TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30012745
Length (bp)784
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30012745) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30012745) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30012745) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30012745) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012745

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30012745SMESG000025867.1 dd_Smed_v4_3875_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012745SMESG000025867.1 DN298487ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30012745SMESG000025867.1 DN298487ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30012745SMESG000025867.1 dd_Smed_v4_3875_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30012745SMESG000025867.1 dd_Smed_v4_3875_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30012745SMESG000025867.1 dd_Smed_v4_3875_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 58.151 bits (139), Expect = 5.017e-9
Identity = 52/202 (25.74%), Postives = 93/202 (46.04%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNE--GCVCVLRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCS--STFHNSLKLHFSECLLVELPCPIYNCGRMFK 733
            + C  C  +L +P +T+CG R C+ C+   ++ S   KC  C+  ++   D + +DN   RE+  +++ C NE  GC   L + +L  H+   C +    C   DC +++   +  +H+   C  +   C+HC++  P+  L+          D  C      CP++CS  +   + L  H SEC+     C     G +F+
Sbjct:   51 YKCEKCHLVLCSPKQTECGHRFCESCMAALLS-SSSPKCTACQESIVK--DKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHE-------DTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQ 242          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 58.151 bits (139), Expect = 5.017e-9
Identity = 52/202 (25.74%), Postives = 93/202 (46.04%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNE--GCVCVLRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCS--STFHNSLKLHFSECLLVELPCPIYNCGRMFK 733
            + C  C  +L +P +T+CG R C+ C+   ++ S   KC  C+  ++   D + +DN   RE+  +++ C NE  GC   L + +L  H+   C +    C   DC +++   +  +H+   C  +   C+HC++  P+  L+          D  C      CP++CS  +   + L  H SEC+     C     G +F+
Sbjct:   51 YKCEKCHLVLCSPKQTECGHRFCESCMAALLS-SSSPKCTACQESIVK--DKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHE-------DTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQ 242          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 50.8322 bits (120), Expect = 1.183e-6
Identity = 44/169 (26.04%), Postives = 80/169 (47.34%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNE--GCVCVLRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCS 640
            + C  C  +L +P +T+CG R C+ C+   ++ S   KC  C+  ++   D + +DN   RE+  +++ C NE  GC   L + +L  H+   C +    C   DC +++   +  +H+   C  +   C+HC++  P+  L+          D  C      CP++CS
Sbjct:   51 YKCEKCHLVLCSPKQTECGHRFCESCMAALLS-SSSPKCTACQESIVK--DKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHE-------DTDCPCVVVSCPHKCS 209          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 50.8322 bits (120), Expect = 1.183e-6
Identity = 44/169 (26.04%), Postives = 80/169 (47.34%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNE--GCVCVLRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCS 640
            + C  C  +L +P +T+CG R C+ C+   ++ S   KC  C+  ++   D + +DN   RE+  +++ C NE  GC   L + +L  H+   C +    C   DC +++   +  +H+   C  +   C+HC++  P+  L+          D  C      CP++CS
Sbjct:   51 YKCEKCHLVLCSPKQTECGHRFCESCMAALLS-SSSPKCTACQESIVK--DKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHE-------DTDCPCVVVSCPHKCS 209          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 48.9062 bits (115), Expect = 4.305e-6
Identity = 38/143 (26.57%), Postives = 72/143 (50.35%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNE--GCVCVLRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILR 562
            + C  C  +L +P +T+CG R C+ C+   ++ S   KC  C+  ++   D + +DN   RE+  +++ C NE  GC   L + +L  H+   C +    C   DC +++   +  +H+   C  +   C+HC++  P+  L+
Sbjct:   51 YKCEKCHLVLCSPKQTECGHRFCESCMAALLS-SSSPKCTACQESIVK--DKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQ 190          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf5 (Tnf receptor-associated factor 5 [Source:ZFIN;Acc:ZDB-GENE-071120-3])

HSP 1 Score: 51.9878 bits (123), Expect = 1.880e-7
Identity = 57/207 (27.54%), Postives = 85/207 (41.06%), Query Frame = 2
Query:  128 SEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDI----ILRDNESNREMSKIKMKCLNEGCVCVLRMS--NLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTF-HNSLKLHFSECLLVELPCPIYNCG 721
