Arf-GAP with dual PH domain-containing 1 isoform X2

Overview
NameArf-GAP with dual PH domain-containing 1 isoform X2
Smed IDSMED30012725
Length (bp)823
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Arf-GAP with dual PH domain-containing 1 isoform X2 (SMED30012725) t-SNE clustered cells

Violin plots show distribution of expression levels for Arf-GAP with dual PH domain-containing 1 isoform X2 (SMED30012725) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Arf-GAP with dual PH domain-containing 1 isoform X2 (SMED30012725) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Arf-GAP with dual PH domain-containing 1 isoform X2 (SMED30012725) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012725

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012725h1SMcG0021078 SmedASXL_019960SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30012725h1SMcG0021078 dd_Smed_v4_5945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012725h1SMcG0021078 dd_Smed_v4_5945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012725h1SMcG0021078 dd_Smed_v4_5945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012725h1SMcG0021078 dd_Smed_v4_5945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30012725h1SMcG0021078 dd_Smed_v4_5945_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Human
Match: EBNA1BP2 (EBNA1 binding protein 2 [Source:HGNC Symbol;Acc:HGNC:15531])

HSP 1 Score: 82.0333 bits (201), Expect = 2.815e-17
Identity = 76/248 (30.65%), Postives = 122/248 (49.19%), Query Frame = 2
Query:   56 LEPGVYL---SEKKDIFQKEKLEKAIKSLYKDLPWIEKMDI-------VDSEQIVAA-----KSLEAE---EYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK---------DPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQNR 718
            L+PG+ +     KK +     L++ +    +DL W+E++D+       +   +  A      K+++ E   + E  F  QA+ AV   +  L + KV   RP D++AEM KSD  M K+++ L       E     +Q R  +K+GK VQ EV Q+RQ++K   +  IKKY+K         + +   L    +   K  +  K  + KR +KN+K+  GGK+ G K NT+ES +D+SSF       R
Sbjct:   87 LKPGLNVVLEGPKKAVNDVNGLKQCLAEFKRDLEWVERLDVTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLPRLHQLKVPTKRPTDYFAEMAKSDLQMQKIRQKLQTKQAAMERSEKAKQLRALRKYGKKVQTEVLQKRQQEKAHMMNAIKKYQKGFSDKLDFLEGDQKPLAQRKKAGAKGQQMRKGPSAKRRYKNQKFGFGGKKKGSKWNTRESYDDVSSFRAKTAHGR 334          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Human
Match: EBNA1BP2 (EBNA1 binding protein 2 [Source:HGNC Symbol;Acc:HGNC:15531])

HSP 1 Score: 81.2629 bits (199), Expect = 3.294e-17
Identity = 76/248 (30.65%), Postives = 121/248 (48.79%), Query Frame = 2
Query:   56 LEPGVYL---SEKKDIFQKEKLEKAIKSLYKDLPWIEKMDIV------------DSEQIVAAKSLEAE---EYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK---------DPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQNR 718
            L+PG+ +     KK +     L++ +    +DL W+E++D+              + Q    K+++ E   + E  F  QA+ AV   +  L + KV   RP D++AEM KSD  M K+++ L       E     +Q R  +K+GK VQ EV Q+RQ++K   +  IKKY+K         + +   L    +   K  +  K  + KR +KN+K+  GGK+ G K NT+ES +D+SSF       R
Sbjct:   32 LKPGLNVVLEGPKKAVNDVNGLKQCLAEFKRDLEWVERLDVTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLPRLHQLKVPTKRPTDYFAEMAKSDLQMQKIRQKLQTKQAAMERSEKAKQLRALRKYGKKVQTEVLQKRQQEKAHMMNAIKKYQKGFSDKLDFLEGDQKPLAQRKKAGAKGQQMRKGPSAKRRYKNQKFGFGGKKKGSKWNTRESYDDVSSFRAKTAHGR 279          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Celegans
Match: C18A3.3 (Probable rRNA-processing protein EBP2 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q09958])

