BHLH domain-containing protein

Overview
NameBHLH domain-containing protein
Smed IDSMED30012743
Length (bp)793
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BHLH domain-containing protein (SMED30012743) t-SNE clustered cells

Violin plots show distribution of expression levels for BHLH domain-containing protein (SMED30012743) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BHLH domain-containing protein (SMED30012743) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BHLH domain-containing protein (SMED30012743) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012743

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012743SMESG000052476.1 SmedASXL_000335SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30012743SMESG000052476.1 dd_Smed_v4_12011_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012743SMESG000052476.1 dd_Smed_v4_12011_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012743SMESG000052476.1 dd_Smed_v6_12011_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30012743SMESG000052476.1 dd_Smed_v4_12011_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BHLH domain-containing protein vs. Ensembl Human
Match: CCDC169 (coiled-coil domain containing 169 [Source:HGNC Symbol;Acc:HGNC:34361])

HSP 1 Score: 64.6994 bits (156), Expect = 6.121e-12
Identity = 57/216 (26.39%), Postives = 105/216 (48.61%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELA-AAQLNMIELKIKNQKEMDAQQMVXXXXXXXXXXXXPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSI 711
            RL   +  E   +D ++ S  E+R+ ++++E ++ N ++E +EWKTRY+ Q E+ND+  KQI+ L++K+        +   S+R   +      E  +  ++ LE EK+ L +Q K    +++QE+KAY K   +R+    E++  + L+ +       K     Q+   +  +  T          R  P  Q+ +  K GP+KK      LP +
Sbjct:   16 RLKQQLLEEVRKKDAVQLSIFELRHKITELEAKL-NTDNEGSEWKTRYETQLELNDELEKQIVYLKEKVEKIHGNSSDRLSSIR---VYERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGLHQV------SKRQQVDQLPRMQENLVKTG---------RYNPAKQKTVSAKRGPVKKITRPNHLPEL 212          
BLAST of BHLH domain-containing protein vs. Ensembl Human
Match: CCDC169 (coiled-coil domain containing 169 [Source:HGNC Symbol;Acc:HGNC:34361])

HSP 1 Score: 61.6178 bits (148), Expect = 1.103e-10
Identity = 43/146 (29.45%), Postives = 81/146 (55.48%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAA 504
            RL   +  E   +D ++ S  E+R+ ++++E ++ N ++E +EWKTRY+ Q E+ND+  KQI+ L++K+        +   S+R   +      E  +  ++ LE EK+ L +Q K    +++QE+KAY K   +R+    E++  
Sbjct:   16 RLKQQLLEEVRKKDAVQLSIFELRHKITELEAKL-NTDNEGSEWKTRYETQLELNDELEKQIVYLKEKVEKIHGNSSDRLSSIR---VYERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQG 157          
BLAST of BHLH domain-containing protein vs. Ensembl Zebrafish
Match: ccdc169 (coiled-coil domain containing 169 [Source:ZFIN;Acc:ZDB-GENE-091204-29])

HSP 1 Score: 97.8265 bits (242), Expect = 2.861e-24
Identity = 54/152 (35.53%), Postives = 95/152 (62.50%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELA--AAQLNM 516
            RL+A +EHER  ++M++ S S++RN L+D+E+++ ++E+E NEW+TRY+ Q E+N+Q  KQI +++++L + ++   +   S+R+     +   +     ++LL  EK  L  Q  D   RI QE KAY K  E+R+    E+A  ++ LN+
Sbjct:   13 RLHAEVEHEREVKEMLQDSVSDLRNTLADLERRLHSVEEEENEWRTRYETQLELNEQLEKQISVVRERLQTLRSDPSDRLASIRSYE---EMSEDALRQRLKLLSSEKSGLQAQLMDFRMRIVQEGKAYQKVYEERRAYLAEIAKLSSTLNL 161          
BLAST of BHLH domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000001146.1 (coiled-coil domain containing 169 [Source:NCBI gene;Acc:100497065])

HSP 1 Score: 83.1889 bits (204), Expect = 1.312e-18
Identity = 48/136 (35.29%), Postives = 86/136 (63.24%), Query Frame = 1
Query:   70 LNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRK 477
            L   I+ E+  ++M++ ST E++N ++++E+++ ++EDE NEWKTRY+ Q E+N Q  +QI +L++K  + +    +   S+R+   Q   G    +  ++ L+ EK  + NQ KD + RI+QEAKAY+K   +R+
Sbjct:   18 LTEDIQLEKKMKEMLQISTFELKNTIAELERRLNSVEDEGNEWKTRYETQVELNKQLERQIYILREKSENIRGNPTDRLSSIRSFD-QMPLGA--LNQFLKHLDDEKILMENQLKDFELRIEQEAKAYYKVNNERR 150          
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Match: Ccdc169 (coiled-coil domain containing 169 [Source:MGI Symbol;Acc:MGI:2444356])