            S     F C  C  ++ NP +T CG   C +C+  +       KC       LD++ I    I +DN   RE+  +++ C N    C  R S  NL+ H+ + C     +C  SDC   +      EH  N C  +LE C +C+  FP+  +       +      C +    C   C+     + L+ H  ECL VE  C   N G
Sbjct:   33 SRLEQQFICPSCGGIVLNPHQTGCGHIFCAQCVKAYTENGGSSKC------PLDSIPIKPEEIFQDNCCKRELLNLEVFCTN-APECTQRFSLCNLQDHL-KACPHERVRCSHSDCSDIVLRKNLLEHQRNACSYRLETCHYCRQNFPVSQM-------MGHQKSSCPDVEVPCSNNCTQMIKRHQLQAHADECLEVETDCVYKNYG 224          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 52.373 bits (124), Expect = 2.458e-7
Identity = 42/180 (23.33%), Postives = 75/180 (41.67%), Query Frame = 2
Query:  107 LTQQVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRS-------LMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGEC 625
            ++++VL     P + C  C+ +L  P +  CG R C  C  K +  S    C  CR+         + N+ +   DN + RE+  +  KC NEGC     + +  +     C++   +C  C   + L EK+ H   +C  +   C +C+          F+   +   D +C  +  +C
Sbjct:   43 ISREVLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCF-KQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKV--------TFNFKEIKAHDEICQKFPMQC 213          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 51.9878 bits (123), Expect = 3.031e-7
Identity = 42/180 (23.33%), Postives = 75/180 (41.67%), Query Frame = 2
Query:  107 LTQQVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRS-------LMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGEC 625
            ++++VL     P + C  C+ +L  P +  CG R C  C  K +  S    C  CR+         + N+ +   DN + RE+  +  KC NEGC     + +  +     C++   +C  C   + L EK+ H   +C  +   C +C+          F+   +   D +C  +  +C
Sbjct:   30 ISREVLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCF-KQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKV--------TFNFKEIKAHDEICQKFPMQC 200          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 51.9878 bits (123), Expect = 3.031e-7
Identity = 42/180 (23.33%), Postives = 75/180 (41.67%), Query Frame = 2
Query:  107 LTQQVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRS-------LMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGEC 625
            ++++VL     P + C  C+ +L  P +  CG R C  C  K +  S    C  CR+         + N+ +   DN + RE+  +  KC NEGC     + +  +     C++   +C  C   + L EK+ H   +C  +   C +C+          F+   +   D +C  +  +C
Sbjct:   30 ISREVLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCF-KQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKV--------TFNFKEIKAHDEICQKFPMQC 200          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 51.6026 bits (122), Expect = 3.743e-7
Identity = 42/180 (23.33%), Postives = 77/180 (42.78%), Query Frame = 2
Query:   95 NKLELTQQVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKC-RSLMLDNVDIILR------DNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNW 613
            NK    +++L ++      C IC ++L  P +  CG R C  C  K ++ S  +KC  C +  + +    IL+      DN + RE+  ++  C+NE C     +    ++    C +    C  C + ++  E E H   +CP +   C +C+          FH  ++   D +C  +
Sbjct:   15 NKPGFPKKILANKLEDKHLCNICLKILRRPFQAQCGHRFCSYCFNKAVS-SGPQKCSACIKEDIFEEPTSILKQGCAFPDNAAKREVEALEAVCINEECSWTGTIKEYEANHEGKCDFRILPCPSCKELLRANELERHNERECPERTLNCKYCKE--------PFHFKNIKAHDEICPKY 185          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 62.3882 bits (150), Expect = 1.381e-10
Identity = 54/216 (25.00%), Postives = 94/216 (43.52%), Query Frame = 2
Query:  137 PP---SFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKLHFS-ECLLVELPCPIY--NCGRMFKRVDYYDHVTNF 766
            PP    + C IC   L    +T CG R C+ C++K I  +  +      SLM +    +  DN + RE+  +++KC ++GC   + + +L  H+   C ++  +CS C         ++H   +CP +   C +C     L +     +NH    D+ C      C Y  ++     +  H+S +C +  +PC  Y   C    +R D   H+  F
Sbjct:   64 PPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESLMENQ---LFPDNFAKREILSLRVKCPSQGCTETMELRHLERHLVR-CDFAGVECSQCQSSFPKYSLQKHKFEECPRRQIFCENCA----LAMALEDKLNH----DQTCPLAYVTCEYCQTNLIREQMPAHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQEF 267          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 55.4546 bits (132), Expect = 3.140e-8
Identity = 56/204 (27.45%), Postives = 92/204 (45.10%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNV--DIILRDNESNREMSKIKMKCLNE--GCVCVLRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCS--STFHNSLKLHFSECLLVELPCPIYNCGRMFK 733
            + C  C+ +L NP +T+CG R C+ C+   ++ S   +C  C     DN+  D + +DN   RE+  ++M C NE  GC  ++ + NL  H+   C +    C  +DC +++   +  +H+   C  +   C  C+N  PL  ++          D  C +    CP+ CS  S   + L  H  EC+     C     G  FK