HSP 1 Score: 75.8702 bits (185), Expect = 1.207e-15
Identity = 50/154 (32.47%), Postives = 92/154 (59.74%), Query Frame = 2
Query:   68 VYLSEKKDIFQKE-KLEKAIKSLYKDLPWIEKMDIVDSEQIVAAKSLEAEEY--ESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK 520
            + +++K+ I  K  ++++ +  + KDLPW+E +++V +      K +E +++  E  F +QA++AV+I    L    + + RP D+YAEM KSD HM K+++ L+   + +E +   R+ REEKKF   VQ+EV   +  +K    + +KK++K
Sbjct:   77 IQVAKKRPIINKSAEMKEKLAEITKDLPWVETLEVV-TPHSEMDKKVENDDFQRELNFYKQAEKAVQIAYPRLLNLGIKVLRPTDYYAEMAKSDTHMQKVRKRLLGIQEMKERQEAFRRIREEKKFAVKVQKEVLAAKNTEKKNLAEAVKKHKK 229          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Fly
Match: CG1542 (gene:FBgn0039828 transcript:FBtr0085757)

HSP 1 Score: 58.9214 bits (141), Expect = 8.216e-10
Identity = 71/255 (27.84%), Postives = 126/255 (49.41%), Query Frame = 2
Query:   56 LEPGV---YLSEKKDIFQKEKLEKAIKSLYKDLPWIEKMDIVDSEQIVAAK-SLEAEEYESQ------------------------------FLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKDPNSVDLKNT--LEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQ 712
            L+PG+   +  ++  +    KL    +++   LPW+E++D++++   +A + +++ E++E +                              F  QA+ AV   I  L E  +   RP D++AEM KSDEHM K++  L+   + +     ++Q RE++K GK + ++   QR+ +K + L ++KK+RK      LKN   LE         K+    R+ +NKK+  GGK+ G+KRNTK S+  +     S+ Q
Sbjct:   32 LKPGLNVEFNGQRDKVNDVTKLLAKTEAIKMQLPWLERLDMINTLAPLAPELAVQLEKHEQKRANLFKGNAKLPYIRPEEDPVLNDFKREMLFHRQAQSAVLEAIPRLHELGIKTRRPDDYFAEMAKSDEHMQKVRANLMAKQQGQAKSERIKQIREQRKMGKMLAKQTKVQREAEKKDMLDKLKKFRKGK----LKNLDFLEDAKALESKQKQSAENRKKRNKKFGFGGKKKGLKRNTKSSSAGLDGDKSSRRQ 282          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Zebrafish
Match: ebna1bp2 (EBNA1 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6989])

HSP 1 Score: 115.931 bits (289), Expect = 3.884e-30
Identity = 85/245 (34.69%), Postives = 132/245 (53.88%), Query Frame = 2
Query:   56 LEPGVYLSE---KKDIFQKEKLEKAIKSLYKDLPWIEKMDIVD-------------SEQIVAAKSLEAE---EYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQK--REEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK-----------DPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSF 694
            L+PG+ + +   KK I   E L K +    K+LPWIE++D+ +             ++Q   +K + AE   + E  F  QA+  V   +  L++ K+   RP D++AEM K+D+HM K+++ L+  LK E M    + K  RE++K+GK VQ EV Q RQK K   L  +KKY+K           D N     ++ + +  K  P    N KR++K+KK+  GG++ G K NTKES +D+S+F
Sbjct:   35 LKPGLNIPQDEQKKTINNVEGLNKCLAEFKKNLPWIERLDLTNPPAVNIIAKAEGRAQQPEGSKEINAEDDFQREMYFYRQAQATVLAALPKLQKFKIPTKRPDDYFAEMAKTDQHMQKIRKKLL--LKQEVMEKSEKAKRLREQRKYGKKVQTEVIQNRQKQKKAMLSAVKKYQKGMTDKLDFLEGDQNQGQKGSSTKKQINKKNP----NAKRKYKDKKFGFGGRKKGSKWNTKESHDDVSAF 273          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Zebrafish
Match: ebna1bp2 (EBNA1 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6989])