HSP 1 Score: 77.0258 bits (188), Expect = 1.746e-16
Identity = 61/215 (28.37%), Postives = 115/215 (53.49%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELKIKNQKEMDAQQMVXXXXXXXXXXXXPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSI 711
            RL   +  E + +D+++ ST EIR+ ++++E  + N +   +EWKTRY+ Q E+NDQ  KQI+ L++K+   +    +   S+R   +      E  +  ++ LE+EK +L +Q K+  +R++QE+KAYH+   +R++   E+     +    ++  +++MD          +   + SP +T   R+   NQ+  + K GP+KK      LP +
Sbjct:   16 RLKLELLEEIHMKDVVQLSTLEIRHKIAELEANL-NGDLAGSEWKTRYETQLELNDQLEKQIVSLKEKMEKMRGNPSDRLSSIR---VYEKMPVESLNVLLKQLEKEKRSLESQVKEYAFRLEQESKAYHRTNNERRSYIAEMTQVSGSN---QVSKRQQMDP---------LPRMKESPVKTG--RHNSMNQKTTNAKKGPVKKVPRSNHLPKL 212          
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Match: Ccdc169 (coiled-coil domain containing 169 [Source:MGI Symbol;Acc:MGI:2444356])

HSP 1 Score: 71.633 bits (174), Expect = 1.222e-14
Identity = 46/144 (31.94%), Postives = 86/144 (59.72%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELA 498
            RL   +  E + +D+++ ST EIR+ ++++E  + N +   +EWKTRY+ Q E+NDQ  KQI+ L++K+   +    +   S+R   +      E  +  ++ LE+EK +L +Q K+  +R++QE+KAYH+   +R++   E+ 
Sbjct:   16 RLKLELLEEIHMKDVVQLSTLEIRHKIAELEANL-NGDLAGSEWKTRYETQLELNDQLEKQIVSLKEKMEKMRGNPSDRLSSIR---VYEKMPVESLNVLLKQLEKEKRSLESQVKEYAFRLEQESKAYHRTNNERRSYIAEMT 155          
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3KPT0|CC169_XENLA (Coiled-coil domain-containing protein 169 OS=Xenopus laevis OX=8355 GN=ccdc169 PE=2 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 2.093e-19
Identity = 53/144 (36.81%), Postives = 91/144 (63.19%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELA 498
            RL   I+ E+N ++M++ ST E++N ++++E+++ ++EDE NEWKTRY+ Q E+N Q  +QI +L++K  + +    +   S+R+   Q   G    +  V+ L+ EK  L NQ K+ + RI+QEAKAY+K   +R+    E+A
Sbjct:   17 RLTEEIQLEKNKKEMLQMSTFELKNTIAELEQRLNSVEDEGNEWKTRYETQIELNKQLERQIYILREKSENIRGNPTDRLSSIRS-LDQMPVGA--LNQFVKHLDDEKILLENQLKNFELRIEQEAKAYYKVNNERRMYISEIA 157          
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BXX9|CC169_MOUSE (Coiled-coil domain-containing protein 169 OS=Mus musculus OX=10090 GN=Ccdc169 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 1.222e-15
Identity = 61/215 (28.37%), Postives = 115/215 (53.49%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELKIKNQKEMDAQQMVXXXXXXXXXXXXPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSI 711
            RL   +  E + +D+++ ST EIR+ ++++E  + N +   +EWKTRY+ Q E+NDQ  KQI+ L++K+   +    +   S+R   +      E  +  ++ LE+EK +L +Q K+  +R++QE+KAYH+   +R++   E+     +    ++  +++MD          +   + SP +T   R+   NQ+  + K GP+KK      LP +
Sbjct:   16 RLKLELLEEIHMKDVVQLSTLEIRHKIAELEANL-NGDLAGSEWKTRYETQLELNDQLEKQIVSLKEKMEKMRGNPSDRLSSIR---VYEKMPVESLNVLLKQLEKEKRSLESQVKEYAFRLEQESKAYHRTNNERRSYIAEMTQVSGSN---QVSKRQQMDP---------LPRMKESPVKTG--RHNSMNQKTTNAKKGPVKKVPRSNHLPKL 212          
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Match: sp|A6NNP5|CC169_HUMAN (Coiled-coil domain-containing protein 169 OS=Homo sapiens OX=9606 GN=CCDC169 PE=2 SV=4)