Sbjct:   46 YKCEKCRLVLCNPRQTECGHRFCETCMNAILS-STSPQCMACE----DNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHE-------DVDCPSVVISCPHMCSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFK 237          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 49.2914 bits (116), Expect = 3.707e-6
Identity = 47/171 (27.49%), Postives = 81/171 (47.37%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNV--DIILRDNESNREMSKIKMKCLNE--GCVCVLRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCS 640
            + C  C+ +L NP +T+CG R C+ C+   ++ S   +C  C     DN+  D + +DN   RE+  ++M C NE  GC  ++ + NL  H+   C +    C  +DC +++   +  +H+   C  +   C  C+N  PL  ++          D  C +    CP+ CS
Sbjct:   46 YKCEKCRLVLCNPRQTECGHRFCETCMNAILS-STSPQCMACE----DNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHE-------DVDCPSVVISCPHMCS 204          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 60.8474 bits (146), Expect = 3.600e-10
Identity = 53/202 (26.24%), Postives = 95/202 (47.03%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNE--GCVCVLRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCS--STFHNSLKLHFSECLLVELPCPIYNCGRMFK 733
            + C  C+ +L NP +T+CG R C+ C+   ++ S   KC  C+  ++   D + +DN   RE+  +++ C NE  GC   L + +L  H+   C +    C  +DC +++   +  +H+   C  +   C+HC++  P+  L+          D  C      CP++CS  +   + L  H SEC+     C     G +F+
Sbjct:   50 YKCEKCRLVLCNPKQTECGHRFCESCMAALLS-SSSPKCTACQESIIK--DKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHE-------DTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQ 241          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 53.5286 bits (127), Expect = 1.043e-7
Identity = 45/169 (26.63%), Postives = 82/169 (48.52%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCV--LRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCS 640
            + C  C+ +L NP +T+CG R C+ C+   ++ S   KC  C+  ++   D + +DN   RE+  +++ C NEG  C   L + +L  H+   C +    C  +DC +++   +  +H+   C  +   C+HC++  P+  L+          D  C      CP++CS
Sbjct:   50 YKCEKCRLVLCNPKQTECGHRFCESCMAALLS-SSSPKCTACQESIIK--DKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHE-------DTDCPCVVVSCPHKCS 208          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 53.5286 bits (127), Expect = 1.043e-7
Identity = 45/169 (26.63%), Postives = 82/169 (48.52%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCV--LRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCS 640
            + C  C+ +L NP +T+CG R C+ C+   ++ S   KC  C+  ++   D + +DN   RE+  +++ C NEG  C   L + +L  H+   C +    C  +DC +++   +  +H+   C  +   C+HC++  P+  L+          D  C      CP++CS
Sbjct:   50 YKCEKCRLVLCNPKQTECGHRFCESCMAALLS-SSSPKCTACQESIIK--DKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHE-------DTDCPCVVVSCPHKCS 208          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 50.447 bits (119), Expect = 8.858e-7
Identity = 44/162 (27.16%), Postives = 69/162 (42.59%), Query Frame = 2
Query:   86 TKMNKLELTQ-----QVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKC--RSLMLDNVDII-----LRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQ 535
            T    LEL Q      +LG+     + C+ C+ +L  P +  CG R C  CL   ++ S  + C  C    L  + + I+       DN + RE+  +   C N+GC     +    S     C +   +C  C   ++L EKE H   +CP +   C HC+
Sbjct:    7 TSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILS-SGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCR 167          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 48.1358 bits (113), Expect = 5.685e-6
Identity = 44/168 (26.19%), Postives = 69/168 (41.07%), Query Frame = 2
Query:   86 TKMNKLELTQ-----QVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCL------VKFIAISKERKCRKC--RSLMLDNVDII-----LRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQ 535
            T    LEL Q      +LG+     + C+ C+ +L  P +  CG R C  CL         ++ S  + C  C    L  + + I+       DN + RE+  +   C N+GC     +    S     C +   +C  C   ++L EKE H   +CP +   C HC+
Sbjct:    7 TSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILRCASILSSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCR 174          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q28DL4|TRAF6_XENTR (TNF receptor-associated factor 6 OS=Xenopus tropicalis OX=8364 GN=traf6 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.141e-9
Identity = 54/216 (25.00%), Postives = 93/216 (43.06%), Query Frame = 2
Query:  137 PP---SFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKLHFS-ECLLVELPCPIY--NCGRMFKRVDYYDHVTNF 766