HSP 1 Score: 115.546 bits (288), Expect = 4.266e-30
Identity = 85/245 (34.69%), Postives = 132/245 (53.88%), Query Frame = 2
Query:   56 LEPGVYLSE---KKDIFQKEKLEKAIKSLYKDLPWIEKMDIVD-------------SEQIVAAKSLEAE---EYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQK--REEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK-----------DPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSF 694
            L+PG+ + +   KK I   E L K +    K+LPWIE++D+ +             ++Q   +K + AE   + E  F  QA+  V   +  L++ K+   RP D++AEM K+D+HM K+++ L+  LK E M    + K  RE++K+GK VQ EV Q RQK K   L  +KKY+K           D N     ++ + +  K  P    N KR++K+KK+  GG++ G K NTKES +D+S+F
Sbjct:   35 LKPGLNIPQDEQKKTINNVEGLNKCLAEFKKNLPWIERLDLTNPPAVNIIAKAEGRAQQPEGSKEINAEDDFQREMYFYRQAQATVLAALPKLQKFKIPTKRPDDYFAEMAKTDQHMQKIRKKLL--LKQEVMEKSEKAKRLREQRKYGKKVQTEVIQNRQKQKKAMLSAVKKYQKGMTDKLDFLEGDQNQGQKGSSTKKQINKKNP----NAKRKYKDKKFGFGGRKKGSKWNTKESHDDVSAF 273          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Zebrafish
Match: ebna1bp2 (EBNA1 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6989])

HSP 1 Score: 62.3882 bits (150), Expect = 1.292e-11
Identity = 41/103 (39.81%), Postives = 59/103 (57.28%), Query Frame = 2
Query:  419 REEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK-----------DPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSF 694
            RE++K+GK VQ EV Q RQK K   L  +KKY+K           D N     ++ + +  K  P    N KR++K+KK+  GG++ G K NTKES +D+S+F
Sbjct:   23 REQRKYGKKVQTEVIQNRQKQKKAMLSAVKKYQKGMTDKLDFLEGDQNQGQKGSSTKKQINKKNP----NAKRKYKDKKFGFGGRKKGSKWNTKESHDDVSAF 121          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Xenopus
Match: ebna1bp2 (uncharacterized loc100135222 [Source:Xenbase;Acc:XB-GENE-5949754])

HSP 1 Score: 98.5969 bits (244), Expect = 1.338e-23
Identity = 92/250 (36.80%), Postives = 134/250 (53.60%), Query Frame = 2
Query:   56 LEPG--VYLSEKKDIFQK-EKLEKAIKSLYKDLPWIEKMDI-VDSEQIVAAKS---------LEAE---EYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKD-PNSVD-LKNTLEVRPKKT------EPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPS----KHQNRP 721
            L+PG  V L  KK  F     L +++K L  +LPW E+MD+ VD     A ++         + AE   + E  F  QA+ AV   +  L + KV   RP D++AEM K+D+HM K+++ L       E     +Q R  +K+GK VQ EV Q+RQK+K+  + +IKKY+K   + +D L+     +  KT      +  K  + KR +K++K+  GGK+ G KRNTKES ND+S F  S    K Q RP
Sbjct:   34 LKPGLNVILEGKKKPFNDVSGLRQSLKDLMNELPWAERMDVTVDPVAETAGQNGQTAPNTPDINAEDDFQREMCFYRQAQAAVLYALPRLHQLKVATKRPDDYFAEMAKTDQHMQKIRQKLQIKQAAMEKSEKAKQLRALRKYGKKVQTEVLQKRQKEKSAMMTQIKKYQKGLSDKLDFLEGDQTQKKNKTGGSAAQKAKKGPSAKRRYKDQKFGFGGKKKGSKRNTKESYNDVSGFRASVAHGKGQRRP 283          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Mouse
Match: Ebna1bp2 (EBNA1 binding protein 2 [Source:MGI Symbol;Acc:MGI:1916322])