HSP 1 Score: 64.6994 bits (156), Expect = 2.940e-11
Identity = 57/216 (26.39%), Postives = 105/216 (48.61%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELA-AAQLNMIELKIKNQKEMDAQQMVXXXXXXXXXXXXPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSI 711
            RL   +  E   +D ++ S  E+R+ ++++E ++ N ++E +EWKTRY+ Q E+ND+  KQI+ L++K+        +   S+R   +      E  +  ++ LE EK+ L +Q K    +++QE+KAY K   +R+    E++  + L+ +       K     Q+   +  +  T          R  P  Q+ +  K GP+KK      LP +
Sbjct:   16 RLKQQLLEEVRKKDAVQLSIFELRHKITELEAKL-NTDNEGSEWKTRYETQLELNDELEKQIVYLKEKVEKIHGNSSDRLSSIR---VYERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGLHQV------SKRQQVDQLPRMQENLVKTG---------RYNPAKQKTVSAKRGPVKKITRPNHLPEL 212          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A1I8HTG9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008072g1 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 8.255e-59
Identity = 101/215 (46.98%), Postives = 149/215 (69.30%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELKIKNQKEMDAQQMVXXXXXXXXXXXXPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSI 711
            RL A +  E   ++M+E+S +E+   ++++EK+   IEDESNEWKTR++IQ EIN+Q  KQI++LQ+K++ +    K++Q+ V++NT+  +FG   T + ++LL++EK  LINQRKDIDWR+DQEAKAYHKA E+RKN Q E+     N+ +++  N   +       +       R SPKR+IG RNIP +QR+ID + GPIKKTAA+K LPS+
Sbjct:   11 RLRATLMQETQMKEMVEESCNELAVTVAELEKRYEGIEDESNEWKTRFEIQQEINEQLRKQIVILQEKVMQASKTTKDIQRIVKSNTITTEFGS-ATPNMIKLLQKEKTGLINQRKDIDWRVDQEAKAYHKANEERKNIQEEINQINANLGDIRKSNA--LTTGGEGGAGGRPKSPRGSPKRSIGQRNIPPDQRVIDPRKGPIKKTAAVKQLPSL 222          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A1I8FUN8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 2.097e-58
Identity = 101/215 (46.98%), Postives = 149/215 (69.30%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELKIKNQKEMDAQQMVXXXXXXXXXXXXPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSI 711
            RL A +  E   ++M+E+S +E+   ++++EK+   IEDESNEWKTR++IQ EIN+Q  KQI++LQ+K++ +    K++Q+ V++NT+  +FG   T + ++LL++EK  LINQRKDIDWR+DQEAKAYHKA E+RKN Q E+     N+ +++  N   +       +       R SPKR+IG RNIP +QR+ID + GPIKKTAA+K LPS+
Sbjct:   59 RLRATLMQETQMKEMVEESCNELAVTVAELEKRYEGIEDESNEWKTRFEIQQEINEQLRKQIVILQEKVMQASKTTKDIQRIVKSNTITTEFGS-ATPNMIKLLQKEKTGLINQRKDIDWRVDQEAKAYHKANEERKNIQEEINQINANLGDIRKSN--ALTTGGEGGAGGRPKSPRGSPKRSIGQRNIPPDQRVIDPRKGPIKKTAAVKQLPSL 270          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A1I8F213 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.595e-51
Identity = 95/215 (44.19%), Postives = 142/215 (66.05%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELKIKNQKEMDAQQMVXXXXXXXXXXXXPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSI 711
            RL A +  E   ++M+E+S +E+   ++++EK+   IEDESNEWKTR++IQ EIN+Q  KQI++LQ+K++ +    K++Q+ V++NT+  +FG   T + ++LL++EK  LINQRKDIDWR+DQEAK    A    KN Q E+     N+ +++  N   +       +       R SPKR+IG RNIP +QR+ID + GPIKKTAA+K LPS+
Sbjct:   11 RLRATLMQETQMKEMVEESCNELAVTVAELEKRYEGIEDESNEWKTRFEIQQEINEQLRKQIVILQEKVMQASKTTKDIQRIVKSNTITTEFGS-ATPNMIKLLQKEKTGLINQRKDIDWRVDQEAKPTRSA----KNIQEEINQINANLGDIRKSNA--LTTGGEGGAGGRPKSPRGSPKRSIGQRNIPPDQRVIDPRKGPIKKTAAVKQLPSL 218          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A210QE62 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12520 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 6.469e-46
Identity = 91/216 (42.13%), Postives = 138/216 (63.89%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIEL-AAAQLNMIELKIKNQKEMDAQQMVXXXXXXXXXXXXPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSI 711
            ++ A I+ E+  ++M+EQS+SE+R  + ++EK+   + DE NEWKTR + Q E+NDQ +KQI +LQ K+  +K+ LK+  KS + +    D   + T H VR+LE+EK  L NQ +DI+WR+DQE+KAYHKA E+RK    E+ AAA  N + +  +  + +   +                R +G RNIP++QRI+D K GPI+KTAA+K+LPS+
Sbjct:   13 KIRAEIKQEKQMKEMLEQSSSELRYTIEELEKRYDGVVDEGNEWKTRCETQQEMNDQLDKQIFMLQSKVQEAKSNLKDAGKSTK-DMKNFDDLSDATPHMVRMLEKEKNMLHNQMRDIEWRLDQESKAYHKAHEERKTYSTEIHAAATRNRLPITHRELEPIPGSRT--------------PRDMG-RNIPEDQRILDPKRGPIRKTAAVKSLPSL 212          
BLAST of BHLH domain-containing protein vs. TrEMBL
Match: A0A3S1A857 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_007214 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.051e-44
Identity = 85/218 (38.99%), Postives = 141/218 (64.68%), Query Frame = 1
Query:   70 LNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELKIKNQKEM----DAQQMVXXXXXXXXXXXXPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSI 711
            L A ++ E+  ++M++QS++E++  + ++EK+  +IE+E NEWKTRY+ Q E+N Q  KQIL+LQDK+  ++  LKE              G   +   V++LEREK +L +Q +D++WR+DQE+KAYHKA ++RK   +E+ A + N+ ++K + +  M    D+Q  + +R     +  + +   G  NIP++QRI+D ++GPIKKTA +KALPS+
Sbjct:   14 LRAELQQEKQMKEMLDQSSAELKATIEELEKRYDSIENEGNEWKTRYETQTEMNQQLEKQILMLQDKVEDARRNLKE--------------GKPASPQMVKMLEREKHSLFSQLRDLEWRLDQESKAYHKANDERKQYVLEINATKGNVGDIKARQRHMMITNQDSQSKILARPNQGDSPKTYRSPDG--NIPEDQRILDARYGPIKKTAGVKALPSL 215          
BLAST of BHLH domain-containing protein vs. Ensembl Cavefish
Match: ccdc169 (coiled-coil domain-containing protein 169-like [Source:NCBI gene;Acc:111195093])