            PP    + C IC   L    +T CG R C+ C++K I  +  +      SLM +    +  DN + RE+  +++KC ++GC   + + +L  H+   C ++  +CS C         ++H   +CP +   C +C     L       +NH    D+ C      C Y  ++     +  H+S +C +  +PC  Y   C    +R D   H+  F
Sbjct:   64 PPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESLMENQ---LFPDNFAKREILSLRVKCPSQGCTETMELRHLERHLVR-CDFAGVECSQCQSSFPKYSLQKHKFEECPRRQIFCENCAVAMALED----KLNH----DQTCPLAYVTCEYCQTNLIREQMPAHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQEF 267          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 2.518e-9
Identity = 53/202 (26.24%), Postives = 95/202 (47.03%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNE--GCVCVLRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCS--STFHNSLKLHFSECLLVELPCPIYNCGRMFK 733
            + C  C+ +L NP +T+CG R C+ C+   ++ S   KC  C+  ++   D + +DN   RE+  +++ C NE  GC   L + +L  H+   C +    C  +DC +++   +  +H+   C  +   C+HC++  P+  L+          D  C      CP++CS  +   + L  H SEC+     C     G +F+
Sbjct:   50 YKCEKCRLVLCNPKQTECGHRFCESCMAALLS-SSSPKCTACQESIIK--DKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHE-------DTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQ 241          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 9.516e-9
Identity = 51/216 (23.61%), Postives = 96/216 (44.44%), Query Frame = 2
Query:  137 PP---SFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKLHFS-ECLLVELPCPIY--NCGRMFKRVDYYDHVTNF 766
            PP    + C IC   L    +T CG R C+ C+VK +  +   KC     ++++N   +  DN + RE+  +K+KC ++GC   + + +L  H+ + C +++ +CS C         E+H+ ++C  +   C +C        +    +        +C      C Y  ++     +  H+S +C +  +PC  Y   C    +R D   H+ +F
Sbjct:   64 PPLESKYECPICLMALREAVQTPCGHRFCKACIVKSLRDAG-HKCPVDNEILMENQ--LFPDNFAKREILSLKVKCPSQGCTETMELRHLERHLGQ-CQFASVECSQCQGSFPKSRLEKHMEHECGRRKIFCDNCGLAMAYEDMSGHEL--------ICPLAYVTCEYCQTNLIREQMPSHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQDF 267          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 58.151 bits (139), Expect = 2.409e-8
Identity = 52/202 (25.74%), Postives = 93/202 (46.04%), Query Frame = 2
Query:  146 FFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNE--GCVCVLRMSNLRSHMNEFCSWSNYQC--SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCS--STFHNSLKLHFSECLLVELPCPIYNCGRMFK 733
            + C  C  +L +P +T+CG R C+ C+   ++ S   KC  C+  ++   D + +DN   RE+  +++ C NE  GC   L + +L  H+   C +    C   DC +++   +  +H+   C  +   C+HC++  P+  L+          D  C      CP++CS  +   + L  H SEC+     C     G +F+
Sbjct:   51 YKCEKCHLVLCSPKQTECGHRFCESCMAALLS-SSSPKCTACQESIVK--DKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHE-------DTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQ 242          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q3MV19|TRF6A_XENLA (TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 4.168e-6
Identity = 49/216 (22.69%), Postives = 97/216 (44.91%), Query Frame = 2
Query:  137 PP---SFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKLHFS-ECLLVELPCPI--YNCGRMFKRVDYYDHVTNF 766
            PP    + C IC   L    +T CG R C+ C++K +  +   KC     ++++    +  DN + RE+  +++KC N GC   + + +L  H+ + C +++ +CS C      L  ++H+ ++C  +   C +C     L +       H    + +C      C Y  ++     +  H+S +C +  +PC    + C    +R +   H+ +F
Sbjct:   64 PPLESKYECPICLMALREAVQTPCGHRFCKACILKSLR-NAGHKCPVDNEILMEKQ--LFPDNFAKREILSLRVKCPNLGCTDTMELRHLEHHLVQ-CQFASVECSQCQGSFLKLLLDKHMEHECGRRRTFCDNCG----LAMAYEDKSGH----ELICPMAYVTCDYCQTNLIREQMPAHYSMDCTMAPIPCMYCEFGCREKMQRHNLAGHLQDF 267          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.194e-17
Identity = 64/216 (29.63%), Postives = 118/216 (54.63%), Query Frame = 2
Query:  152 CTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKC----RKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDR-MCSNWSGECPYQCSSTFHNSLKLHFSECLLVELPCP--IYNCGRMFKRVDYYDHV--TNFDH 772
            C +CQ +L +  +TDCGCR C+ C+  ++  + E++C      CRS++   +     D  +N+E+S +K+KCL EGCV    + +++ H++ FC + N  CS CG E  + E+  HL+N+C ++  LC +C+    L   + ++ +HL    R +C  +   CPY C+     +L  H   C    L CP  +++C ++  +    +H+  ++++H
Sbjct:   31 CVMCQDILLDAIQTDCGCRYCKECIDNYLE-NGEKECVAEYEDCRSVITSYI----YDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLD-FCEYRNEMCSLCGMEYIIKEESNHLANECLLREVLCQYCRT---LLTFKEYNESHLCFESRDLCGKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHVFDCKQLIPKDQMTEHLNTSSYEH 237          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1D122 (TRAF-5 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.294e-17
Identity = 58/190 (30.53%), Postives = 96/190 (50.53%), Query Frame = 2
Query:  152 CTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKLHFSECLLVELPCPIYNCG 721
            C IC+Q++  P+++ CGCR C +C+ +FI+  K RKC  C    ++ V +I RD    +E+ +++++C  EGC   +       H    C +   +C  CG+E     KE+H   +C   +  C  C        L+N H N+    + +C  W  +CPYQC+   + ++K H S C     PCP+ + G
Sbjct:   22 CGICKQIMFEPTQSQCGCRFCSKCIEEFISKEK-RKCPICTDQNIEKVSLI-RDKAIEKEIMRMRVQCPQEGCGENIMYREWGGH-ERACVYGVNECEKCGEEYVRSRKEDHEREECGESVVKCDDCGKEMRREDLKNVHKNYDGDEESLCEKWMCKCPYQCTEEQYVNMKEHASSCRERCTPCPLKDIG 208          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG60 (TNF receptor-associated factor-2-like protein B OS=Dugesia japonica OX=6161 GN=TRAF-2B PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.910e-16
Identity = 66/204 (32.35%), Postives = 100/204 (49.02%), Query Frame = 2
Query:  152 CTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHIN-HLNITDRMCSNWSGECPYQCSSTFHNSLKLHFSECLLVELPCPI--YNCGRMFKRVDYYDH 754
            C IC QLL    +TDCGCR C+ CL ++ A  K     KC +    ++  I+ DN  NRE+ K+ +KCL  GC     + ++  H++  C      C  C +E+  +E +EH   +CPM+L  CTHC        L   H+N H   T+++C+   G+CPY+C +    +L  H   C    + C      C R+  + D   H
Sbjct:   30 CIICSQLLLEALQTDCGCRYCKECLKEYQAKGK----TKCLTDGCGDLGNIIPDNAVNREIGKLTVKCLFPGCEHSELLKDIGDHLDS-CIHQTINCKSCNEELTKIELKEHTEKKCPMRLVSCTHCGEEMEYSNLTELHLNVH---TEKLCAKLVGKCPYKCDNGKEVNLLDHRKSCSKKPVTCLFSEIGCNRVMTKEDLIKH 225          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1I8J887 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 8.482e-14
Identity = 68/258 (26.36%), Postives = 109/258 (42.25%), Query Frame = 2
Query:   56 YKSLSDLLERTKMNKLELTQQVLG----SEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKC----RKC--RSLMLDNVDI------ILRDNESNREMSKIKMKCLN--EGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNI-TDRMCSNWSGECPYQCSSTF----HNSLKLHFSECLLVELPCPIYN--CGRMFKRVDYYDH 754
            +K  SDL  R+ +   EL   V      S+ P    C+ C + L N  +T  GCR CQ C+   +   ++R C      C  R    D V+I         D  + RE++K++++C N   GC   L  + +  H+ + C W +++C  C + +   + + H S++C  + E C  C     L        +H N+ +D  C  +S  CP+ CS             H SEC    + C   +  C  M +R D   H
Sbjct: 1715 FKPRSDLNCRSSLRMSELPSSVSAARPVSDLPAHLQCSSCSKPLFNARQTPHGCRLCQACVTGLLHEVEKRPCPGHTEACTLRGEGDDGVEIEVSQATCFPDMATRREVAKLRVRCPNCDAGCSVQLEWARMDQHVQQSCDWHSFRCEQCKELILKKDMQRHTSSECRHRKETCDLCSQ---LVTHSEMETSHRNLQSDVCCPRFSARCPH-CSERSTPMDRRGYVAHLSECPERPVECKYSHLGCRAMVRRSDLERH 1968          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A1I8G6V3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.629e-13
Identity = 68/258 (26.36%), Postives = 108/258 (41.86%), Query Frame = 2
Query:   56 YKSLSDLLERTKMNKLELTQQVLG----SEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKC----RKC--RSLMLDNVDI------ILRDNESNREMSKIKMKCLN--EGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNI-TDRMCSNWSGECPYQCSSTF----HNSLKLHFSECLLVELPCPIYN--CGRMFKRVDYYDH 754
            +K  SDL  R+ +   EL   V      S+ P    C+ C + L N  +T  GCR CQ C+   +   ++R C      C  R    D V+I         D  + RE++K++++C N   GC   L  + +  H+ + C W + +C  C + +   + + H S++C  + E C  C     L        +H N+ +D  C  +S  CP+ CS             H SEC    + C   +  C  M +R D   H
Sbjct: 1616 FKPRSDLNCRSSLRMSELPSSVSAARPVSDLPAHLQCSSCSKPLFNARQTPHGCRLCQACVTGLLHEVEKRPCPGHTEACTLRGEGDDGVEIEVSQATCFPDMATRREVAKLRVRCPNCDAGCSVQLEWARMDQHVQQSCDWHSLRCEQCKELILKKDMQRHTSSECRHRKETCDLCSQ---LVTHSEMETSHRNLQSDVCCPRFSARCPH-CSERSTPMDRRGYVAHLSECPERPVECKYSHLGCRAMVRRSDLERH 1869          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 56.6102 bits (135), Expect = 8.473e-9
Identity = 44/180 (24.44%), Postives = 78/180 (43.33%), Query Frame = 2
Query:   95 NKLELTQQVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKC-RSLMLDNVDIILR------DNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNW 613
            NK    +++L ++      C ICQ++L  P +  CG R C  C  K ++ S  +KC  C +  + +    IL+      DN + RE+  ++  C+NEGC     +    +     C +    C  C + ++  E E H   +CP +   C +C+          FH  ++   D +C  +
Sbjct:   15 NKPGFPRKILANKLEDKHLCNICQKILRRPFQAQCGHRFCSYCFNKTVS-SGPQKCSACIKEDIFEEPTSILKQGCAFPDNAAKREVEALEAVCINEGCSWTGTIKEYEATHEGQCDFMIIPCPSCKELLRANELERHNERECPERTLNCKYCKE--------PFHFKNIKAHDEICPKY 185          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 52.373 bits (124), Expect = 1.717e-7
Identity = 37/141 (26.24%), Postives = 65/141 (46.10%), Query Frame = 2
Query:  137 PPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCR--------SLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCS-DCGXXXXXXXXXXXXSNQCPMKLELCTHC 532
            P  F C+ C  +L    +T CG R C+ C++  +  +K+  C KC+        S M+  +D    DN  N+E+ ++++ C+N+GC     + +   H ++ C ++   C+  CG  +       HL   CP     C  C