HSP 1 Score: 83.9593 bits (206), Expect = 2.650e-18
Identity = 73/240 (30.42%), Postives = 120/240 (50.00%), Query Frame = 2
Query:   56 LEPGVYL---SEKKDIFQKEKLEKAIKSLYKDLPWIEKMDIV---------------DSEQIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK---------DPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSF 694
            L+PG+ +     KK +     L++ +    +DL W+E++D+                + +Q       +  + E  F  QA+ AV   +  L + +V   RP D++AEM KSD+ M K+++ L       E     +Q R  +K+GK VQ EV Q+RQ++K   +  IKKY+K         + +   ++ + +   K  +  K  N KR +KN+K+  GGK+ G K NTKES +D+SSF
Sbjct:   32 LKPGLNVVLEKPKKAVNDVSGLKQCLAEFRRDLEWVERLDVTLGPVPEVSETQPTPQNQDQKKGVNPEDDFQREMSFYRQAQAAVLAVLPRLHQLQVPTKRPTDYFAEMAKSDQQMQKIRQKLQTKQAAMEKSEKAKQLRALRKYGKKVQTEVLQKRQREKAHMMNAIKKYQKGFSDKLDFLEGDQKPVERSAKAGGKGQQMSKGPNAKRRYKNQKFGFGGKKKGSKWNTKESYDDVSSF 271          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Mouse
Match: Ebna1bp2 (EBNA1 binding protein 2 [Source:MGI Symbol;Acc:MGI:1916322])