HSP 1 Score: 92.4337 bits (228), Expect = 2.113e-22
Identity = 55/148 (37.16%), Postives = 86/148 (58.11%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVR----LLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELA 498
            RL A +E ER  ++M+  S S++R+ L+D+E+++ ++E E NEW+TRY+ Q E+N Q  +QI ++Q+KL        +   S+R+         E+T   +R    LL  EK  L NQ  +   RIDQE KAY KA ++R+    E+A
Sbjct:   13 RLQAELEQEREVKEMLVGSVSDLRSTLTDLEQRLHSVEGEGNEWRTRYETQLELNGQLERQIGVVQEKLEGHSGNPMDRLASIRSYD-------EMTVDALRQRLKLLSTEKTTLQNQLLEYRLRIDQEGKAYQKAYDERRAYLTEIA 153          
BLAST of BHLH domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003020.1 (pep scaffold:Pmarinus_7.0:GL477049:63953:68183:1 gene:ENSPMAG00000002756.1 transcript:ENSPMAT00000003020.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 2.333e-7
Identity = 32/98 (32.65%), Postives = 55/98 (56.12%), Query Frame = 1
Query:  193 EWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLL---EREKENLINQRKDIDWRIDQEAKAYHKACEDRK 477
            EW+TRY+ Q E+N++   Q+  ++ K+   ++ L+E     R N +Q  +  +      +LL   E E+++L     D +WRI QEAKAYHK   +++
Sbjct:    4 EWRTRYETQRELNERLRLQLEEMRTKVKEGRDTLRE-----RMNVMQG-YNQQSKESLKQLLWKKEEERQSLQETLVDYEWRIAQEAKAYHKVINEKR 95          
BLAST of BHLH domain-containing protein vs. Ensembl Nematostella
Match: EDO37982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE60])