Sbjct:   24 PVHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQ-CEYALIPCNIGCGLMVLRKTLATHLEKGCPNNKTTCQVC 163          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 51.9878 bits (123), Expect = 2.426e-7
Identity = 37/141 (26.24%), Postives = 65/141 (46.10%), Query Frame = 2
Query:  137 PPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCR--------SLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCS-DCGXXXXXXXXXXXXSNQCPMKLELCTHC 532
            P  F C+ C  +L    +T CG R C+ C++  +  +K+  C KC+        S M+  +D    DN  N+E+ ++++ C+N+GC     + +   H ++ C ++   C+  CG  +       HL   CP     C  C
Sbjct:   24 PVHFLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQ-CEYALIPCNIGCGLMVLRKTLATHLEKGCPNNKTTCQVC 163          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO45915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA4])

HSP 1 Score: 58.5362 bits (140), Expect = 5.482e-10
Identity = 57/204 (27.94%), Postives = 93/204 (45.59%), Query Frame = 2
Query:  143 SFFCTICQQLLENPSK-TDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCL--NEGCVCVLRMSNLRSHMNEFCSWSNYQC-SDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSST--FHNSLKLHFS-ECLLVELPCPIYNCGRMFK 733
            SF C +C   L +P + T CG R CQ C+   I   + R+ R     +  NV  I  DN  +R++  + + C    +GC     +S+L  H+   C+ S  +C  DCG  ++  + E H   +C  +L  CTHC         +      +N+  + C+++   CP  C +      +L +H + EC L+ +PC     G  FK
Sbjct:   15 SFECPVCLMALRDPVQVTPCGHRVCQTCIKPII---RNRRPRCPLDNLTLNVGKIFPDNACHRQILSMDILCPHHGDGCEWQGTISDLEKHLERGCNLSEVRCPKDCGASVERGKLEGHYP-ECSRRLVNCTHCN--------KEVVFADMNVHLQSCASFPISCPLTCGAKDLTKEALAVHLNQECPLLVIPCRFAEAGCTFK 206          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 56.225 bits (134), Expect = 3.891e-9
Identity = 59/220 (26.82%), Postives = 95/220 (43.18%), Query Frame = 2
Query:   80 ERTKMNKLELTQQVLGSEY---PP----SFFCTICQQLLENPSK-TDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNE--GCVCVLRMSNLRSHMNEFCSWSNYQCS-DCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKLHFSECLLVELPCP 706
            +  KM ++E  ++ L   Y   PP       C +C+ +  +P +  +CG R CQ C  K I  S E KC KC   + D +  +  D     +M+++  +C+N   GC   +  + + +H  E C +S+  C  DCG + +   K++HL   CP K+  C +C +    R LR                               + K H  +CLL+ LPCP
Sbjct:   24 DEDKMPEIEKVERPLTKNYFKKPPFEERKHLCPVCEDIFVSPVQIKECGHRLCQHCY-KTIWRSPEPKCPKCSGDLDDKIPDV--DQAFENDMNELPCRCINHEWGCKVEVPFTQMITHKGE-CEYSDILCDNDCGAKFQRRFKQKHLDKDCPKKIISCPYCDD----RHLR------------------------------ENKKEHLEDCLLIPLPCP 205          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO46837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP22])

HSP 1 Score: 46.2098 bits (108), Expect = 1.305e-6
Identity = 31/103 (30.10%), Postives = 49/103 (47.57%), Query Frame = 2
Query:  143 SFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDC 451
            +  C IC  +LEN   T CG   C+ CL  +++  + + C  CRS +L    I +       +   +  +  + GC  V RM N++SH+ E C +   QC  C
Sbjct:   15 NLLCNICVGVLENAITTICGHSFCESCLETWLSRPEVQSCPSCRSHVLSLDLIPVHAIRGLVDGLLVHCENADNGCDIVTRMDNMKSHL-ESCPYGLVQCKAC 116          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 48.1358 bits (113), Expect = 4.114e-6
Identity = 48/234 (20.51%), Postives = 85/234 (36.32%), Query Frame = 2
Query:  119 VLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRS-------LMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKL-----HFSECLLVELPCPIYNCG----RMFKRVDYYDHVTNFDH 772
            VL       + C  C Q+L  P +  CG R C  C  +  + S  + C+ CR        + + N      DN + RE++ +  +CLN+GC     +    +     C +   QC  C   +   +K+ H   +C  +   C +C+          F+   +   D +C  +    P QC       +       H   C   +  CP    G        ++  ++H +  +H
Sbjct:   19 VLSVPMEDKYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTS-SGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKV--------TFNFKDIKAHDEICQKF----PLQCKDCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEH 239          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 48.1358 bits (113), Expect = 4.568e-6
Identity = 48/234 (20.51%), Postives = 85/234 (36.32%), Query Frame = 2
Query:  119 VLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRS-------LMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKL-----HFSECLLVELPCPIYNCG----RMFKRVDYYDHVTNFDH 772
            VL       + C  C Q+L  P +  CG R C  C  +  + S  + C+ CR        + + N      DN + RE++ +  +CLN+GC     +    +     C +   QC  C   +   +K+ H   +C  +   C +C+          F+   +   D +C  +    P QC       +       H   C   +  CP    G        ++  ++H +  +H
