGLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK----KATSLQRVTYLVFDEADRMFDMGFEYQVRSIASHIRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQLVEVLP--NGTDKWVWLTRRLV-------EF-------------TSSGSVLIFVTKKANCDELATNLQQEGYSLGLLHGDMDQSERNKVISDFKKKSLPVLVATDVAARGLDIPSIRTVVNYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTQKDT 611          
BLAST of SMED30012754 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 344.739 bits (883), Expect = 1.300e-115
Identity = 184/392 (46.94%), Postives = 260/392 (66.33%), Query Frame = -3
Query:  184 GVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQ 1359
            GV + LCEA E++ WK PT+IQ +AIP AL+GKDIIGLA+TGSGKTGAF +PILQ L+  P+  FALV TPTRELA QI  +F  LG  IG+K A ++GG+   +Q+  +  KPH+IIATPGR + H+  TKGFN   ++ LK+LVMDEADR+L+  F+ +++KIL ++P+ R+T+LFSAT T KV KLQRA+L +PVK SV  KY    +L+++ +  P + + ++LV++L +L                        A  S I+F  T   +  +A  L+ LG  A P++  MSQ +R  +++K K +   I++ATDVA+RG+DIP+VDVVI +DIP  +K Y HR GRTARAG+ G SIT V+QY+   +  I+  + K+LP   T+ +
Sbjct:    1 GVTEVLCEACEQLGWKQPTKIQVEAIPVALQGKDIIGLAETGSGKTGAFALPILQALLDAPQRLFALVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQSLALAKKPHVIIATPGRLVDHLENTKGFN---IRALKYLVMDEADRILNMDFETEVDKILKVIPKERKTYLFSATMTKKVQKLQRAALKEPVKCSVSTKYQTVEKLQQYYVFIPAKFKDSYLVYILNEL------------------------AGNSFIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVSQYDVELFQRIEHLIGKKLPAFPTNEE 365          
BLAST of SMED30012754 vs. Ensembl Sea Lamprey
Match: ddx49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:ZFIN;Acc:ZDB-GENE-031030-3])

HSP 1 Score: 242.276 bits (617), Expect = 2.719e-75
Identity = 155/403 (38.46%), Postives = 231/403 (57.32%), Query Frame = -3
Query:  184 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRML---SSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVA----ARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQ 1371
            FK LG++D L +  +++    PT +Q+  IPP L G+D +G A+TGSGKT AF +PILQ+L +DP   F LV  PTRELA QI  +F  +GK +G+K + ++GG+    QA ++  KPH++IATPGR   H+ ++  F   +LK ++FLVMDEADR+L   ++ F +DL  IL  LP  R+T LFSAT TD + +L+  +L +P      E      EL +  +L   + + A+LV +++++                           SIIVF  T     +L   L+     +  ++S M Q +R A++ K K     I++ATDVA    ARG+DIP V VV+ ++ P   KTY HR GRTARAG+ GV+IT+V QY+      I+E +  +L   +T+ +
Sbjct:    7 FKRLGLDDWLMQQCKQMGISKPTPVQENCIPPILRGQDCMGCAQTGSGKTAAFVLPILQKLSEDPFGIFCLVLAPTRELAYQIAEQFRVMGKPLGLKDSVIVGGMDSVRQAQELARKPHVVIATPGRLADHLRSSNTF---SLKKIQFLVMDEADRLLEQGATDFTKDLQVILA-LPAKRQTLLFSATLTDTLQELRNLALTNPFFWESKEPVRTVEELDQRYILVADKVKDAYLVHIIQKI--------------------QDAHDDWSIIVFTNTCKNCQVLNMMLRHFNFPSVALHSMMRQTERFASLSKFKSSMFKILIATDVASSFWARGLDIPTVQVVLNHNTPSLPKTYIHRVGRTARAGRNGVAITIVTQYDIHLVQAIEETINTKLKEFVTEEK 385          
BLAST of SMED30012754 vs. Ensembl Sea Lamprey
Match: DDX54 (DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:20084])

HSP 1 Score: 184.882 bits (468), Expect = 4.201e-54
Identity = 118/354 (33.33%), Postives = 182/354 (51.41%), Query Frame = -3
Query:  319 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDP--KPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTH 1374
             F+ +G++  + + +    +K+PT IQ+K IP  LEG+D++ +A+TGSGKT AF +P+ + L          ALV +PTRELA+Q       LGK  G+K A ++GG   + Q   +   P III TPGR + HV          L+ ++++V DEADR+    F   L +I+  LP +R+T LFSAT   ++ +  RA L DPV + +D     S +LK   +    + +   L+ LL+ +     KP E                    +VFV T+     L   + + G++   I S + Q +R   + K   +K  +++ TDVAARGID P +D VI Y+ P   K + H
Sbjct:   34 GFQSMGLSYPVFKGVMGKGYKVPTPIQRKCIPVILEGRDVVAMARTGSGKTAAFLVPMFERLHARSAQAGARALVLSPTRELALQTSKFTKELGKHTGLKTALILGGDRMEDQFAALHENPDIIIGTPGRLM-HVVVEMNLK---LQAMEYVVFDEADRLFEMGFAEQLTEIIRRLPDSRQTLLFSATLPKQLVEFARAGLSDPVLIRLDVDSKLSDQLKLAFMCSRADDKPCVLLHLLRTVV----KPHE------------------QTVVFVATKHHVEYLRELVSQAGMSCAYIYSALDQTERKINVGKFVHKKTMLLIVTDVAARGID-PMLDNVINYNFPGKPKLFIH 360          
BLAST of SMED30012754 vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 186.808 bits (473), Expect = 2.852e-52
Identity = 122/357 (34.17%), Postives = 181/357 (50.70%), Query Frame = -3
Query:  319 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELM--KDPKPF---FALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTH 1374
            SF   G ++ L   I + ++  PT IQ + IP AL G+DIIG+AKTGSGKT +F  P+L  +M  K+ KP      L+  PTREL  QI  E    GK   +    + GG     QA  +     I++ TPGR + HV   K  N   L+ + +LV DEADRM    F+  +  I   +   R+T L+SAT   +V KL R  LIDP++V   +    + ++ + + +  +   +A   WL   L        EF              ++ S+++FV  +  S  L+  L++ G     ++ DM Q +R   I   K + + IMVATDVAARG+DIP++  V+ YD+     T+TH
Sbjct:  250 SFGHFGFDEQLLNLIRKSEFTQPTPIQCQGIPIALSGRDIIGIAKTGSGKTASFIWPMLVHIMAQKELKPGDGPIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHV-KKKATN---LQRVTYLVFDEADRMFDMGFEYQVRSIANHVRPDRQTMLYSATFRMRVEKLARDILIDPIRVVQGDIGEANEDVTQRVEI--FSNGAAKWNWLCSHLV-------EF-------------TSSGSVLIFVTRKDNSEELSNDLEQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGLDIPSIKTVVNYDVARDIDTHTH 580          
BLAST of SMED30012754 vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 180.259 bits (456), Expect = 5.716e-50
Identity = 134/419 (31.98%), Postives = 214/419 (51.07%), Query Frame = -3
Query:  220 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPK---------PFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILP--------------------------RTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKM 1371
            +KE  +   + E IE+  +K PT IQ++AIP  L+ +DIIG+A+TGSGKT AF IP+L  +   PK           +A++  PTRELA QI+ E    GK +G++   +IGG+  + Q  ++     I+IATPGR +  V   +      L    ++V+DEADRM+   F+ D+ +IL  +P                          + R+T +F+AT    V +L R+ L  P  V +         +++ + +    ++   L+ LL     +  +P                     II+FV  +   ++LA  L+K+G NA  ++    QEQR   +  +K    DI+VATDVA RGIDI +V +V+ YD+ ++ + YTHR GRT RAGK GVS+T + + +   + ++++ M
Sbjct:  322 WKESILPSHIREVIEKCGYKDPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVWITTLPKIDRIEDTDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCKIVIATPGRLI-DVLENRYL---VLSRCTYVVLDEADRMIDMGFEPDVQRILEHMPVSNQKPDTDDAEDPDKMTANFESGRHKYRQTVMFTATMPAAVERLARSYLRRPAVVYIGSVGKPIERVEQRVFIMGESEKRKKLLELL----SRGFEP--------------------PIIIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVLNYDMAKNIEDYTHRIGRTGRAGKSGVSVTFLTKEDAAVFYDLKQAM 712          
BLAST of SMED30012754 vs. Ensembl Yeast
Match: RRP3 (Protein involved in rRNA processing; required for maturation of the 35S primary transcript of pre-rRNA and for cleavage leading to mature 18S rRNA; homologous to eIF-4a, which is a DEAD box RNA-dependent ATPase with helicase activity [Source:SGD;Acc:S000001107])

