SMED30012750

Overview
NameSMED30012750
Smed IDSMED30012750
Length (bp)3707
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012750

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30012750SMESG000059073.1 PL030014A20D06_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012750 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000089:29857..33563 -18535
Homology
BLAST of SMED30012750 vs. Planmine SMEST
Match: SMESG000059073.1 (SMESG000059073.1)

HSP 1 Score: 2232.99 bits (5785), Expect = 0.000e+0
Identity = 1124/1159 (96.98%), Postives = 1126/1159 (97.15%), Query Frame = -2
Query:  224 MEKPLSRKLVIPKTEHLDQKYWYVNPGIMTKANYEKAFIIINSMDLTRFDLSYVLFLGIKYLVCYLELFSLDQTPLLTESIKNHLKFLLLVTSKQKHSKYLLHHRYICHASNVVEQFIKIPHQDYLERQMYLDHIEIICKMLICKSQLWIKNNDLLSAYMYRYGYSPSKTSVVYCSYIIPNERQYLNPLQHVSQKLLDKIEMKCFCKIKLSFNDLPCHYSDDFVLLEILFDPYRGNFLGFLDMLEYIVKSLSPTAFFPHCLRIIVLEDSCIYNFLTNIPHKKLVRMGKSISLTGRLEPFLEEFSASKRLYSLLEVMIKDEDFDDTVSSVSXXXXXXXXXXXDSFXXXXXXXXXXXXXXXDVKKHNRILKLFSKLYHERIDRIRTKPRYQVSTRDTDIIFNLGNNNSSAIKTDEIVVEELNNSAKRAAPEGHCIEIAMSESESLSDDEFHSDTNFITINVDENCFTQKAYQKNSSNIVEDEVNDGKFRIINDKNNDESSIEVEIDHSFESKFDEIVTKPVCYYSSEAMFNHKLRVMMRCDTAEMSDDIFNPDSPEFMENLQLIHKRNLLEKKYNLEMGIKNVGKIGISLENIVRSDESQLGKMLFNGKEFESLSDTKHSEEKRMTYSKSYSDNRNLGNFDPIQRQGMLNLKTLEDNNADKLLPNKQHAEGRKMTYSKSYSDDRNPIQRQGTLNMNTLERNRTENFGSNKNTLGPYQIISKSSNDHYDKYWLSENAERLLAQRETEDPKTSSLTKENNAGVDSSNWQGLFPQIPQKVYPAMSYQALVDSSSSIKNYVKRFGQDTIRKFVQGKLFNENWMKLLYDQIEFDDIDDNGEFSDCSPKKLLEVFDKFTETELKGNATKNMLKSKGIYSLLKILTKGGLNFSHFKILAEGVGVDIPLLNKINTSPGYLPVWSGYLTDKLGYQPEQSLSFCICQLSYDLLLLKIQHCQVINFIFQYHLNNFRRLISSSPAKVLRVFNVLQILNRLDKVRSEKIYFGDNISDLINDFLGIHELIFSRNCCKFHHQIHGGIKVLYHSINLDNRLHVMEPFIRLPGDRRLKKIEQIGHAVIALRGTHRELLNVDQYTVDIFYDFQKGNHFGTFDMLQAMMSKPSQSSILQGHRSLICFPTGELWIFNDLDWLKVSTTYFLSRDKKLTDLLD 3700
            MEKPLSRKLVIPKTEHLDQKYWYVNPGIMTKANYEKAFIIINSMDLTRFDLSYVLFLGIKYLVCYLELFSLDQTPLLTESIKNHLKFLLLVTSKQKHSKYLLHHRYICHASNVVEQFIKIPHQDYLERQMYLDHIEIICKMLICKSQLWIKNNDLLSAYMYRYGYSPSKTSVVYCSYIIPNERQYLNPLQHVSQKLLDKIEMKCFCKIKLSFNDLPCHYSDDFVLLEILFDPYRGNFLGFLDMLEYIVKSLSPTAFFPHCLRIIVLEDSCIYNFLTNIPHKKLVRMGKSISLTGRLEPFLEEFSASKRLYSLLEVMIKDEDFDDTVSSVSDNIQDICNICDDSFNEEDEEEMEEKEMENDVKKHNRILKLFS                                 ++AIKTDEIVVEELNNSAKRAAPEGHCIEIAMSESESLSDDEFHSDTNFITINVDENCFTQKAYQKNSSNIVEDEVNDGKFRIINDKNNDESSIEVEIDHSFESKFDEIVTKPVCYYSSEAMFNHKLRVMMRCDTAEMSDDIFNPDSPEFMENLQLIHKRNLLEKKYNLEMGIKNVGKIGISLENIVRSDESQLGKMLFNGKEFESLSDTKHSEEKRMTYSKSYSDNRNLGNFDPIQRQGMLNLKTLEDNNADKLLPNKQHAEGRKMTYSKSYSDDRNPIQRQGTLNMNTLERNRTENFGSNKNTLGPYQIISKSSNDHYDKYWLSENAERLLAQRETEDPKTSSLTKENNAGVDSSNWQGLFPQIPQKVYPAMSYQALVDSSSSIKNYVKRFGQDTIRKFVQGKLFNENWMKLLYDQIEFDDIDDNGEFSDCSPKKLLEVFDKFTETELKGNATKNMLKSKGIYSLLKILTKGGLNFSHFKILAEGVGVDIPLLNKINTSPGYLPVWSGYLTDKLGYQPEQSLSFCICQLSYDLLLLKIQHCQVINFIFQYHLNNFRRLISSSPAKVLRVFNVLQILNRLDKVRSEKIYFGDNISDLINDFLGIHELIFSRNCCKFHHQIHGGIKVLYHSINLDNRLHVMEPFIRLPGDRRLKKIEQIGHAVIALRGTHRELLNVDQYTVDIFYDFQKGNHFGTFDMLQAMMSKPSQSSILQGHRSLICFPTGELWIFNDLDWLKVSTTYFLSRDKKLTDLLD
Sbjct:    1 MEKPLSRKLVIPKTEHLDQKYWYVNPGIMTKANYEKAFIIINSMDLTRFDLSYVLFLGIKYLVCYLELFSLDQTPLLTESIKNHLKFLLLVTSKQKHSKYLLHHRYICHASNVVEQFIKIPHQDYLERQMYLDHIEIICKMLICKSQLWIKNNDLLSAYMYRYGYSPSKTSVVYCSYIIPNERQYLNPLQHVSQKLLDKIEMKCFCKIKLSFNDLPCHYSDDFVLLEILFDPYRGNFLGFLDMLEYIVKSLSPTAFFPHCLRIIVLEDSCIYNFLTNIPHKKLVRMGKSISLTGRLEPFLEEFSASKRLYSLLEVMIKDEDFDDTVSSVSDNIQDICNICDDSFNEEDEEEMEEKEMENDVKKHNRILKLFS---------------------------------TNAIKTDEIVVEELNNSAKRAAPEGHCIEIAMSESESLSDDEFHSDTNFITINVDENCFTQKAYQKNSSNIVEDEVNDGKFRIINDKNNDESSIEVEIDHSFESKFDEIVTKPVCYYSSEAMFNHKLRVMMRCDTAEMSDDIFNPDSPEFMENLQLIHKRNLLEKKYNLEMGIKNVGKIGISLENIVRSDESQLGKMLFNGKEFESLSDTKHSEEKRMTYSKSYSDNRNLGNFDPIQRQGMLNLKTLEDNNADKLLPNKQHAEGRKMTYSKSYSDDRNPIQRQGTLNMNTLERNRTENFGSNKNTLGPYQIISKSSNDHYDKYWLSENAERLLAQRETEDPKTSSLTKENNAGVDSSNWQGLFPQIPQKVYPAMSYQALVDSSSSIKNYVKRFGQDTIRKFVQGKLFNENWMKLLYDQIEFDDIDDNGEFSDCSPKKLLEVFDKFTETELKGNATKNMLKSKGIYSLLKILTKGGLNFSHFKILAEGVGVDIPLLNKINTSPGYLPVWSGYLTDKLGYQPEQSLSFCICQLSYDLLLLKIQHCQVINFIFQYHLNNFRRLISSSPAKVLRVFNVLQILNRLDKVRSEKIYFGDNISDLINDFLGIHELIFSRNCCKFHHQIHGGIKVLYHSINLDNRLHVMEPFIRLPGDRRLKKIEQIGHAVIALRGTHRELLNVDQYTVDIFYDFQKGNHFGTFDMLQAMMSKPSQSSILQGHRSLICFPTGELWIFNDLDWLKVSTTYFLSRDKKLTDLLD 1126          
BLAST of SMED30012750 vs. Planmine SMEST
Match: SMESG000081478.1 (SMESG000081478.1)

HSP 1 Score: 275.018 bits (702), Expect = 2.643e-76
Identity = 131/311 (42.12%), Postives = 202/311 (64.95%), Query Frame = -2
Query: 2738 IPKTEHLDQKYWYVNPGIMTKANYEKAFIIINSMDLTRFDLSYVLFLGIKYLVCYLELFSLDQTPLLTESIKNHLKFLLLVTSKQKHSKYLLHHRYICHASNVVEQFIKIPHQDYLERQMYLDHIEIICKMLICKSQLWIKNNDLLSAYMYRYGYSPSKTSVVYCSYIIPNERQYLNPLQHVSQKLLDKIEMKCFCKIKLSFNDLPCHYSDDFVLLEILFDPYRGNFLGFLDMLEYIVKSLSPTAFFPHCLRIIVLEDSCIYNFLTNIPHKKLVRMGKSISLTGRLEPFLEEFSASKRLYSLLEVMIKDED 3670
            IPK   LD+ +W+VN G+++   Y+KA +++ +  LT  D S++LFLG+KYL+ Y+ELF  D TPLL+E I  HLK+L  +   QK SK LL + +I     +         +++  RQ+Y+D +E  C +   +  +WIKN  +L AY+YRYGY P ++SV+Y S++IPN+++Y++PL  V QK ++KIE+KC CKI LS     C    +++ LE++FD YRGN++GF++M  YIVK L+PT +F   LR +++E S +Y+ LTN+P KKL  + K++     + PFL   S SK+L S++   I+D D