HSP 1 Score: 68.9366 bits (167), Expect = 1.031e-13
Identity = 49/152 (32.24%), Postives = 77/152 (50.66%), Query Frame = 2
Query:  110 LEKAIKSLYKDLPWIEKMDI-------VDSEQIVAA-----KSLEAE---EYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK 520
            L++ +    +DL W+E++D+       V   Q         K +  E   + E  F  QA+ AV   +  L + +V   RP D++AEM KSD+ M K+++ L       E     +Q R  +K+GK VQ EV Q+RQ++K   +  IKKY+K
Sbjct:   16 LKQCLAEFRRDLEWVERLDVTLGPVPEVSETQPTPQNQDQKKGVNPEDDFQREMSFYRQAQAAVLAVLPRLHQLQVPTKRPTDYFAEMAKSDQQMQKIRQKLQTKQAAMEKSEKAKQLRALRKYGKKVQTEVLQKRQREKAHMMNAIKKYQK 167          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. UniProt/SwissProt
Match: sp|O13802|EBP2_SCHPO (Probable rRNA-processing protein ebp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ebp2 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 7.276e-21
Identity = 74/233 (31.76%), Postives = 122/233 (52.36%), Query Frame = 2
Query:   35 DIEFSDPLEPGVYLSEKKDIFQKEKLE----KAIKSLYK------DLPWIEKMDIVDSEQIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKDPNSVDLK--------------NTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRN 661
            ++E SD LE G+ L E  D+ +K KL      A++++Y+      D+ ++E   +   E I+     +    E  F +Q   +VK     L E  VLI+RP D++AEMLKSD+HM K+++ LIK+   +++    +++RE KKFGK VQ    ++RQ++K E L++I   ++     DL               +T +   + T+   + N KR+ KN+KY  GG +   K N
Sbjct:   69 EVELSD-LE-GIELEEDADLIRKRKLAINNTVALENIYERIKYPDDISFVENQAVTTKEPIIIENVEDDLARELAFYKQGVSSVKAAFAKLREANVLISRPHDYFAEMLKSDDHMEKVRQELIKEATAKKLSQQAKKQRELKKFGKQVQLAKQEERQREKKETLEKINLLKRKHTGGDLTTEDDFDIALSSASADTFKKGSRSTKSRPQPNPKRQKKNEKYGFGGPKHRSKSN 299          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. UniProt/SwissProt
Match: sp|P36049|EBP2_YEAST (rRNA-processing protein EBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EBP2 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.908e-18
Identity = 68/179 (37.99%), Postives = 102/179 (56.98%), Query Frame = 2
Query:  215 EYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIK--KYRKDPNSVD-----LKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQ---NRP 721
            E E  F +Q+  AV +    L+  KV   RP D++AEM+KSDEHM K+K  LI++  +++ R   R++R+ KKFGK VQ    Q+RQ +K E L++IK  K ++  N +D     +    EV  K+ +   R N KR  KN KY +GG +   ++N   S+ D+S F+  K +   NRP
Sbjct:  241 ERELAFYKQSLDAVLVARDELKRLKVPFKRPLDYFAEMVKSDEHMDKIKGKLIEEASDKKAREEARRQRQLKKFGKQVQNATLQKRQLEKRETLEKIKSLKNKRKHNEIDHSEFNVGVEEEVEGKRFD-RGRPNGKRAAKNAKYGQGGMKRFKRKNDATSSADVSGFSSRKMKGKTNRP 418          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. UniProt/SwissProt
Match: sp|Q9D903|EBP2_MOUSE (Probable rRNA-processing protein EBP2 OS=Mus musculus OX=10090 GN=Ebna1bp2 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.853e-17
Identity = 73/240 (30.42%), Postives = 120/240 (50.00%), Query Frame = 2
Query:   56 LEPGVYL---SEKKDIFQKEKLEKAIKSLYKDLPWIEKMDIV---------------DSEQIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK---------DPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSF 694
            L+PG+ +     KK +     L++ +    +DL W+E++D+                + +Q       +  + E  F  QA+ AV   +  L + +V   RP D++AEM KSD+ M K+++ L       E     +Q R  +K+GK VQ EV Q+RQ++K   +  IKKY+K         + +   ++ + +   K  +  K  N KR +KN+K+  GGK+ G K NTKES +D+SSF
Sbjct:   32 LKPGLNVVLEKPKKAVNDVSGLKQCLAEFRRDLEWVERLDVTLGPVPEVSETQPTPQNQDQKKGVNPEDDFQREMSFYRQAQAAVLAVLPRLHQLQVPTKRPTDYFAEMAKSDQQMQKIRQKLQTKQAAMEKSEKAKQLRALRKYGKKVQTEVLQKRQREKAHMMNAIKKYQKGFSDKLDFLEGDQKPVERSAKAGGKGQQMSKGPNAKRRYKNQKFGFGGKKKGSKWNTKESYDDVSSF 271          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. UniProt/SwissProt
Match: sp|Q9I8J6|EBP2_XENLA (Probable rRNA-processing protein EBP2 OS=Xenopus laevis OX=8355 GN=ebna1bp2 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.843e-17
Identity = 59/171 (34.50%), Postives = 92/171 (53.80%), Query Frame = 2
Query:   56 LEPG--VYLSEKKDIFQ-KEKLEKAIKSLYKDLPWIEKMDIV----------DSEQIVAAKSLEAE---EYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK 520
            L+PG  V L  KK  F     L++++K L  +LPW+E++D+           + +       + AE   + E  F  QA+ AV   +  L + KV   RP D++AEM K+D+HM K++  L     + E     +Q R  +K+GK VQ EV Q+RQK+K+  + +IKKY+K
Sbjct:   35 LKPGLNVVLEGKKKPFNDASGLKQSLKDLKNELPWVERLDVTVDPVVDTTGQNGQTDPNTSDINAEDDFQREMCFYRQAQAAVLYSLPRLRKLKVATKRPDDYFAEMAKTDQHMQKIRHKLQLKQASMEKSEKAKQLRALRKYGKKVQVEVLQKRQKEKSAMVTQIKKYQK 205          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. UniProt/SwissProt
Match: sp|Q99848|EBP2_HUMAN (Probable rRNA-processing protein EBP2 OS=Homo sapiens OX=9606 GN=EBNA1BP2 PE=1 SV=2)