HSP 1 Score: 313.923 bits (803), Expect = 8.301e-103
Identity = 175/391 (44.76%), Postives = 248/391 (63.43%), Query Frame = -3
Query:  205 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILP-RTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELP 1374
            SF EL +   L +A + + +  PT IQ KAIPPALEG DIIGLA+TGSGKT AF IPIL  L  D +P++A +  PTRELA QI+  F+ LG  +GV+   ++GG+    QA  ++ KPHIIIATPGR + H+  TKGF   +L+ LKFLVMDEADR+L  +F   L++IL I+P + R T+LFSAT T K+ KLQRASL +PVK +V  KY     L + +++ P   ++ +L++LL +                           K++I+F +T+  +  L+     L  +A  ++ D++Q QR  ++   K  K  I+VATDVAARG+DIP+VD+V+ YDIP  +K+Y HR GRTARAG+ G SI++V+QY+    + I+E + K+LP
Sbjct:   82 SFSELNLVPELIQACKNLNYSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILNRLWHDQEPYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTKGF---SLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFIG------------------------KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKLP 445          
BLAST of SMED30012754 vs. Ensembl Yeast
Match: DBP8 (ATPase, putative RNA helicase of the DEAD-box family; component of 90S preribosome complex involved in production of 18S rRNA and assembly of 40S small ribosomal subunit; ATPase activity stimulated by association with Esf2p [Source:SGD;Acc:S000001212])

HSP 1 Score: 234.187 bits (596), Expect = 9.154e-73
Identity = 149/396 (37.63%), Postives = 224/396 (56.57%), Query Frame = -3
Query:  208 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILP--RTRRTFLFSATNTDKVSKLQRASL------IDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKEL 1371
            FK LG++  L E++  +K   PT IQK  IP  LEG+D IG AKTGSGKT AF  P+L +  +DP   F +V TPTRELA+QI  +F  LG  + ++ + ++GG     QA  +  KPH IIATPGR   H+ ++       L   K+LV+DEAD +L+S F   L   +  LP    R+T LF+AT TD+V  LQ A +      +   +V   +  A  S LK   +L P   + A+L  L   LTC+     E++               K+ I+FV   M + +L   L++L +    ++S M Q++RT ++H+ +     I++ATDVA+RG+DIP V++V+ YDIP     + HR+GRTARAG+ G +I+ V Q +  +   I++++ K++
Sbjct:    4 FKSLGLSKWLTESLRAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDPSGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVIVGGESIVQQALDLQRKPHFIIATPGRLAHHIMSSGDDTVGGLMRAKYLVLDEADILLTSTFADHLATCISALPPKDKRQTLLFTATITDQVKSLQNAPVQKGKPPLFAYQVESVDNVAIPSTLKIEYILVPEHVKEAYLYQL---LTCE-----EYE--------------NKTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARILIATDVASRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRIGDAISFVTQRDVSRIQAIEDRINKKM 377          
BLAST of SMED30012754 vs. Ensembl Yeast
Match: DRS1 (Nucleolar DEAD-box protein required for ribosome assembly and function; including synthesis of 60S ribosomal subunits; constituent of 66S pre-ribosomal particles [Source:SGD;Acc:S000003931])

HSP 1 Score: 209.92 bits (533), Expect = 7.158e-61
Identity = 140/382 (36.65%), Postives = 217/382 (56.81%), Query Frame = -3
Query:  259 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFA---LVFTPTRELAIQIQTEFNGLGKGI-----GVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDE-KYAESSELKEFMLLCPYEQ-QSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQ 1374
            +F  L ++  + + +  + +  P+ IQ   IP AL GKDII  A TGSGKT AF IPI++ L+  P    +   +V  PTRELAIQ+      +GK I     G+     +GGL  + Q   + ++P I+IATPGRF+ H+  +  FN   + +++ LVMDEADRML   F  +LN+I+ +LP  R+  LFSAT   K+  L   SL  PV++ +D  K A +   +EF+ +   +  + A L  L+++L      PT                  K I+VFV  +  ++ L   +  LG++   ++  ++QEQR  +++K K  +V +++ TD+A+RG+DIP ++VVI YD+P+S + Y HR GRTARAG+ G S+T V +
Sbjct:  232 NFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIASTRVIVLLPTRELAIQVAD----VGKQIARFVSGITFGLAVGGLNLRQQEQMLKSRPDIVIATPGRFIDHIRNSASFN---VDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALLFNLIRKLD-----PT----------------GQKRIVVFVARKETAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVGE 585          
BLAST of SMED30012754 vs. Ensembl Yeast
Match: HAS1 (ATP-dependent RNA helicase; involved in the biogenesis of 40S and 60S ribosome subunits; localizes to both the nuclear periphery and nucleolus; highly enriched in nuclear pore complex fractions; constituent of 66S pre-ribosomal particles [Source:SGD;Acc:S000004903])