Sbjct:   13 IPKRHILDKNFWFVNAGLLSTTIYDKAALLVGTFPLTSVDFSFILFLGLKYLIHYIELFIFDNTPLLSECINKHLKYLQTLVGTQKKSKKLLSYEFITKVQFIFNNLQTFEVKNFACRQVYIDQLERFCSLFTGRLSIWIKN-PILQAYLYRYGYDPCRSSVIYNSFLIPNQKRYVDPLCRVDQKFIEKIEVKCNCKIMLSVETTECFLYPEYITLEVIFDLYRGNYIGFIEMFGYIVKRLNPTQYFVKSLRTVIIEGSILYSILTNVPFKKLKYLEKTVIAGCPITPFLSPESTSKQLLSIV-ARIRDHD 321          

HSP 2 Score: 221.09 bits (562), Expect = 1.067e-58
Identity = 138/457 (30.20%), Postives = 234/457 (51.20%), Query Frame = -2
Query:  278 RNRTENFGSNKNTLGPYQIISKSSNDHYDKYWLSENAERLLAQ---RETEDPKTSSLTKENNAGVDSSNWQGLFPQIPQKVYPAMSYQALVDSSSSIKNYVKRFGQDTIRKFVQGKLFN-ENWMKLLYDQIEFDDIDDNGEFSDCSPKKLLEVFDKFTETELKGNATK----NMLKSKGIYSLLKILTKGGLNFSHFKILAEGVGVDIPLLNKINTSPGYLPVWSGYLTDKLGYQPEQSLSFCICQLSYDLLLLKIQHCQVINFIFQYHLNNFRRLISSSPAK-VLRVFNVLQILNRLDKVRSEKIYFGDNISD----LINDFLGIHELIFSRNCCKFHHQIHGGIKVLYHSINLDNRLHVMEPFIRLPGDRRLKKIEQIGHAVIALRGTHRELLNVDQYTVDIFYDFQKGNHFGTFDMLQAMMSKPSQSSILQGHRSLICFPTGELWIFNDLDWLK 1609
            R  +  F S K      Q +S+ S       W+S+ A ++L++    +++   TSS        +   + +  FPQI                      ++++ G+  I  F+  KL+  ++W+  L  QI F   +D      C        FD   +T  K N+ K    + +  K IY+LL +LT   +    F+ +  G GV +P+++K+N +   +P + G L          +LS C+CQ+ YDL+ +  +  Q + +I + H+     +I +   K +L  F++L I N L+ +       G   S     L  +   +H+++F + CC +    H G+ ++YHS+ LDNRL+V+EPF +LPGDRR+K+IE+I + +IALR      +++D+Y VDIFYDF  GNHFG  D+L+ MM+  ++   +Q HR+++ +P+GELW+F + DWLK
Sbjct:  586 RGVSRTFTSKKVKTKVAQNVSRYS-------WMSKAASQILSEGMVSKSDIDSTSSSAYSEKEILSKDDLRKRFPQIFL--------------------FLEKHGEHLIDIFINKKLYKKQDWLNFLSTQIHFSLTNDIFLKRICD-------FDSIFKTICKRNSVKLQAYDDVIVKKIYALLLLLTGEVITEKEFRDIVSGKGVSLPIIDKVNKTHPSVPTYIGNLDSYKEKDDLHNLSRCLCQMMYDLIQIAHESSQDVFYILKIHIQVLDDIIKNIQDKDILSAFDILNIRNELNSLDFNTHVRGYGTSSSIILLAEELSFLHDILFKQPCCSYKLSKHLGLHIIYHSLRLDNRLNVVEPFFKLPGDRRIKRIEKICNCLIALRTQKHPTISIDEYLVDIFYDFDNGNHFGAIDLLKQMMNSQNRLLAIQDHRTIVAYPSGELWVFREADWLK 1008          
BLAST of SMED30012750 vs. Planmine SMEST
Match: SMESG000081480.1 (SMESG000081480.1)

HSP 1 Score: 253.832 bits (647), Expect = 2.322e-69
Identity = 120/311 (38.59%), Postives = 204/311 (65.59%), Query Frame = -2
Query: 2738 IPKTEHLDQKYWYVNPGIMTKANYEKAFIIINSMDLTRFDLSYVLFLGIKYLVCYLELFSLDQTPLLTESIKNHLKFLLLVTSKQKHSKYLLHHRYICHASNVVEQFIKIPHQDYLERQMYLDHIEIICKMLICKSQLWIKNNDLLSAYMYRYGYSPSKTSVVYCSYIIPNERQYLNPLQHVSQKLLDKIEMKCFCKIKLSFNDLPCHYSDDFVLLEILFDPYRGNFLGFLDMLEYIVKSLSPTAFFPHCLRIIVLEDSCIYNFLTNIPHKKLVRMGKSISLTGRLEPFLEEFSASKRLYSLLEVMIKDED 3670