HSP 1 Score: 81.2629 bits (199), Expect = 1.582e-16
Identity = 76/248 (30.65%), Postives = 121/248 (48.79%), Query Frame = 2
Query:   56 LEPGVYL---SEKKDIFQKEKLEKAIKSLYKDLPWIEKMDIV------------DSEQIVAAKSLEAE---EYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK---------DPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQNR 718
            L+PG+ +     KK +     L++ +    +DL W+E++D+              + Q    K+++ E   + E  F  QA+ AV   +  L + KV   RP D++AEM KSD  M K+++ L       E     +Q R  +K+GK VQ EV Q+RQ++K   +  IKKY+K         + +   L    +   K  +  K  + KR +KN+K+  GGK+ G K NT+ES +D+SSF       R
Sbjct:   32 LKPGLNVVLEGPKKAVNDVNGLKQCLAEFKRDLEWVERLDVTLGPVPEIGGSEAPAPQNKDQKAVDPEDDFQREMSFYRQAQAAVLAVLPRLHQLKVPTKRPTDYFAEMAKSDLQMQKIRQKLQTKQAAMERSEKAKQLRALRKYGKKVQTEVLQKRQQEKAHMMNAIKKYQKGFSDKLDFLEGDQKPLAQRKKAGAKGQQMRKGPSAKRRYKNQKFGFGGKKKGSKWNTRESYDDVSSFRAKTAHGR 279          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. TrEMBL
Match: A0A0D2WM13 (Uncharacterized protein OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_002269 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 7.863e-32
Identity = 77/213 (36.15%), Postives = 125/213 (58.69%), Query Frame = 2
Query:  101 KEKLEKAIKSLYKDLPWIEKMDIVDSEQIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKDPNSV-----DLKNTLEVRPKKTEP-LKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQNRP 721
            +E+L    + +    PW E++D+V +  IV   + +  + E  F  QA  AVK+    L    +   RP D++AEM+K+D+HM K++EAL+ + +  E     ++ R+ K+FGK VQ++V + RQK KT  L+ IKK++KD ++      D  +   +   K E   ++ N KR +KN KY  GGK+ G KRNT++SA+D SSFN ++++  P
Sbjct:    6 RERLGDIAQQVDASFPWAERLDLVSTVPIVLDDAQDDFKREMSFYNQALEAVKLARPRLAAANIKFTRPDDYFAEMVKTDDHMRKVREALLSEHQAVERSEQAKKSRQMKQFGKKVQQQVLEDRQKQKTSDLEAIKKFKKDRSAKPDFLDDGDDQFNIGVDKEESHSQKTNSKRSYKNDKYGNGGKKRGSKRNTRDSASDDSSFNFARNKALP 218          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. TrEMBL
Match: A0A0D2VLT7 (Uncharacterized protein OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_002269 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 6.602e-31
Identity = 78/213 (36.62%), Postives = 126/213 (59.15%), Query Frame = 2
Query:  101 KEKLEKAIKSLYKDLPWIEKMDIVDSEQIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKD----PNSV-DLKNTLEVRPKKTEP-LKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQNRP 721
            +E+L    + +    PW E++D+V +  IV   + +  + E  F  QA  AVK+    L    +   RP D++AEM+K+D+HM K++EAL+ + +  E     ++ R+ K+FGK VQ++V + RQK KT  L+ IKK++KD    P+ + D  +   +   K E   ++ N KR +KN KY  GGK+ G KRNT++SA+D SSFN ++++  P
Sbjct:   98 RERLGDIAQQVDASFPWAERLDLVSTVPIVLDDAQDDFKREMSFYNQALEAVKLARPRLAAANIKFTRPDDYFAEMVKTDDHMRKVREALLSEHQAVERSEQAKKSRQMKQFGKKVQQQVLEDRQKQKTSDLEAIKKFKKDRSAKPDFLDDGDDQFNIGVDKEESHSQKTNSKRSYKNDKYGNGGKKRGSKRNTRDSASDDSSFNFARNKALP 310          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. TrEMBL
Match: A0A3R7CFM4 (Putative rRNA-processing protein EBP2 OS=Clonorchis sinensis OX=79923 GN=EBNA1BP2 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.660e-30
Identity = 86/253 (33.99%), Postives = 130/253 (51.38%), Query Frame = 2
Query:   62 PGVY---LSEKKDIFQKEKLEKAIKSLYKDLPWIEKMDIVDSEQIVAAKSLEAEEYESQ------------FLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEI----KKYRKDPNSV------DLKNTLE------VRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKE--SANDISSFNPSKHQNRP 721
            PG+Y      K+ +  K  L   ++ L   LPWIE++D+V ++   AAK L+A +   Q            F    + AV + I  L +  V   RP D++AEM+K+DE M K+K+ LI+  +   +R   RQ RE +KFGK  Q+ V Q R+ +K +    I    KK+ KD +        + +NT +       R K     ++INY+R++KNKKY  GG++   KRNT +  S      FNP+KHQ +P
Sbjct:   17 PGLYREVTVPKQHVNNKPALTNTLEHLCNKLPWIERLDVV-TKPAPAAKELDAPDTADQIDPDDDFKRENYFYRLGQAAVLVAIPKLHQLGVPTKRPADYFAEMVKTDEQMGKIKQHLIETQQRLTLRERARQMRERRKFGKQTQQAVLQARKAEKRQLTDAIKASRKKFGKDQDGTLDQILGEYRNTPDKQKAGFNRAKDVANRRKINYQRDYKNKKYGHGGQKKRSKRNTADSFSGGARQDFNPAKHQAKP 268          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. TrEMBL
Match: A0A4S2KYW0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010536 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.028e-30
Identity = 85/253 (33.60%), Postives = 132/253 (52.17%), Query Frame = 2
Query:   62 PGVY---LSEKKDIFQKEKLEKAIKSLYKDLPWIEKMDIVDSEQIVAAKSLEAEEYESQ------------FLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEI----KKYRKDPNSVDLKNTLEVR--PKKTEP----------LKRINYKREFKNKKYSKGGKRSGMKRNTKESANDIS--SFNPSKHQNRP 721
            PG+Y      ++ +  K  L   ++ L+  LPWIE++D+V ++   AAK L+  +   Q            F    + AV + I  L +  V   RP D++AEMLK+DE M K+K+ L++  +   +R   RQ RE +KFGK  Q+ V Q R+ +K +  + I    KK+ KD +    +   E R  P K +P           ++INY+R++KNKKY  GG++   KRNT +S    +   FNP+KHQ +P
Sbjct:   17 PGLYREIAVPRQHVNNKPALTNTLEHLHNKLPWIERLDVV-TKPAPAAKELDVPDTADQIDPDDDFKRENYFYRLGQAAVLVAIPKLHQLGVPTKRPADYFAEMLKTDEQMGKIKQHLVETQQRLTLRERARQMRERRKFGKQTQQAVLQARKAEKRQLTEAIKTSRKKFGKDHDGTLDQILGEYRDTPDKQKPGFNRAKDVANRRKINYQRDYKNKKYGHGGQKKRSKRNTADSFGGAARQDFNPAKHQAKP 268          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. TrEMBL
Match: A0A504YJA5 (rRNA-processing protein EBP2 (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_06288 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 9.744e-30
Identity = 94/260 (36.15%), Postives = 127/260 (48.85%), Query Frame = 2
Query:   62 PGVY---LSEKKDIFQKEKLEKAIKSLYKDLPWIEKMDIVDSEQIVAAKSLEAEEY------------ESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK-----------------------DPNS--VDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKES--ANDISSFNPSKHQN 715
            PG+Y      K     K  LE  +K +  +LPWIE++DIV +    AAK LE E              E+ F    + AV   I  L    V   RP DF+AEM+KSDEHM K+K+ LI+  +   +R   RQ RE++KFGK  Q  V Q R+ +K +  + IK  RK                        PN    + K T   R K     ++IN++R++KNKKY  GG++   KRNT+ES  A     F+PSKHQN
Sbjct:   44 PGLYKEIQQPKHHPNNKPALENTLKHIENNLPWIERLDIV-TPPAPAAKELEVENDPDKIDADDDFKRENYFYRIGQAAVLKAIPQLHALGVPTKRPADFFAEMVKSDEHMGKVKKHLIETQQRLALRERARQVREKRKFGKQTQLAVLQARKAEKRQLSEAIKASRKKSGHNRAELLDSILNQFRDEHEPKPNQKKAEAKQTGFHRAKDVANRRKINHERDYKNKKYGHGGQKKRGKRNTRESFGAGLKRDFDPSKHQN 302          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Cavefish
Match: ebna1bp2 (EBNA1 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-6989])