HSP 1 Score: 183.341 bits (464), Expect = 1.017e-52
Identity = 129/365 (35.34%), Postives = 199/365 (54.52%), Query Frame = -3
Query:  319 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIP---ILQELMKDPKPFFAL-VFTPTRELAIQI------QTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRT-RRTFLFSATNTDKVSKLQRASL-IDPVKVSV--DEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTH 1371
            F+EL ++    +AIE++ +   T +Q + IPP L G+D++G AKTGSGKT AF IP   +L  L   P+    + V TPTRELA+QI        EF+    GI      +IGG   + +A +++   +++IATPGR L H+  TKGF     KNLK L++DEADR+L   F+ ++ +I+ ILP   R++ LFSAT T KV  L R SL   P+ ++V  +   + +  L++  ++C  +++     +LL                 F++L  + KK    IIVF+ +       A  L  + L    ++    Q++RT T  +    +  I++ TDVAARG+DIP VD +IQ+D P+  + Y H
Sbjct:   44 FEELKLSQPTLKAIEKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELLHSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGI------VIGGANRRQEAEKLMKGVNMLIATPGRLLDHLQNTKGF---VFKNLKALIIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDKR-----FLL----------------LFSFLKRNQKK---KIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIH 375          
BLAST of SMED30012754 vs. Ensembl Yeast
Match: DBP10 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; constituent of 66S pre-ribosomal particles; essential protein involved in ribosome biogenesis [Source:SGD;Acc:S000002189])

HSP 1 Score: 186.422 bits (472), Expect = 8.650e-52
Identity = 132/415 (31.81%), Postives = 214/415 (51.57%), Query Frame = -3
Query:  229 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFA--LVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLK-----------QLTCKSAKPTEFDIAAFNYLDSDGKK--------------------ATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQ 1374
            SF   G++  +   I+R  ++ PT IQ+K IP  L+ +DI+G+A+TGSGKT AF +P++++L        A  ++ +P+RELA+Q    F    +G  ++   L GG   + Q   ++  P +IIATPGRFL H+      +   LK+++++V DEADR+    F   LN++L  LP TR+T LFSAT  + +    +A L++PV V +D +   S  L+   L      + A+L+++L+           QL        E D  + +  D   K+                    + K+ I+FV TR     ++  L+  G     I   + Q  R   ++  +     I+V TDVAARG+DIP +  VI Y +P S+K + HR GRTARAG +G + ++V +   P  ++++
Sbjct:  138 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFGMMMTNPDVIIATPGRFL-HLKVEMNLD---LKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEIIKIPLATSEQLQKLQNSNNEADSDSDDENDRQKKRRNFKKEKFRKQKMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLE 548          
BLAST of SMED30012754 vs. Ensembl Nematostella
Match: EDO33593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU4])

HSP 1 Score: 355.91 bits (912), Expect = 1.975e-119
Identity = 191/390 (48.97%), Postives = 260/390 (66.67%), Query Frame = -3
Query:  205 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELP 1374
            +FK LGV D LCEA +++ WK P++IQ++AIP AL+GKD+IGLA+TGSGKTGAF +PILQ L+ +P+  FAL+ TPTRELA QI  +   LG GIGVKCA ++GG+   +QA  +  KPHIIIATPGR + H+  TKGF   +L+ LK+LVMDEADR+L+  F+++++K+L ++P+ RRTFLFSAT T KV KLQRASL  PVKV V  KY    +L++  L  P + +  +LV++L +L                        A  S +VF  T      +   L+ LGL+A P++  MSQ +R   ++K K +   I+VATDVA+RG+DIP+VDVVI +DIP  +K Y HR GRTARAG+ G S+T V QY+   Y  I+  + K+LP
Sbjct:   15 TFKSLGVVDALCEACKQLGWKTPSKIQREAIPVALQGKDVIGLAETGSGKTGAFALPILQALLDNPQRLFALILTPTRELAFQISEQCEALGSGIGVKCAVIVGGIDMMSQALMLAKKPHIIIATPGRLIDHLENTKGF---SLRTLKYLVMDEADRILNMDFEKEVDKLLKVIPKERRTFLFSATMTKKVQKLQRASLQAPVKVEVATKYQTVEKLQQSYLFIPSKFKDCYLVYVLNEL------------------------AGNSFMVFCGTCNNVQRVTLMLRNLGLDAVPLHGQMSQSKRLGALNKFKSKSRSILVATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGRSVTFVTQYDVELYQRIEHLIAKKLP 377          
BLAST of SMED30012754 vs. Ensembl Nematostella
Match: EDO43011 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZV2])

HSP 1 Score: 280.796 bits (717), Expect = 3.084e-90
Identity = 170/404 (42.08%), Postives = 232/404 (57.43%), Query Frame = -3
Query:  163 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQAMESELL 1374
            SF  LG+N  L      +  K PTEIQ   +PP L+G+D IG AKTGSGKT AF +PILQ+L  DP   FA+V TPTRELA QI  +F  LG+ IG+K A ++GGL    QA  + NKPH++IATPGR   H+ +T   N   LK ++FLV+DEADR+L   F  DL  I   +P  R+T LFSAT TD + +LQ+ S   P    V    A  +EL +  LL P   +  +LV LL++                           +S+IVF  T     +L     KLGL    ++S +SQ +R A + + K   + I+VATDVA+RG+DIP V++V+  +IP   K Y HR GRTARAG+ G++I+MV QY+  +  +I+EK+  +    LT+    E E+L
Sbjct:    8 SFAGLGLNKWLVSQCVAMGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGKTAAFALPILQKLCDDPYGIFAVVLTPTRELAFQIADQFKVLGRPIGLKEAVIVGGLDMMKQALSLANKPHVVIATPGRLADHIKSTDTLN---LKKIQFLVLDEADRLLDPSFGDDLKVIFDAVPEKRQTLLFSATLTDTMGELQKMSGSQPFSYEVQSDIATVAELDQRYLLTPAHVRDCYLVHLLRE-----------------------NDDNQSVIVFTHTCKNCQVLVSMFHKLGLTCVGLHSLLSQGERLAALARFKSGTIKILVATDVASRGLDIPQVELVVNSNIPADPKDYIHRVGRTARAGRGGMAISMVTQYDIDRVKKIEEKINTK----LTEYTTSEKEVL 381          
BLAST of SMED30012754 vs. Ensembl Nematostella
Match: EDO43557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY08])