            +PK + + +++WYVN G++  + ++KA +++ +  L   DL +VLFLGIKYL+ Y+ELFS D TPLL E I  H+K+L  +  KQK SK  L +RYI     V E    I + +Y+ RQ+Y+D +E  C +   + ++WI+N+ L  AY+ RYG+ P +++ +Y S++IPNE++Y++PL  V+QK ++K+ ++C CKI LS     C+   +F+ LE++FD + GN++GF++M  +I+K L+PT +F    R I++E + +YN L+++P +KL  + K++        FL   S SK+  +++E MI++E+
Sbjct:   20 VPKRQVIAEEFWYVNAGLLPDSYFDKALVLVGTNKLKSADLRFVLFLGIKYLIHYIELFSFDNTPLLIECISKHIKYLEALLGKQKKSKQYLSYRYIEKLRFVFESLQNIEYNNYICRQIYIDQLERFCCLFSSRLKIWIRNSRL-QAYLIRYGFDPYRSAAIYNSFLIPNEKKYIDPLCRVNQKFIEKMGLRCKCKIILSIESTECYLFPEFITLEVIFDLFHGNYVGFMEMFGFIIKQLNPTQYFVKSCRTILIEGAMLYNILSDVPVRKLKYLEKTVIPGVPCPAFLSINSISKQFLNIVE-MIREEE 328          

HSP 2 Score: 215.312 bits (547), Expect = 8.866e-57
Identity = 123/357 (34.45%), Postives = 198/357 (55.46%), Query Frame = -2
Query:  278 IKNYVKRFGQDTIRKFVQGKLF-NENWMKLLYDQIEFDDIDDNGEFSDCSPKKLLEVFDKFTETELKGNATKNMLKSKGIYSLLKILTKGGLNFSHFKILAEGVGVDIPLLNKINTSPGYLPVWSGYLTDKLGYQPEQSLSFCICQLSYDLLLLKIQHCQVINFIFQYHLNNFRRLISSSPAKVLR-VFNVLQILNRLDK--VRSEKIYFGDNISDL--INDFLGIHELIFSRNCCKFHHQIHGGIKVLYHSINLDNRLHVMEPFIRLPGDRRLKKIEQIGHAVIALRGTHRELLNVDQYTVDIFYDFQKGNHFGTFDMLQAMMSKPSQSSILQGHRSLICFPTGELWIFNDLDWLK 1330
            +  Y+K+F       F+  KLF  +NW+  L   ++F    +   +  C+ +   +++ K  E         N    K IY+LL +LT   +   +F  L EG G++ P++NKIN S   LP + G L          +LS C+CQL YDL+ L  +  + + +I + H++    ++ +     +R  F  L I+N L K  ++S     G NIS L    +   +H++IF   CC +    H GI ++YHS+ LD+RL+ +EPF++LPGDRR++KIE+I + +I LR     ++ ++QY VDI+YDF+ GNHFG   +++ MM    +S+ ++ HR+LI +P+GELW F D  WLK
Sbjct:  666 VAKYLKKFDMRLTDTFISRKLFRKQNWINFLEQNLDFQYSREIEIYKLCNTE---DIYMKVYENHTDRIENINDSLRKRIYALLILLTNNTITEKNFAELLEGQGINFPIINKINLSKSSLPTFIGNLEKIKKKDYVGNLSKCLCQLMYDLIHLGYECNRELFYIMKTHISELVEIVKNINDDDIRSAFRTLNIINDLTKFNMKSYISGMGPNISMLYLAEELSLLHDIIFKNPCCSYKIHKHLGIHIIYHSMQLDDRLNAVEPFLKLPGDRRIRKIEKICNCLITLRTGQHPIVPMNQYYVDIYYDFESGNHFGAMGLIKQMMLNQQKSASMKDHRTLIAYPSGELWAFRDTKWLK 1019          
BLAST of SMED30012750 vs. Planmine SMEST
Match: SMESG000007916.1 (SMESG000007916.1)

HSP 1 Score: 202.601 bits (514), Expect = 9.895e-53
Identity = 102/307 (33.22%), Postives = 181/307 (58.96%), Query Frame = -2
Query: 2768 LSRKLVIPKTEHLDQKYWYVNPGIMTKANYEKAFIIINSMDLTRFDLSYVLFLGIKYLVCYLELFSLDQTPLLTESIKNHLKFLLLVTSKQKHSKYLLHHRYICHASNVVEQFIKIPHQDYLERQMYLDHIEIICKMLICKSQLWIKNNDLLSAYMYRYGYSPSKTSVVYCSYIIPNERQYLNPLQHVSQKLLDKIEMKCFCKIKLSFNDLPCHYSDDFVLLEILFDPYRGNFLGFLDMLEYIVKSLSPTAFFPHCLRIIVLEDSCIYNFLTNIPHKKLVRMGKSISLTGRLEPFLEEFSASKRLYS 3688