Sbjct:   26 VLSVPMEDKYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTS-SGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKV--------TFNFKDIKAHDEICQKF----PLQCKDCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEH 246          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025867.1 (SMESG000025867.1)

HSP 1 Score: 435.647 bits (1119), Expect = 6.605e-157
Identity = 226/227 (99.56%), Postives = 226/227 (99.56%), Query Frame = 2
Query:   92 MNKLELTQQVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKLHFSECLLVELPCPIYNCGRMFKRVDYYDHVTNFDH 772
            MNKLELTQQVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGKEMKLLEKEEHLSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKLHFSEC LVELPCPIYNCGRMFKRVDYYDHVTNFDH
Sbjct:    1 MNKLELTQQVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGKEMKLLEKEEHLSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKLHFSECPLVELPCPIYNCGRMFKRVDYYDHVTNFDH 227          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000018435.1 (SMESG000018435.1)

HSP 1 Score: 94.7449 bits (234), Expect = 6.900e-22
Identity = 66/211 (31.28%), Postives = 109/211 (51.66%), Query Frame = 2
Query:  140 PSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHIN-HLNITDRMCSNWSGECPYQCSSTFHNSLKLHFSECLLVELPCPIYNCGRMF--KRVDYYDHVTN 763
            P F C+ C ++L +PS+T CGCR C  C+ K  A S E  C  C++ + +    I++D   +RE+S ++++CL  GC  + +   L  H+   C W    C  C +      KE HL  +C   +  C+ C         + FH+N ++   D++C N SG+CPY+C+S  HN+++ H  +C      C +Y  G  F   +VD   H+++
Sbjct:   30 PRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFA-SCENICPNCQTEIPNE---IIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHL-RMCKWRLENCDKCPQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVNINVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCQFVGNQVDMSKHLSD 235          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000039087.1 (SMESG000039087.1)

HSP 1 Score: 94.3597 bits (233), Expect = 7.531e-22
Identity = 73/240 (30.42%), Postives = 111/240 (46.25%), Query Frame = 2
Query:   53 PYKSLSDLLERTKMNKLELTQQVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKE--RKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDR-MCSNWSGECPYQCSSTFHNSLKLHFSECLLVELPCPI--YNCGRMFKRVDYYDHV 757
            P++SL+  L        E   Q L  + P ++FC IC+ +L +P +T CGCR C+ C+VK ++ S         CR+ +L+    I  D  ++R +  +K+KC  + C  +  + N+ SH NE C +   +C  C K+        H   +C  + E+C  C   FPL IL    + H NI  R +C  +   CPY+C      SL  H   C      CP     C  +F  VD   H+
Sbjct:   22 PFQSLNSKLYNCHPEVTEQGFQFL-KKVPSAYFCVICKNVLTDPVQTSCGCRYCRSCIVKHLSFSSYCCNDSEDCRNELLELETNIRTDAAASRFIKALKVKCTTKDCEYITTLENINSHRNE-CLFVIVECDQCSKKFTRNYLLTHKKIECEKRKEICQFCGISFPLEILP---LIHNNIHHRDLCVKYLSLCPYKCGMKEEISLVEHRKICFSKPFLCPYIEVGCDYLFFTVDLNKHM 256          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000018409.1 (SMESG000018409.1)

HSP 1 Score: 92.0485 bits (227), Expect = 5.274e-21
Identity = 66/212 (31.13%), Postives = 110/212 (51.89%), Query Frame = 2
Query:  140 PSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNI--TDRMCSNWSGECPYQCSSTFHNSLKLHFSECLLVELPCPIYNCGRMF--KRVDYYDHVTN 763
            P F C+ C ++L +PS+T CGCR C  C+ K  A S    C  C++ + +    I++D   +RE+S ++++CL  GC  + +   L  H+ + C W    C  C +      KE HL  +C   +  C+ C         + FH+N +N+   D++C N SG+CPY+C+S  HN+++ H  +C      C +Y  G  F   +VD   H+++
Sbjct:   28 PRFVCSKCHEILIDPSQTQCGCRFCYSCINKHFA-SCGNICPNCQTEIPNE---IIKDRAIDREISNLEIRCLLNGCDHIGQFKYLDDHL-KMCKWRLENCDKCHQTYPKQMKEIHLQEECVNGICKCSKCGLEMTRHEYQTFHVN-INVECIDKLCENLSGKCPYECNSEIHNNIRNHLYDCPNKVTKCFLYELGCRFVGNQVDMSKHLSD 233          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000027149.1 (SMESG000027149.1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.056e-18
Identity = 56/204 (27.45%), Postives = 105/204 (51.47%), Query Frame = 2
Query:  128 SEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIAISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMSNLRSHMNEFCSWSNYQCSDCGXXXXXXXXXXXXSNQCPMKLELCTHCQNYFPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKLHFSECLLVELPCPI--YNCGRMFK 733
            +  P    C +C ++L N  +T+CGCR C +C+ +++A S  RKC  C + +L N + +  D  + RE++++++ C  + C    ++ ++  HMN  C +    C  C +++  + +++H  N C M++  C +CQ    L  +   H+N  N  + MC ++   CP  C+     ++K H  EC+  +  CP    NC  + K
Sbjct:    7 TNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLA-SGSRKCPSCDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHMNS-CEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDN--EEMCDDYVSICPNNCNQKQQINIKRHLLECINKKKKCPFNQINCNTIDK 206          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF35.017e-925.74TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF35.017e-925.74TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.183e-626.04TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.183e-626.04TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.305e-626.57TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf51.880e-727.54Tnf receptor-associated factor 5 [Source:ZFIN;Acc:... [more]