HSP 1 Score: 103.219 bits (256), Expect = 1.757e-25
Identity = 74/235 (31.49%), Postives = 125/235 (53.19%), Query Frame = 2
Query:   59 EPGVYLS---EKKDIFQKEKLEKAIKSLYKDLPWIEKMDIVD---------SEQIVAAKSLEAE---EYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKD-PNSVDL-------KNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSF 694
            +PG+ +     KK     E L+K +    K+LPW+E++D+ +         +E   +   +  E   + E  F  QA+  V   +  L++  +   RP D++AEM K+D+HM K+++ L++     E     ++ RE++KFGK VQ EV Q+RQK K + +  +KKY++   + +D        KN      K+       + KR++K++K+  GG++ G KRNTKES ND+S F
Sbjct:   38 QPGLNIPLEEPKKAANNVEGLKKCLADFKKNLPWVERLDLTNKPVDDVLAKAEGRPSNDDVNPEDDFQREMYFYRQAQATVLEALPKLKKLNIFTKRPDDYFAEMSKTDQHMQKIRKKLMQKQVAMENSEKAKKLREQRKFGKKVQVEVLQKRQKQKRDMMTAVKKYQRGMTDKLDFLEGDKEGKNGPASSKKQMGKRGGPSSKRKYKDQKFGFGGRKKGSKRNTKESHNDVSGF 272          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Cavefish
Match: EBNA1BP2 (EBNA1 binding protein 2 [Source:HGNC Symbol;Acc:HGNC:15531])