            LS   +IP    L Q YWY++PGI++ + Y+K+ + I+++    ++L ++ F+ I  L+  LELFS D TP+L   IK  L F   +  KQK++   +   YI   S V    I++    Y+E+Q+ +D IE +C     + + W +++ L  AY++R+G+  +  +++Y S++IP  +++++ +     + L+KIE +C C I ++ N     Y  D+ L+E++FD Y G  LGFLDML Y++KS+  T +F   LR IV++DS  + FL+N P + L  +G+++     + PF  + + +KR++S
Sbjct:    4 LSSDDIIPSRYELTQNYWYISPGILSLSLYKKSLLEISTVSYDPYELEFIFFVSISNLIKQLELFSFDFTPILIHIIKQQLSFFKTLCVKQKYANLFISSSYIDQLSTVFHSLIELKRWRYVEQQICIDEIERVCNFFKSRLRYWFQSSHL-KAYLWRWGFKENINAIIYYSFLIPKVQKFVDAMLKDGSQYLEKIESRCKCSISMNSNMGIHMYEFDYFLMEVVFDLYHGKPLGFLDMLRYLMKSIHLTKYFLKNLRTIVIKDSSSFIFLSNTPMRTLRLLGRNVESGESISPFFSKLNCTKRIFS 309          

HSP 2 Score: 157.147 bits (396), Expect = 1.715e-38
Identity = 99/329 (30.09%), Postives = 174/329 (52.89%), Query Frame = -2
Query:  317 FNENWMKLL-----YDQIEFDDIDDNGEFSDCSPKKLLEVFDKFTETELKGNATKNMLKSKGIYSLLKILTKGGLNFSHFKILAEGVGVDIPLLNKINTSPGYLPVWSGYLTDKLGYQPEQSLSFCICQLSYDLLLLKIQHCQVINFIFQYHLNNFRR-----LISSSPAKVLRVFNVL-QILNRLDKVRSEKIYFGDNISDLINDFLGIHELIFSRNCCKFHHQIHGGIKVLYHSINLDNRLHVMEPFIRLPGDRRLKKIEQIGHAVIALRGTHRELLNVDQYTVDIFYDFQKGNHFGTFDMLQAMMSKP-SQSSILQGHRSLICFPT 1267
            + +NW+K+L     +  ++ D   D  ++ +C P   +E ++K  +     N     +K+K I           +  +HF+ L EG  +DIP++ ++N +    P + GYL           L   ICQLS+D+ LL +            H N F +      I S   K+L++ + L ++++ L+  +         I ++ +++L +HE +FSR CC +    + GI+++YHSI +D     +EPF+RLPGDRR++KIE   +++IALR     +LN  +Y ++I+YDF  GNHF   +++ +M+ +   +SS L  +R+LIC+PT
Sbjct:  578 YVDNWVKILKLDYDWSNLQSDLQIDGDKYVECCP---IEFYNKLKDE----NPIPTEMKNKTI-----------VYNTHFRELNEGKSIDIPIILEVNKT-TLKPTFFGYLNPNQSTNSALRLQLLICQLSFDMFLLSV------------HRNEFLKESQSTKIVSEIGKILKLKDTLTELISILNLSKQFSALDEARIIEVSDEYLFLHEFLFSRKCCNWLEHKYYGIRIIYHSIFIDGNAKCIEPFLRLPGDRRIRKIENRCNSIIALREIIHSVLNTKRYLIEIYYDFFSGNHFSCVELIGSMLVENYGKSSRLVANRTLICYPT 875          
BLAST of SMED30012750 vs. Planmine SMEST
Match: SMESG000007916.1 (SMESG000007916.1)

HSP 1 Score: 202.601 bits (514), Expect = 1.467e-52
Identity = 102/307 (33.22%), Postives = 181/307 (58.96%), Query Frame = -2
Query: 2768 LSRKLVIPKTEHLDQKYWYVNPGIMTKANYEKAFIIINSMDLTRFDLSYVLFLGIKYLVCYLELFSLDQTPLLTESIKNHLKFLLLVTSKQKHSKYLLHHRYICHASNVVEQFIKIPHQDYLERQMYLDHIEIICKMLICKSQLWIKNNDLLSAYMYRYGYSPSKTSVVYCSYIIPNERQYLNPLQHVSQKLLDKIEMKCFCKIKLSFNDLPCHYSDDFVLLEILFDPYRGNFLGFLDMLEYIVKSLSPTAFFPHCLRIIVLEDSCIYNFLTNIPHKKLVRMGKSISLTGRLEPFLEEFSASKRLYS 3688
            LS   +IP    L Q YWY++PGI++ + Y+K+ + I+++    ++L ++ F+ I  L+  LELFS D TP+L   IK  L F   +  KQK++   +   YI   S V    I++    Y+E+Q+ +D IE +C     + + W +++ L  AY++R+G+  +  +++Y S++IP  +++++ +     + L+KIE +C C I ++ N     Y  D+ L+E++FD Y G  LGFLDML Y++KS+  T +F   LR IV++DS  + FL+N P + L  +G+++     + PF  + + +KR++S