traf2b2.458e-723.33Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b3.031e-723.33Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b3.031e-723.33Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2a3.743e-723.33Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
egf1.381e-1025.00epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
ssh23.140e-827.45slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh23.707e-627.49slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf33.600e-1026.24TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.043e-726.63TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.043e-726.63TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf28.858e-727.16TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf25.685e-626.19TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28DL4|TRAF6_XENTR1.141e-925.00TNF receptor-associated factor 6 OS=Xenopus tropic... [more]
sp|Q60803|TRAF3_MOUSE2.518e-926.24TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q6DJN2|TRF6B_XENLA9.516e-923.61TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q13114|TRAF3_HUMAN2.409e-825.74TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q3MV19|TRF6A_XENLA4.168e-622.69TNF receptor-associated factor 6-A OS=Xenopus laev... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1DBK61.194e-1729.63TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1D1222.294e-1730.53TRAF-5 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
D5JG601.910e-1632.35TNF receptor-associated factor-2-like protein B OS... [more]
A0A1I8J8878.482e-1426.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G6V32.629e-1326.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
traf2a8.473e-924.44TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf11.717e-726.24TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf12.426e-726.24TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO459155.482e-1027.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328493.891e-926.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468371.305e-630.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
traf2b4.114e-620.51TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b4.568e-620.51TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025867.16.605e-15799.56SMESG000025867.1[more]
SMESG000018435.16.900e-2231.28SMESG000018435.1[more]
SMESG000039087.17.531e-2230.42SMESG000039087.1[more]
SMESG000018409.15.274e-2131.13SMESG000018409.1[more]
SMESG000027149.12.056e-1827.45SMESG000027149.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012745 ID=SMED30012745|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=784bp
AAATAAATGAGCAAATTTAGTTACAAATAAAACACTATATAAATGTAGCT
AGCCTTACAAATCATTATCTGATTTACTTGAAAGAACAAAAATGAATAAG
CTAGAATTGACTCAACAAGTACTGGGAAGTGAATATCCACCTTCGTTTTT
CTGCACAATCTGTCAACAACTGCTGGAAAACCCATCGAAAACTGACTGCG
GTTGCAGAACCTGTCAGAGATGTCTGGTAAAGTTCATTGCAATTTCAAAA
GAAAGGAAATGCCGAAAATGTAGATCGTTGATGCTGGACAATGTGGACAT
CATATTACGAGACAACGAATCCAATCGGGAAATGTCAAAGATCAAAATGA
AATGCCTAAATGAAGGTTGCGTTTGTGTTTTGAGAATGTCAAATTTACGA
AGCCATATGAATGAATTCTGTTCTTGGTCAAATTATCAATGCTCGGACTG
TGGTAAAGAAATGAAGTTATTGGAGAAGGAGGAACATTTATCTAATCAGT
GTCCAATGAAACTGGAACTGTGTACTCACTGTCAAAATTATTTTCCATTG
CGGATATTGAGAAATTTCCACATAAATCATTTAAATATTACTGATAGAAT
GTGCTCTAATTGGTCTGGCGAGTGCCCCTATCAATGTTCTTCAACCTTTC
ACAATTCGTTGAAACTCCACTTTTCAGAATGCCTCTTGGTTGAATTACCT
TGTCCAATATATAATTGTGGTCGAATGTTTAAACGGGTGGATTACTATGA
CCATGTAACGAACTTTGATCATTGATATACAAAT
back to top

protein sequence of SMED30012745-orf-1

>SMED30012745-orf-1 ID=SMED30012745-orf-1|Name=SMED30012745-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=228bp
MNKLELTQQVLGSEYPPSFFCTICQQLLENPSKTDCGCRTCQRCLVKFIA
ISKERKCRKCRSLMLDNVDIILRDNESNREMSKIKMKCLNEGCVCVLRMS
NLRSHMNEFCSWSNYQCSDCGKEMKLLEKEEHLSNQCPMKLELCTHCQNY
FPLRILRNFHINHLNITDRMCSNWSGECPYQCSSTFHNSLKLHFSECLLV
ELPCPIYNCGRMFKRVDYYDHVTNFDH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0042981regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 1..122
e-value: 5.7E-14
score: 54.1
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 16..224
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 13..64
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 16..224
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 21..61
score: 9.627