HSP 1 Score: 199.519 bits (506), Expect = 3.311e-58
Identity = 122/359 (33.98%), Postives = 187/359 (52.09%), Query Frame = -3
Query:  319 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPK------PFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTH 1377
            +SF   G ++ +  +I ++++  PT+IQ +A+P AL G+DIIG+AKTGSGKT AF  P L  +M  P+      P   L+  PTREL  QI TE    GK   +    + GG  +  Q+  +     I++ATPGR + HV   K  N   L  + +LV DEADRM    F+  +  I   +   R+T LFSAT   KV  L R  L+DPV+V + E    + ++ + + +  +    +   WL + L   ++                      S+++FV  ++ S  LA  L+K       ++ DM Q +R+  + + K R++ I+VATDVAARG+DIP++  VI YD+     T+TH
Sbjct:  106 ISFAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPI-VLICAPTRELCQQIYTEARRFGKAYNIHVVAVFGGGNKYEQSKALQEGAEIVVATPGRLIDHV-KAKATN---LHRVTYLVFDEADRMFDMGFEPQVRSIANNVRPDRQTLLFSATFKKKVEHLCRDILVDPVRVVIGELGEANEDVTQIVHI--FNSMPSKWEWLTQNLVSFAS--------------------AGSVLIFVTKKLNSEELATNLRKNDFEVALLHGDMDQFERSKVLGQFKKREIPILVATDVAARGLDIPSIKTVINYDVARDITTHTH 437          
BLAST of SMED30012754 vs. Ensembl Nematostella
Match: EDO45469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RST4])

HSP 1 Score: 200.29 bits (508), Expect = 3.801e-57
Identity = 135/401 (33.67%), Postives = 211/401 (52.62%), Query Frame = -3
Query:  184 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKP--FFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDP--VKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQ 1374
             F+ LG++  + + + +  +K+PT IQ+K +P  ++GKD++ +A+TGSGKT AF IP+ ++L          AL+ +PTRELA+Q Q     LG+  G+K + ++GG   + Q   I   P I++ATPGRFL HV       E  L +++++V DEADR+    F   L++I++ LP +R+T LFSAT    +    +A L DP  V++ VD K +E  ++ +++        S  L   L  L     KPTE                    ++F  T+     L   L   G++   + S + Q  RT  + K + +K  +MV TDVAARGIDIP +D VI +  P  AK + HR GR ARAG+ G + ++V        +++   + + L L  T  Q
Sbjct:   20 GFQSLGLSFPVFKGVMKKGYKVPTPIQRKTLPLVMDGKDVVAMARTGSGKTAAFLIPMFEKLQTHTAKVGIRALILSPTRELALQTQKFIKELGRFTGLKSSVILGGDSLEGQFAAIHTNPDIVVATPGRFL-HVVMEM---ELKLSSVEYVVFDEADRLFEMGFAEQLHEIIHRLPESRQTLLFSATLPRLLVDFAKAGLCDPALVRLDVDTKLSEQLKVSDYVF-------SLELYTALMHLLQNVIKPTE------------------QTLIFAATKHHVEYLKEMLLSGGIDCSYVYSSLDQTARTINVGKFQHKKTMVMVVTDVAARGIDIPMLDNVINFHFPPKAKLFVHRVGRVARAGRSGTAYSLVANDEVAHLLDLHLFLGRPLRLSATGSQ 391          
BLAST of SMED30012754 vs. Ensembl Nematostella
Match: EDO43602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYA5])

HSP 1 Score: 194.512 bits (493), Expect = 1.095e-54
Identity = 138/416 (33.17%), Postives = 221/416 (53.12%), Query Frame = -3
Query:  226 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPK----------PFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILP------------------------RTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQE 1371
            +KE  + D++ E ++++ +K PT IQ++AIP  L+ +DIIG+A+TGSGKT AF IP+L  +M  PK          P+ AL+  PTRELA QI+ E    G+ +G++  ++IGGL  + Q  Q+     I+IATPGR +  V   +      L    ++VMDEADRM+   F+ ++ KIL  LP                        + R+T +F+AT   +V +L +  L  P  V +         +++ + L   +Q+   L+ LL     K  +P                     II+FV  +  +++LA  L+K+G  A  ++   +QEQR   +  +K    DI+VATDVA RGIDI +V  VI YD+ ++ + YTHR GRT RAGK G++++ + Q ++  + ++++
Sbjct:  352 WKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPY-ALILAPTRELAQQIEEEILKFGRPLGIRTVSVIGGLSREDQGFQLRLGVEIVIATPGRLI-DVLENRYL---VLNRCSYIVMDEADRMIDMGFEPEVQKILEHLPVSNVKPDSEDSEDPEHLLTHMGKDKYRQTVMFTATMPPQVERLAKNYLRRPAVVYIGSVGKPVERVEQRVYLVNEQQKRKKLLELL----NKDLEP--------------------PIIIFVNQKKGADVLAKSLEKMGFRATTLHGGRNQEQREFALSSLKGGSKDILVATDVAGRGIDIKDVSHVINYDMAKTIEDYTHRIGRTGRAGKTGIAVSFLTQSDSGVFYDLKQ 738          
BLAST of SMED30012754 vs. Ensembl Medaka
Match: ddx47 (DEAD-box helicase 47 [Source:NCBI gene;Acc:101159675])

HSP 1 Score: 353.984 bits (907), Expect = 1.373e-117
Identity = 188/397 (47.36%), Postives = 260/397 (65.49%), Query Frame = -3
Query:  184 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQ 1374
            +FK+LGV D LCEA +++ WK PT+IQ +AIP AL+GKD+IGLA+TGSGKTGAF +PILQ L+  P+    LV TPTRELA QI  +F  LG  IGVKCA ++GG+   +Q+  +  KPHI+IATPGR + H+  TKGF   +L+ LKFLVMDEADR+L+  F+ +++KIL ++PR RRTFLFSAT T KV KLQRA+L DPVK +V  KY+   +L+++ +  P + +  +LV +L +L                        A  S ++F  T   +  +A  L+ LG+ A P++  MSQ +R   ++K K +   +++ATDVA+RG+DIP+VD VI YDIP  +K Y HR GRTARAG+ G SIT V QY+   +  I+  + K+LP   T  +
Sbjct:   40 TFKDLGVTDVLCEACDQLGWKSPTKIQVEAIPVALQGKDVIGLAETGSGKTGAFALPILQSLLASPQRLHTLVLTPTRELAFQISEQFEALGSSIGVKCAVIVGGIDMMSQSLVLAKKPHIVIATPGRLIDHMENTKGF---SLRALKFLVMDEADRILNMDFETEVDKILKVIPRERRTFLFSATMTKKVQKLQRAALKDPVKCAVSTKYSTVDKLQQYYVFIPAKYKDCYLVSILNEL------------------------AGNSFMIFCSTCNNAQRVALMLRNLGITAIPLHGQMSQNKRLGALNKFKSKSRSVLLATDVASRGLDIPHVDCVINYDIPTHSKDYIHRVGRTARAGRSGKSITFVTQYDVELFQRIESLIGKKLPAFPTQEE 409          
BLAST of SMED30012754 vs. Ensembl Medaka
Match: ddx49 (DEAD-box helicase 49 [Source:NCBI gene;Acc:101169189])