Sbjct:    4 LSSDDIIPSRYELTQNYWYISPGILSLSLYKKSLLEISTVSYDPYELEFIFFVSISNLIKQLELFSFDFTPILIHIIKQQLSFFKTLCVKQKYANLFISSSYIDQLSTVFHSLIELKRWRYVEQQICIDEIERVCNFFKSRLRYWFQSSHL-KAYLWRWGFKENINAIIYYSFLIPKVQKFVDAMLKDGSQYLEKIESRCKCSISMNSNMGIHMYEFDYFLMEVVFDLYHGKPLGFLDMLRYLMKSIHLTKYFLKNLRTIVIKDSSSFIFLSNTPMRTLRLLGRNVESGESISPFFSKLNCTKRIFS 309          

HSP 2 Score: 157.147 bits (396), Expect = 1.832e-38
Identity = 99/329 (30.09%), Postives = 174/329 (52.89%), Query Frame = -2
Query:  317 FNENWMKLL-----YDQIEFDDIDDNGEFSDCSPKKLLEVFDKFTETELKGNATKNMLKSKGIYSLLKILTKGGLNFSHFKILAEGVGVDIPLLNKINTSPGYLPVWSGYLTDKLGYQPEQSLSFCICQLSYDLLLLKIQHCQVINFIFQYHLNNFRR-----LISSSPAKVLRVFNVL-QILNRLDKVRSEKIYFGDNISDLINDFLGIHELIFSRNCCKFHHQIHGGIKVLYHSINLDNRLHVMEPFIRLPGDRRLKKIEQIGHAVIALRGTHRELLNVDQYTVDIFYDFQKGNHFGTFDMLQAMMSKP-SQSSILQGHRSLICFPT 1267
            + +NW+K+L     +  ++ D   D  ++ +C P   +E ++K  +     N     +K+K I           +  +HF+ L EG  +DIP++ ++N +    P + GYL           L   ICQLS+D+ LL +            H N F +      I S   K+L++ + L ++++ L+  +         I ++ +++L +HE +FSR CC +    + GI+++YHSI +D     +EPF+RLPGDRR++KIE   +++IALR     +LN  +Y ++I+YDF  GNHF   +++ +M+ +   +SS L  +R+LIC+PT
Sbjct:  578 YVDNWVKILKLDYDWSNLQSDLQIDGDKYVECCP---IEFYNKLKDE----NPIPTEMKNKTI-----------VYNTHFRELNEGKSIDIPIILEVNKT-TLKPTFFGYLNPNQSTNSALRLQLLICQLSFDMFLLSV------------HRNEFLKESQSTKIVSEIGKILKLKDTLTELISILNLSKQFSALDEARIIEVSDEYLFLHEFLFSRKCCNWLEHKYYGIRIIYHSIFIDGNAKCIEPFLRLPGDRRIRKIENRCNSIIALREIIHSVLNTKRYLIEIYYDFFSGNHFSCVELIGSMLVENYGKSSRLVANRTLICYPT 875          
The following BLAST results are available for this feature:
BLAST of SMED30012750 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012750 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059073.10.000e+096.98SMESG000059073.1[more]
SMESG000081478.12.643e-7642.12SMESG000081478.1[more]
SMESG000081480.12.322e-6938.59SMESG000081480.1[more]
SMESG000007916.19.895e-5333.22SMESG000007916.1[more]
SMESG000007916.11.467e-5233.22SMESG000007916.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012750 ID=SMED30012750|Name=SMED30012750|organism=Schmidtea mediterranea sexual|type=transcript|length=3707bp
AAATCGGTAGTTATGCTTATCTAGCCTCAACAGTTTTTATTCGGTCCCCT
ATTAAACGCTTTGACTCCCATATAGGAAACTCCTTATTTCGGATTAAAAT
TCATAAAATATTGTAATGTATTTTTTTAAGAGGAAATATTTGAATGAAGA
TTACAAAAACCGGAAATCATAGAGATTAACTGAAAAAATTATTCTAACTC
TTAAAAGAATAAGAGATTCAGTTATCCAGGAGATCAGTCAACTTTTTATC