HSP 1 Score: 122.094 bits (305), Expect = 2.760e-33
Identity = 79/225 (35.11%), Postives = 127/225 (56.44%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLL---EREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELKIKNQKEM-----DAQQMVXXXXXXXXXXXXPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSIRD 717
            RL A I+ E+  ++M+EQS+ E+   + +++ +     DE NEWKTR++ Q E+N Q  KQI+LL+DKL     Q+K   +  + + L+  + G   +   +L+   ER+K  L  Q +D++WR+D E+KAYHK  E+RK     L      + + K K +  +     ++++ +   S  +  +     + GL   P NQRIID K GPIKKTAA++ LP I+D
Sbjct:   72 RLRAEIQQEKQMKEMLEQSSEELDKTIVELQGKFEIAGDEDNEWKTRFETQHEMNTQLEKQIILLRDKL----EQMKIPSREGKPHPLRT-YNGLTDADVKKLMRQTERDKLQLEGQLRDLEWRLDNESKAYHKISEERKQYFTALNETSAVIDDTKTKRKHALIESQRNSEETLARFSQATMRKIDSNSSFGL---PDNQRIIDPKKGPIKKTAAVRKLPKIQD 288          
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Match: SMESG000052476.1 (SMESG000052476.1)

HSP 1 Score: 415.231 bits (1066), Expect = 8.430e-149
Identity = 217/217 (100.00%), Postives = 217/217 (100.00%), Query Frame = 1
Query:   67 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELKIKNQKEMDAQQMVXXXXXXXXXXXXPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSIRD 717
            RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELKIKNQKEMDAQQMVTSRSTISHTRHSPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSIRD
Sbjct:    9 RLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELKIKNQKEMDAQQMVTSRSTISHTRHSPKRTIGLRNIPQNQRIIDRKFGPIKKTAAIKALPSIRD 225          
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Match: SMESG000019789.1 (SMESG000019789.1)

HSP 1 Score: 152.525 bits (384), Expect = 4.197e-45
Identity = 90/229 (39.30%), Postives = 133/229 (58.08%), Query Frame = 1
Query:   88 HERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIELAAAQLNMIELK-----------------IKNQKEMDAQQMVX--XXXXXXXXXXXPKRT--IGLRNIPQNQRIIDRKFGPIKKTAAIKALPSI 711
             E+  + ++E S SE+   +++ EK++  +  E+NEWKTRYDIQ E NDQ +KQIL++QDK+  SKNQL++VQK++R++       G+I+   ++ L+ E++ L+ Q++D+DWRI QE KA+HKA E RK    E+ +A  N+ ELK                 +  Q      Q V   S          PK +     RNIP +QRIID K GPIKK +A+K LP +
Sbjct:   18 QEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNDQISKQILIIQDKIQQSKNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENKAFHKANEQRKAVTNEILSATENINELKYMTDPGPQSPPRSPKQSVSGQPPTAPVQRVQRLSTVNPMIAARVPKLSTATAFRNIPPDQRIIDPKMGPIKKESAVKNLPPL 246          
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Match: SMESG000019789.1 (SMESG000019789.1)