HSP 1 Score: 253.447 bits (646), Expect = 8.755e-79
Identity = 155/391 (39.64%), Postives = 226/391 (57.80%), Query Frame = -3
Query:  208 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLS---SQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKEL 1371
            F  LG++D L +  +++    PT +Q+  +P  LEG+D +G AKTGSGKT AF +P+LQ+L +DP   F LV TPTRELA QI  +F  LGK +G+K   ++GG+   TQA ++  +PH+++ATPGR   HV ++  F   +++ +KFL++DEADR+L    + F +DL +IL  LP  R+T LFSAT TD + +L+  ++  P       +     EL +  +L P + + A+LV L++  T                     K    SII+F  T     +L   L++       ++S M Q QR A + K K     I++ATDVAARG+DIP V VVI ++ P   K Y HR GRTARAG+ GVSIT+V QY+      I+E+ K +L
Sbjct:    4 FHSLGLSDWLVKQCKQLGIDKPTPVQENCVPAILEGRDCLGCAKTGSGKTAAFVLPVLQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIVVGGMDMVTQALELSKQPHVVVATPGRLADHVRSSNTF---SMRKIKFLILDEADRLLEQGCTDFTKDLEEILGTLPAKRQTLLFSATLTDTLQELKSIAMNKPFFWESTSETRTVEELDQRYILTPEKVKDAYLVHLIQTFT--------------------DKHDDWSIIIFTNTCKNCQILTMMLREFNFPTISLHSMMKQRQRFANLAKFKASVYKILIATDVAARGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRNGVSITLVTQYDIHLVHSIEEQTKTKL 371          
BLAST of SMED30012754 vs. Ensembl Medaka
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:101158015])

HSP 1 Score: 199.519 bits (506), Expect = 2.696e-56
Identity = 129/380 (33.95%), Postives = 207/380 (54.47%), Query Frame = -3
Query:  259 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPF---FALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELK-EFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAF---NYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQ 1377
            +SF ++ ++  + +AI  + +K PT IQK  +P +L G+D+   A TG+GKT AF +P+L+ L+  P+       LV  PTREL IQ+ +    L +   +     +GGL  K+Q   +   P ++IATPGR + H+  T  F    L +++ L++DEADRML   F+  + +I+ +    R+T LFSAT T++V  L   SL  PV++ V+     +  L+ EF+ + P+ +     V                 +AA     + D         +++F QTR  ++ L   L  +GL    ++ ++SQ QR   + + K  ++DI+VATDVAARG+DI  V  VI + +P + K Y HR GRTARAG+ G S+++V +
Sbjct:  173 LSFDDMNLSRPILKAITALGFKQPTPIQKACVPVSLLGRDLCACAATGTGKTAAFMLPVLERLIYKPRTSQVTRVLVLVPTRELGIQVHSVARQLAQFTSITTCLAVGGLDLKSQEAALRAGPDVLIATPGRLIDHLHNTPNFE---LSHIEILILDEADRMLDEYFEEQMKEIIRLCSYNRQTMLFSATMTEEVKDLAAVSLKQPVRIFVNSNTDVAPFLRQEFIRIRPHREGDREAV-----------------VAALLTRTFQD--------HVMLFTQTRKQAHRLHILLGLMGLKVGELHGELSQNQRLENLRRFKDDQIDILVATDVAARGLDIDGVKTVINFTMPSTVKHYVHRVGRTARAGRSGRSVSLVGE 524          
BLAST of SMED30012754 vs. Ensembl Medaka
Match: ddx27 (DEAD-box helicase 27 [Source:NCBI gene;Acc:101158015])

HSP 1 Score: 198.749 bits (504), Expect = 7.415e-56
Identity = 129/380 (33.95%), Postives = 207/380 (54.47%), Query Frame = -3
Query:  259 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPF---FALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELK-EFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAF---NYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQ 1377
            +SF ++ ++  + +AI  + +K PT IQK  +P +L G+D+   A TG+GKT AF +P+L+ L+  P+       LV  PTREL IQ+ +    L +   +     +GGL  K+Q   +   P ++IATPGR + H+  T  F    L +++ L++DEADRML   F+  + +I+ +    R+T LFSAT T++V  L   SL  PV++ V+     +  L+ EF+ + P+ +     V                 +AA     + D         +++F QTR  ++ L   L  +GL    ++ ++SQ QR   + + K  ++DI+VATDVAARG+DI  V  VI + +P + K Y HR GRTARAG+ G S+++V +
Sbjct:  195 LSFDDMNLSRPILKAITALGFKQPTPIQKACVPVSLLGRDLCACAATGTGKTAAFMLPVLERLIYKPRTSQVTRVLVLVPTRELGIQVHSVARQLAQFTSITTCLAVGGLDLKSQEAALRAGPDVLIATPGRLIDHLHNTPNFE---LSHIEILILDEADRMLDEYFEEQMKEIIRLCSYNRQTMLFSATMTEEVKDLAAVSLKQPVRIFVNSNTDVAPFLRQEFIRIRPHREGDREAV-----------------VAALLTRTFQD--------HVMLFTQTRKQAHRLHILLGLMGLKVGELHGELSQNQRLENLRRFKDDQIDILVATDVAARGLDIDGVKTVINFTMPSTVKHYVHRVGRTARAGRSGRSVSLVGE 546          
BLAST of SMED30012754 vs. Ensembl Medaka
Match: ddx54 (DEAD-box helicase 54 [Source:NCBI gene;Acc:101162145])

HSP 1 Score: 194.897 bits (494), Expect = 4.002e-54
Identity = 128/357 (35.85%), Postives = 190/357 (53.22%), Query Frame = -3
Query:  319 SFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFF---ALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPV--KVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTH 1374
             F+ +G++  + + + +  +K+PT IQ+K IP  L+GKD++ +A+TGSGKT AF +P+ ++L K P+      AL+ +PTRELA+Q       LGK  G+K A ++GG   + Q   +   P III TPGR + HV          L +++++V DEADR+    F   L +I+  LP TR+T LFSAT    + +  RA L +PV  ++ VD K ++  +L  F L    + + A L+ LLK +    AKP E                    +VFV T+     L   L   G+    I S + Q  R   I K   RK  +++ TDVAARGIDIP +D+VI Y+ P   K + H
Sbjct:   78 GFQSMGLSYPVYKGVMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTAAFLVPMFEKL-KAPQASAGARALIMSPTRELALQTMKFTKELGKFAGLKTALILGGDRMEDQFAALHENPDIIIGTPGRLM-HVVKEMNLK---LHSVEYVVFDEADRLFEMGFAEQLQEIIQRLPDTRQTLLFSATLPKLLVEFARAGLTEPVLIRLDVDSKLSDQIKLSFFHLRV--DDKPAMLLHLLKNV----AKPQE------------------QTVVFVATKHHVEYLRELLSSEGIECAYIYSALDQTARKINIGKFVHRKAMVLIVTDVAARGIDIPMLDIVINYNFPSKPKLFLH 405          
BLAST of SMED30012754 vs. Planmine SMEST
Match: SMESG000051946.1 (SMESG000051946.1)