GCGACTTAAAAAATAAGTGGTTGAAACTTTTAACCAATCTAAATCATTGA
ATATCCACAATTCCCCGGTTGGGAAACAAATCAGCGACCGATGGCCTTGT
AGAATTGAGCTTTGAGAAGGTTTAGACATCATGGCTTGTAGCATGTCAAA
AGTCCCGAAATGATTTCCTTTCTGGAAATCATAGAAAATATCAACAGTAT
ATTGGTCAACGTTCAAAAGCTCTCGATGGGTACCCCGCAATGCAATCACT
GCATGACCAATCTGTTCGATCTTCTTCAAACGTCTATCGCCGGGCAAACG
TATGAACGGTTCCATGACATGTAAACGGTTGTCCAAATTTATCGAATGAT
ACAGCACTTTGATACCTCCATGAATCTGGTGATGAAATTTGCAGCAATTT
CTTGAAAAAATCAACTCATGGATTCCTAGGAAATCATTTATCAGATCACT
AATATTGTCACCGAAATAAATTTTTTCACTGCGTACTTTATCCAAACGAT
TAAGTATTTGAAGAACATTAAAAACACGCAAAACCTTTGCAGGACTTGAA
CTGATAAGTCTTCTGAAGTTATTCAGATGGTACTGGAAGATAAAATTGAT
AACTTGGCAGTGCTGGATTTTGAGTAGTAGCAAATCATAACTCAGTTGGC
AAATGCAGAAGGATAGACTCTGTTCCGGTTGATATCCTAATTTATCTGTC
AAATACCCAGACCAAACCGGAAGATATCCGGGTGATGTGTTAATTTTATT
TAACAGCGGAATATCAACTCCGACCCCTTCTGCCAATATCTTAAAGTGAC
TAAAATTGAGGCCTCCCTTTGTCAAAATTTTAAGTAAAGAATAAATTCCT
TTTGATTTCAGCATGTTTTTAGTGGCATTTCCTTTTAGCTCCGTTTCAGT
AAATTTGTCGAATACTTCAAGCAATTTTTTGGGGGAACAATCTGAAAACT
CCCCATTGTCATCAATGTCATCGAACTCTATTTGATCATATAATAATTTC
ATCCAATTTTCATTAAATAATTTCCCTTGGACAAATTTACGAATCGTATC
TTGTCCAAATCGTTTGACGTAGTTTTTTATACTGGAACTGCTATCAACAA
GGGCTTGATAACTCATTGCGGGATAAACCTTCTGGGGTATCTGTGGAAAC
AGCCCTTGCCAATTACTTGAATCTACTCCAGCATTGTTTTCTTTAGTAAG
TGATGAAGTTTTAGGGTCTTCAGTTTCTCTTTGTGCAAGTAGTCTTTCAG
CGTTTTCGGACAACCAATATTTATCATAATGATCATTTGAACTTTTACTA
ATAATTTGATATGGTCCTAAGGTATTTTTGTTTGAACCAAAGTTTTCCGT
CCTATTTCTTTCTAAAGTATTCATATTCAACGTTCCTTGTCTTTGGATCG
GATTCCTGTCATCACTGTAGGATTTGCTATAAGTCATTTTTCTTCCTTCT
GCATGTTGTTTATTTGGAAGCAATTTATCCGCATTATTGTCTTCGAGGGT
TTTCAGATTCAACATTCCTTGTCTTTGGATAGGATCAAAGTTTCCCAGAT
TCCTGTTATCACTGTATGATTTGCTATAAGTCATTCTTTTTTCTTCAGAA
TGTTTTGTATCTGAAAGGCTTTCAAATTCTTTTCCGTTGAAAAGCATTTT
TCCTAGTTGGCTCTCATCAGAACGAACAATATTCTCAAGGCTTATCCCAA
TTTTACCAACATTTTTAATACCCATTTCAAGATTGTATTTTTTCTCAAGC
AAATTCCTTTTATGGATCAACTGTAGATTTTCCATGAATTCCGGAGAATC
GGGATTGAAAATATCATCTGACATTTCAGCTGTGTCACACCTCATCATCA
CCCTTAGCTTATGGTTGAACATCGCTTCGGAGCTGTAATAGCAAACTGGC
TTTGTGACAATTTCGTCAAATTTACTTTCAAAAGAATGATCTATCTCGAC
TTCTATAGATGATTCATCATTGTTTTTATCGTTAATAATACGAAACTTTC
CATCATTCACTTCGTCCTCAACAATATTGCTTGAATTTTTCTGATAGGCT
TTTTGAGTAAAACAATTTTCATCAACGTTTATCGTAATAAAGTTCGTATC
AGAATGAAACTCGTCGTCTGAAAGGGACTCACTTTCAGACATAGCGATTT
CAATGCAATGGCCTTCCGGGGCGGCTCTTTTAGCCGAATTATTCAATTCT
TCAACAACTATTTCATCGGTTTTAATTGCACTAGAATTATTATTACCCAG
ATTAAATATTATATCAGTATCTCTCGTACTCACTTGGTACCTTGGTTTTG
TTCTTATTCTGTCAATTCTTTCGTGATAAAGTTTACTAAAAAGCTTAAGG
ATTCGATTATGCTTTTTTACATCATTTTCCATTTCTTTCTCTTCCATCTC
TTCCTCATCTTCTTCATTAAAACTATCATCACATATATTACAAATATCTT