HSP 1 Score: 105.145 bits (261), Expect = 3.882e-28
Identity = 52/120 (43.33%), Postives = 85/120 (70.83%), Query Frame = 1
Query:   88 HERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESNEWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADFGGEITSHTVRLLEREKENLINQRKDIDWRIDQEAK 447
             E+  + ++E S SE+   +++ EK++  +  E+NEWKTRYDIQ E NDQ +KQIL++QDK+  SKNQL++VQK++R++       G+I+   ++ L+ E++ L+ Q++D+DWRI QE K
Sbjct:   18 QEKQMKALVEDSCSELLATIAEYEKRLDAVNYENNEWKTRYDIQKETNDQISKQILIIQDKIQQSKNQLRDVQKAMRSSVPYESDLGDISMSLIKTLQEERDKLVRQKRDLDWRIIQENK 137          
The following BLAST results are available for this feature:
BLAST of BHLH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC1696.121e-1226.39coiled-coil domain containing 169 [Source:HGNC Sym... [more]
CCDC1691.103e-1029.45coiled-coil domain containing 169 [Source:HGNC Sym... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1692.861e-2435.53coiled-coil domain containing 169 [Source:ZFIN;Acc... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000001146.11.312e-1835.29coiled-coil domain containing 169 [Source:NCBI gen... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ccdc1691.746e-1628.37coiled-coil domain containing 169 [Source:MGI Symb... [more]
Ccdc1691.222e-1431.94coiled-coil domain containing 169 [Source:MGI Symb... [more]
back to top
BLAST of BHLH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q3KPT0|CC169_XENLA2.093e-1936.81Coiled-coil domain-containing protein 169 OS=Xenop... [more]
sp|Q8BXX9|CC169_MOUSE1.222e-1528.37Coiled-coil domain-containing protein 169 OS=Mus m... [more]
sp|A6NNP5|CC169_HUMAN2.940e-1126.39Coiled-coil domain-containing protein 169 OS=Homo ... [more]
back to top
BLAST of BHLH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HTG98.255e-5946.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FUN82.097e-5846.98Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8F2132.595e-5144.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210QE626.469e-4642.13Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A3S1A8571.051e-4438.99Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1692.113e-2237.16coiled-coil domain-containing protein 169-like [So... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003020.12.333e-732.65pep scaffold:Pmarinus_7.0:GL477049:63953:68183:1 g... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO379822.760e-3335.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BHLH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BHLH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000052476.18.430e-149100.00SMESG000052476.1[more]
SMESG000019789.14.197e-4539.30SMESG000019789.1[more]
SMESG000019789.13.882e-2843.33SMESG000019789.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012743 ID=SMED30012743|Name=BHLH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=793bp
CCGATCTCTATAGTATTGCATTTGGCAATAATCTAAATATAAATGTCTGA
ACAAGAAGAAATTGAGCGTCTCAATGCTGCAATAGAGCATGAAAGAAATT
ATAGAGATATGATAGAGCAATCAACATCAGAAATTCGGAATGCACTTAGT
GACATTGAAAAGCAAATGACGAATATTGAAGATGAAAGCAATGAATGGAA
AACAAGATATGATATACAATGTGAAATTAATGACCAGTATAACAAACAAA
TCCTTTTACTCCAAGACAAACTTCTGTCATCTAAAAATCAACTGAAAGAA
GTTCAAAAATCTGTACGAACAAACACTTTACAAGCGGACTTTGGTGGTGA
GATTACCTCCCATACGGTGCGCTTATTGGAACGAGAAAAAGAAAACTTAA
TAAACCAACGAAAGGACATTGACTGGAGAATTGATCAAGAGGCCAAAGCT
TACCATAAAGCCTGTGAAGACCGGAAAAATTGTCAAATTGAATTAGCTGC
TGCTCAGTTGAACATGATAGAGCTCAAGATAAAAAACCAAAAGGAAATGG
ATGCCCAACAAATGGTTACTTCTAGGTCGACAATTTCTCACACTCGGCAT
TCACCTAAACGCACAATCGGATTGAGAAATATTCCCCAGAATCAGAGGAT
TATAGACAGGAAATTTGGACCTATTAAAAAAACTGCTGCAATCAAAGCCT
TACCTTCAATCAGAGATTAATTTTTTTAAACTTTGCACTACAAACCTCAA
ATCTGCTGATTTTATTATTGTTATTATATTTGCTCTTTTACTC
back to top

protein sequence of SMED30012743-orf-1

>SMED30012743-orf-1 ID=SMED30012743-orf-1|Name=SMED30012743-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=226bp
MSEQEEIERLNAAIEHERNYRDMIEQSTSEIRNALSDIEKQMTNIEDESN
EWKTRYDIQCEINDQYNKQILLLQDKLLSSKNQLKEVQKSVRTNTLQADF
GGEITSHTVRLLEREKENLINQRKDIDWRIDQEAKAYHKACEDRKNCQIE
LAAAQLNMIELKIKNQKEMDAQQMVTSRSTISHTRHSPKRTIGLRNIPQN
QRIIDRKFGPIKKTAAIKALPSIRD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0046983protein dimerization activity
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005667transcription factor complex
GO:0005737cytoplasm
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028022DUF4600
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 109..129
NoneNo IPR availableCOILSCoilCoilcoord: 144..169
NoneNo IPR availableCOILSCoilCoilcoord: 28..55
NoneNo IPR availablePANTHERPTHR28671:SF3COILED-COIL DOMAIN-CONTAINING PROTEIN 169coord: 4..224
IPR028022Protein of unknown function DUF4600PFAMPF15372DUF4600coord: 48..172
e-value: 5.9E-26
score: 91.4
IPR028022Protein of unknown function DUF4600PANTHERPTHR28671FAMILY NOT NAMEDcoord: 4..224