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 441/441 (100.00%), Postives = 441/441 (100.00%), Query Frame = -3
Query:   55 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQAMESELLADFADIKQCYXXXXXXXXXXXXXXXXXXAFNLTDQV 1377
            MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHRAGRTARAGKRGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQAMESELLADFADIKQCYQEAEIAIKAAQAGRAKRKAFNLTDQV
Sbjct:    1 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHRAGRTARAGKRGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQAMESELLADFADIKQCYQEAEIAIKAAQAGRAKRKAFNLTDQV 441          
BLAST of SMED30012754 vs. Planmine SMEST
Match: SMESG000030761.1 (SMESG000030761.1)

HSP 1 Score: 260.766 bits (665), Expect = 7.849e-82
Identity = 159/405 (39.26%), Postives = 241/405 (59.51%), Query Frame = -3
Query:  220 MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKP-FFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQILN-KPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRT-----------------RRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKM 1377
            M+FKELG+ D LC+  +   W  PT+IQK AIP AL G DIIGLA+TG GKTGAF +PIL + +   KP  FAL+ TPTRELA QI+ +F  +G   G+K   +IGG     Q T++ N   HI++ATPGR +  +  +K   +  L+ ++ LV+DEADRML  +F+ D+  I  +LP+                  R+T LFSAT +  + K+    L  P KV VD K     +LK+F+L+  Y ++  +L  LL+    K  +P   + A       + ++A  S IVFV T   +  L  +L K+G +A  ++S +SQ QR   I + K  + +I++ATD+A+RG+D+ +V +V+ YD+P++   Y HR GRTARAG+ G ++T VN+ N  Q++ +++++
Sbjct:    1 MNFKELGIRDDLCKVCQGCGWNEPTDIQKSAIPVALTGVDIIGLAETGGGKTGAFLLPILNDWLNREKPVMFALILTPTRELAAQIEEQFIAMGSEFGLKSTLIIGGEEMSQQMTELGNWDSHIVVATPGRVVSLMEKSKQARD-MLETIEKLVIDEADRMLHLEFESDMEAISKVLPKKSSITSKKKLAKGQIKCIRQTQLFSATFSSHIEKVAGYLLWKPTKVFVDNKMQIPKQLKQFVLVMQYVERVPNLFALLRFHLAKKIRPGG-NQAVTETTKHESQRALSSAIVFVTTCKQTKPLEIYLNKMGASAVALHSQLSQNQRELAIDRFKTGEANILIATDIASRGLDVDHVRLVVNYDLPQTPDWYKHRVGRTARAGRSGTAVTFVNEINRDQFIGMEKRL 403          
BLAST of SMED30012754 vs. Planmine SMEST
Match: SMESG000018018.1 (SMESG000018018.1)

HSP 1 Score: 209.149 bits (531), Expect = 5.557e-62
Identity = 151/405 (37.28%), Postives = 220/405 (54.32%), Query Frame = -3
Query:  175 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGV-KCATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASLIDPVKVSVDEKYAESSELKEFMLLCPYEQQS-AHLVWLLKQLTCKSAKPTEFDIAAFNYLDSDGKKATKSII-VFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQYNTPQYMEIQEKMKKEL---PLLLTDRQAME 1371
            FK++GV + + + +E  K   PTE+Q+  IP  L+GKD+I  AKTGSGKT AF IPI+Q L+ D KP++ ++ TPTRELA QI  +  GL     + K   + GG     Q   + +  HI+IATPGR    +   +   E +LK  K+LV+DEADR+L   F  DL  I   L   R+T LF+AT T  V        +D VK+  D   A + E+           +S A  V  LKQ    S K    +   F  +D   ++   S+I +F        +L   L+        ++S M++++R  ++ K K   V IMVATD+A+RG+DIP VD+VI +++P + K+Y HR GRTAR+G+ G SITM N +      +IQ+ +  E+   P+  TD Q +E
Sbjct:    2 FKKIGVTEDVIKLLENKKIIKPTEVQEHCIPLVLQGKDVIACAKTGSGKTAAFLIPIIQNLIVDIKPYYCVILTPTRELAHQIGEQAKGLLVSQNLAKTIVITGGKDLIKQGADLTSSYHILIATPGRLAHLIRDNEEREEWSLKRCKYLVLDEADRLLEDNFGEDLKVIFDSLSTKRKTLLFTATLTGPV--------LDVVKIITDTAIANNREVPVIWRASGMTDESKATTVDTLKQYYILS-KMQNNEAIMFYIVDKFLQQNPSSLIMIFTNKCKWCQMLHMMLKAFKFKTVMLHSVMTEKEREESLMKFKSSTVRIMVATDLASRGLDIPRVDLVINHNVPINPKSYVHRVGRTARSGRAGTSITMANLFEKESLKKIQQYIGCEMEKYPIETTDLQKIE 397          
BLAST of SMED30012754 vs. Planmine SMEST
Match: SMESG000067540.1 (SMESG000067540.1)

HSP 1 Score: 187.193 bits (474), Expect = 1.284e-54
Identity = 100/191 (52.36%), Postives = 131/191 (68.59%), Query Frame = -3
Query:  805 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQIL--NKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDK 1371
            F++LGV+  L E IE+I W  PTEIQ+K IP  L+  D++ LA+TGSGKTGAF IPI+Q+L   PK  FAL+ TPT ELA+QI+ EF  LG+  G+K  T++GG   + Q T++L  NK H+++ TPGR L H+   K  N    K L+FLV+DEADRMLS  F  DL  I+  LP+ R+T LFSAT T+K
Sbjct:    7 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFIEDQ-TKLLKSNKCHVVVGTPGRVLLHI-NKKLLN---FKTLRFLVLDEADRMLSDDFVNDLTAIIEALPKMRQTCLFSATMTNK 192          

HSP 2 Score: 76.2554 bits (186), Expect = 7.553e-15
Identity = 45/108 (41.67%), Postives = 73/108 (67.59%), Query Frame = -3
Query:  256 TKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQY 579
            + ++IVF +T+  + +L   L +L ++   + SDM++ +R   +      KV ++VATDVA+RG+DIPNV +VI + +PES+K Y HR GRTARAG+ G++I++   Y
Sbjct:  197 SSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 304          
BLAST of SMED30012754 vs. Planmine SMEST
Match: SMESG000060310.1 (SMESG000060310.1)