GAATGTTATCGGATACAGAGGAAACTGTATCATCGAAGTCTTCATCCTTT
ATCATTACTTCCAATAAACTATAAAGTCGTTTACTCGCACTAAATTCTTC
TAAGAATGGTTCCAATCTCCCAGTCAACGAAATAGATTTACCCATCCTGA
CTAACTTTTTATGTGGAATATTCGTTAGGAAATTATAAATACAGGAATCT
TCAAGGACAATTATTCTCAGACAGTGAGGGAAAAACGCTGTTGGACTTAA
ACTTTTCACGATGTATTCTAACATATCAAGGAACCCAAGGAAGTTCCCTC
GGTATGGATCGAACAATATCTCTAATAAAACAAAATCATCCGAATAATGA
CAAGGTAAATCATTAAATGACAACTTAATTTTACAAAAACATTTCATTTC
AATTTTATCTAAAAGCTTTTGGCTAACGTGTTGAAGGGGATTCAGATATT
GGCGCTCGTTTGGGATAATGTATGAGCAATAGACAACAGAGGTTTTCGAT
GGCGAGTAGCCATAACGGTACATATAGGCAGAGAGTAAGTCGTTATTTTT
TATCCACAATTGACTTTTACAAATCAGCATTTTACATATGATTTCAATAT
GATCCAAATACATTTGTCTTTCTAGATAATCTTGGTGAGGGATCTTGATG
AATTGTTCTACAACATTCGAAGCATGGCAAATGTAGCGATGGTGAAGAAG
ATATTTCGAATGCTTTTGCTTACTTGTAACAAGCAGTAAAAACTTGAGAT
GGTTCTTTATGGATTCGGTTAATAAAGGGGTCTGGTCAAGACTAAAAAGC
TCCAAATAACAAACCAAATATTTGATGCCCAGGAATAAAACATAACTGAG
ATCGAATCTCGTTAAGTCCATTGAATTAATTATAATAAATGCTTTTTCAT
AATTAGCTTTTGTCATAATTCCTGGGTTAACGTACCAATATTTTTGATCA
AGATGCTCTGTTTTAGGGATCACCAATTTCCGTGATAACGGCTTTTCCAT
TATTTAT
back to top

protein sequence of SMED30012750-orf-1

>SMED30012750-orf-1 ID=SMED30012750-orf-1|Name=SMED30012750-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1161bp
MEKPLSRKLVIPKTEHLDQKYWYVNPGIMTKANYEKAFIIINSMDLTRFD
LSYVLFLGIKYLVCYLELFSLDQTPLLTESIKNHLKFLLLVTSKQKHSKY
LLHHRYICHASNVVEQFIKIPHQDYLERQMYLDHIEIICKMLICKSQLWI
KNNDLLSAYMYRYGYSPSKTSVVYCSYIIPNERQYLNPLQHVSQKLLDKI
EMKCFCKIKLSFNDLPCHYSDDFVLLEILFDPYRGNFLGFLDMLEYIVKS
LSPTAFFPHCLRIIVLEDSCIYNFLTNIPHKKLVRMGKSISLTGRLEPFL
EEFSASKRLYSLLEVMIKDEDFDDTVSSVSDNIQDICNICDDSFNEEDEE
EMEEKEMENDVKKHNRILKLFSKLYHERIDRIRTKPRYQVSTRDTDIIFN
LGNNNSSAIKTDEIVVEELNNSAKRAAPEGHCIEIAMSESESLSDDEFHS
DTNFITINVDENCFTQKAYQKNSSNIVEDEVNDGKFRIINDKNNDESSIE
VEIDHSFESKFDEIVTKPVCYYSSEAMFNHKLRVMMRCDTAEMSDDIFNP
DSPEFMENLQLIHKRNLLEKKYNLEMGIKNVGKIGISLENIVRSDESQLG
KMLFNGKEFESLSDTKHSEEKRMTYSKSYSDNRNLGNFDPIQRQGMLNLK
TLEDNNADKLLPNKQHAEGRKMTYSKSYSDDRNPIQRQGTLNMNTLERNR
TENFGSNKNTLGPYQIISKSSNDHYDKYWLSENAERLLAQRETEDPKTSS
LTKENNAGVDSSNWQGLFPQIPQKVYPAMSYQALVDSSSSIKNYVKRFGQ
DTIRKFVQGKLFNENWMKLLYDQIEFDDIDDNGEFSDCSPKKLLEVFDKF
TETELKGNATKNMLKSKGIYSLLKILTKGGLNFSHFKILAEGVGVDIPLL
NKINTSPGYLPVWSGYLTDKLGYQPEQSLSFCICQLSYDLLLLKIQHCQV
INFIFQYHLNNFRRLISSSPAKVLRVFNVLQILNRLDKVRSEKIYFGDNI
SDLINDFLGIHELIFSRNCCKFHHQIHGGIKVLYHSINLDNRLHVMEPFI
RLPGDRRLKKIEQIGHAVIALRGTHRELLNVDQYTVDIFYDFQKGNHFGT
FDMLQAMMSKPSQSSILQGHRSLICFPTGELWIFNDLDWLKVSTTYFLSR
DKKLTDLLDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 69..91
NoneNo IPR availableTMHMMTMhelixcoord: 101..118