HSP 1 Score: 187.193 bits (474), Expect = 1.284e-54
Identity = 100/191 (52.36%), Postives = 131/191 (68.59%), Query Frame = -3
Query:  805 FKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSGKTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKCATLIGGLCEKTQATQIL--NKPHIIIATPGRFLKHVATTKGFNEQTLKNLKFLVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDK 1371
            F++LGV+  L E IE+I W  PTEIQ+K IP  L+  D++ LA+TGSGKTGAF IPI+Q+L   PK  FAL+ TPT ELA+QI+ EF  LG+  G+K  T++GG   + Q T++L  NK H+++ TPGR L H+   K  N    K L+FLV+DEADRMLS  F  DL  I+  LP+ R+T LFSAT T+K
Sbjct:    7 FEKLGVDGNLSEKIEKIGWNEPTEIQRKVIPLMLKENDVVALAETGSGKTGAFAIPIIQKLFDKPKHNFALILTPTHELAVQIKNEFMKLGEEDGLKVVTIVGGEFIEDQ-TKLLKSNKCHVVVGTPGRVLLHI-NKKLLN---FKTLRFLVLDEADRMLSDDFVNDLTAIIEALPKMRQTCLFSATMTNK 192          

HSP 2 Score: 76.2554 bits (186), Expect = 7.553e-15
Identity = 45/108 (41.67%), Postives = 73/108 (67.59%), Query Frame = -3
Query:  256 TKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSDMSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKTYTHXXXXXXXXXXXGVSITMVNQY 579
            + ++IVF +T+  + +L   L +L ++   + SDM++ +R   +      KV ++VATDVA+RG+DIPNV +VI + +PES+K Y HR GRTARAG+ G++I++   Y
Sbjct:  197 SSNVIVFTETKKDTKILYRLLGELDISVAMLQSDMTRVERQNALDSFSSGKVAVLVATDVASRGLDIPNVGLVINFQVPESSKDYLHRVGRTARAGRSGLAISLATIY 304          
The following BLAST results are available for this feature:
BLAST of SMED30012754 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX471.034e-11445.95DEAD-box helicase 47 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX476.986e-8353.78DEAD-box helicase 47 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX491.810e-7740.56DEAD-box helicase 49 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX277.090e-5734.46DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX271.184e-5634.46DEAD-box helicase 27 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of SMED30012754 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T26G10.11.034e-12048.59Putative ATP-dependent RNA helicase T26G10.1 [Sou... [more]
H20J04.43.238e-7736.15pep chromosome:WBcel235:II:4329023:4332507:1 gene:... [more]
H20J04.44.743e-7636.15pep chromosome:WBcel235:II:4329023:4334091:1 gene:... [more]
H20J04.44.743e-7636.15pep chromosome:WBcel235:II:4329023:4334484:1 gene:... [more]
ddx-274.041e-5635.45DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of SMED30012754 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG92531.194e-12048.72gene:FBgn0032919 transcript:FBtr0081468[more]
Dbp45A3.340e-6334.84gene:FBgn0010220 transcript:FBtr0088564[more]
CG323442.123e-5333.94gene:FBgn0052344 transcript:FBtr0072576[more]
Rs14.646e-5335.28gene:FBgn0021995 transcript:FBtr0345935[more]
Rs14.646e-5335.28gene:FBgn0021995 transcript:FBtr0088788[more]
back to top
BLAST of SMED30012754 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx492.450e-7639.55DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
ddx277.006e-5633.76DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:... [more]
ddx421.483e-5234.74DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
ddx544.970e-5235.57DEAD (Asp-Glu-Ala-Asp) box polypeptide 54 [Source:... [more]
ddx181.728e-5034.28DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:... [more]
back to top
BLAST of SMED30012754 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mki673.405e-11847.10marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
mki671.294e-11547.07marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
mki672.913e-11546.94marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
mki675.254e-11546.94marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
mki677.816e-11546.94marker of proliferation Ki-67 [Source:Xenbase;Acc:... [more]
back to top
BLAST of SMED30012754 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx475.737e-11746.75DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:... [more]
Ddx471.563e-10444.50DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:... [more]
Ddx471.563e-8554.20DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 [Source:... [more]
Ddx497.997e-7839.80DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
Ddx188.900e-5536.83DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 [Source:... [more]
back to top
BLAST of SMED30012754 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34580|DDX47_CAEEL1.315e-11948.59Putative ATP-dependent RNA helicase T26G10.1 OS=Ca... [more]
sp|Q6CH58|RRP3_YARLI5.100e-11945.48ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipol... [more]
sp|Q5B5E7|RRP3_EMENI5.940e-11848.46ATP-dependent rRNA helicase rrp3 OS=Emericella nid... [more]
sp|Q29S22|DDX47_BOVIN3.632e-11646.95Probable ATP-dependent RNA helicase DDX47 OS=Bos t... [more]
sp|Q9CWX9|DDX47_MOUSE4.013e-11646.75Probable ATP-dependent RNA helicase DDX47 OS=Mus m... [more]
back to top
BLAST of SMED30012754 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S8BZF61.255e-12249.87Uncharacterized protein (Fragment) OS=Genlisea aur... [more]
L8AZT42.305e-12249.75Vasa-like gene-2 (Fragment) OS=Pinctada fucata OX=... [more]
A0A0M4EQU01.042e-12149.51CG9253 OS=Drosophila busckii OX=30019 GN=Dbus_chr2... [more]
A0A433TKW72.438e-12150.51Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
B4N7D03.013e-12150.26Uncharacterized protein OS=Drosophila willistoni O... [more]
back to top
BLAST of SMED30012754 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx476.461e-11747.61DEAD-box helicase 47 [Source:NCBI gene;Acc:1030345... [more]
ddx494.169e-7738.52DEAD-box helicase 49 [Source:NCBI gene;Acc:1030432... [more]
ddx271.158e-5533.50DEAD-box helicase 27 [Source:NCBI gene;Acc:1030322... [more]
ddx271.645e-5533.50DEAD-box helicase 27 [Source:NCBI gene;Acc:1030322... [more]
ddx429.925e-5534.65DEAD-box helicase 42 [Source:NCBI gene;Acc:1030444... [more]
back to top
BLAST of SMED30012754 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000216.11.300e-11546.94pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
ddx492.719e-7538.46DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [Source:... [more]
DDX544.201e-5433.33DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:... [more]
ddx422.852e-5234.17DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
ddx235.716e-5031.98DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
back to top
BLAST of SMED30012754 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RRP38.301e-10344.76Protein involved in rRNA processing; required for ... [more]
DBP89.154e-7337.63ATPase, putative RNA helicase of the DEAD-box fami... [more]
DRS17.158e-6136.65Nucleolar DEAD-box protein required for ribosome a... [more]
HAS11.017e-5235.34ATP-dependent RNA helicase; involved in the biogen... [more]
DBP108.650e-5231.81Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
back to top
BLAST of SMED30012754 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO335931.975e-11948.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430113.084e-9042.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435573.311e-5833.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454693.801e-5733.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436021.095e-5433.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30012754 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx471.373e-11747.36DEAD-box helicase 47 [Source:NCBI gene;Acc:1011596... [more]
ddx498.755e-7939.64DEAD-box helicase 49 [Source:NCBI gene;Acc:1011691... [more]
ddx272.696e-5633.95DEAD-box helicase 27 [Source:NCBI gene;Acc:1011580... [more]
ddx277.415e-5633.95DEAD-box helicase 27 [Source:NCBI gene;Acc:1011580... [more]
ddx544.002e-5435.85DEAD-box helicase 54 [Source:NCBI gene;Acc:1011621... [more]
back to top
BLAST of SMED30012754 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051946.10.000e+0100.00SMESG000051946.1[more]
SMESG000030761.17.849e-8239.26SMESG000030761.1[more]
SMESG000018018.15.557e-6237.28SMESG000018018.1[more]
SMESG000067540.11.284e-5452.36SMESG000067540.1[more]
SMESG000060310.11.284e-5452.36SMESG000060310.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012754 ID=SMED30012754|Name=SMED30012754|organism=Schmidtea mediterranea sexual|type=transcript|length=1379bp
TAAAGAAAAACAAATGATTTATTATTTCAATTTTCGCTTTTTGTTCATTT
TCTTCACCTGATCTGTCAAATTGAACGCCTTGCGCTTCGCCCTTCCTGCC
TGTGCGGCCTTGATTGCAATTTCCGCCTCCTGATAGCACTGCTTGATATC
GGCGAAATCTGCGAGCAATTCCGATTCCATCGCTTGCCGATCCGTCAACA
GCAGAGGCAATTCCTTTTTCATTTTCTCCTGGATCTCCATGTACTGTGGC
GTGTTGTACTGATTCACCATGGTGATGCTGACCCCCCTTTTGCCGGCACG
CGCAGTCCTGCCCGCCCTGTGAGTGTAGGTCTTTGCCGATTCGGGAATAT
CGTACTGGATGACGACATCGACATTCGGAATGTCGATTCCACGAGCCGCC
ACGTCCGTGGCAACCATAATATCGACTTTCCTCATTTTCATTTTGTGGAT
CGTCGCGGTCCGCTGCTCCTGGCTCATGTCGGAATTGATTGGCTGGGCGT
TCAGGCCCAATTTCTGTAAGAAATACGCCAGCAAATTGCTCATCATTCTC
GTCTGAACGAACACAATTATCGATTTCGTCGCTTTCTTTCCGTCGCTGTC
GAGATAATTGAAAGCGGCAATATCGAATTCCGTCGGTTTGGCGGATTTGC
AGGTCAATTGCTTTAATAGCCACACCAAATGAGCACTCTGTTGTTCATAG
GGACACAGCAACATGAATTCCTTCAGCTCCGAGGATTCGGCGTATTTCTC
GTCGACTGAAACTTTTACCGGATCGATTAATGATGCCCGCTGGAGCTTGG
AGACTTTGTCGGTATTGGTAGCGGAAAACAGAAACGTTCTGCGAGTTCTC
GGGAGGATATAGAGAATTTTGTTGAGATCACGATCGAATTGAGAACTCAA
CATTCGATCGGCTTCGTCCATCACGAGGAATTTGAGATTTTTCAATGTCT
GTTCGTTGAATCCTTTTGTCGTCGCAACGTGTTTCAAAAACCGACCTGGG
GTAGCGATGATTATGTGTGGTTTGTTAAGGATTTGTGTGGCTTGAGTTTT
TTCACATAAACCACCAATAAGTGTTGCACATTTTACGCCAATTCCTTTTC
CTAATCCGTTAAATTCTGTTTGTATTTGAATGGCTAATTCTCTGGTAGGA
GTAAAAACTAATGCAAAAAAAGGTTTCGGATCTTTCATTAATTCTTGTAA
TATTGGGATTGTGAATGCTCCAGTTTTACCTGAACCAGTTTTAGCTAATC
CAATTATATCTTTACCCTCCAAAGCTGGTGGGATAGCTTTTTTCTGTATT
TCAGTAGGTATTTTCCATTTAATACGTTCAATCGCTTCACATAGAGTATC
ATTAACACCCAATTCTTTAAAGCTCATAG
back to top

protein sequence of SMED30012754-orf-1

>SMED30012754-orf-1 ID=SMED30012754-orf-1|Name=SMED30012754-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=452bp
MSFKELGVNDTLCEAIERIKWKIPTEIQKKAIPPALEGKDIIGLAKTGSG
KTGAFTIPILQELMKDPKPFFALVFTPTRELAIQIQTEFNGLGKGIGVKC
ATLIGGLCEKTQATQILNKPHIIIATPGRFLKHVATTKGFNEQTLKNLKF
LVMDEADRMLSSQFDRDLNKILYILPRTRRTFLFSATNTDKVSKLQRASL
IDPVKVSVDEKYAESSELKEFMLLCPYEQQSAHLVWLLKQLTCKSAKPTE
FDIAAFNYLDSDGKKATKSIIVFVQTRMMSNLLAYFLQKLGLNAQPINSD
MSQEQRTATIHKMKMRKVDIMVATDVAARGIDIPNVDVVIQYDIPESAKT
YTHRAGRTARAGKRGVSITMVNQYNTPQYMEIQEKMKKELPLLLTDRQAM
ESELLADFADIKQCYQEAEIAIKAAQAGRAKRKAFNLTDQVKKMNKKRKL
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR011545DEAD/DEAH_box_helicase_dom
IPR027417P-loop_NTPase
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 20..221
e-value: 1.0E-53
score: 194.4
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 32..206
score: 29.258
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 281..362
e-value: 7.7E-31
score: 118.5
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 263..362
e-value: 9.5E-29
score: 100.0
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 258..401
score: 21.235
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 240..451
e-value: 1.2E-47
score: 164.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..210
e-value: 1.3E-76
score: 258.5
NoneNo IPR availablePANTHERPTHR24031:SF676ATP-DEPENDENT RNA HELICASE DDX49-RELATEDcoord: 5..426
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 5..426
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 258..371
e-value: 1.08279E-49
score: 163.447
NoneNo IPR availableCDDcd17954DEADc_DDX47coord: 2..207
e-value: 3.6672E-115
score: 334.285
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 25..195
e-value: 4.8E-44
score: 150.2
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 152..160
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 1..29
score: 10.369
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 69..382