HSP 1 Score: 53.1434 bits (126), Expect = 4.504e-8
Identity = 43/160 (26.88%), Postives = 81/160 (50.62%), Query Frame = 2
Query:   56 LEPGVYL---SEKKDIFQKEKLEKAIKSLYKDLPWIEKMDIVDS--EQIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRK 520
            L+PG+ +     KK     E L+K +    K+LPW+E++D+ +   + ++A         +    +  +R +             I++ +    EM K+D+H  K+++ L++     E     ++ RE++KFGK VQ EV Q+RQK K + +  +KKY++
Sbjct:   42 LKPGLNIPLEEPKKAANNVEGLKKCLADFKKNLPWVERLDLTNKPVDDVLAKAEGRPSNDDVNPEDDFQREM-----------YFISKAQATVLEMSKTDQHHQKIRKKLMQKQVAMENSEKAKKLREQRKFGKKVQVEVLQKRQKQKRDMMTAVKKYQR 190          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Yeast
Match: EBP2 (Required for 25S rRNA maturation and 60S ribosomal subunit assembly; localizes to the nucleolus and in foci along nuclear periphery; constituent of 66S pre-ribosomal particles; cooperates with Rrs1p and Mps3p to mediate telomere clustering by binding Sir4p, but is not involved in telomere tethering [Source:SGD;Acc:S000001655])

HSP 1 Score: 87.8113 bits (216), Expect = 2.748e-20
Identity = 68/179 (37.99%), Postives = 102/179 (56.98%), Query Frame = 2
Query:  215 EYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIK--KYRKDPNSVD-----LKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQ---NRP 721
            E E  F +Q+  AV +    L+  KV   RP D++AEM+KSDEHM K+K  LI++  +++ R   R++R+ KKFGK VQ    Q+RQ +K E L++IK  K ++  N +D     +    EV  K+ +   R N KR  KN KY +GG +   ++N   S+ D+S F+  K +   NRP
Sbjct:  241 ERELAFYKQSLDAVLVARDELKRLKVPFKRPLDYFAEMVKSDEHMDKIKGKLIEEASDKKAREEARRQRQLKKFGKQVQNATLQKRQLEKRETLEKIKSLKNKRKHNEIDHSEFNVGVEEEVEGKRFD-RGRPNGKRAAKNAKYGQGGMKRFKRKNDATSSADVSGFSSRKMKGKTNRP 418          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Nematostella
Match: EDO46929 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNI4])

HSP 1 Score: 113.62 bits (283), Expect = 7.535e-30
Identity = 78/226 (34.51%), Postives = 131/226 (57.96%), Query Frame = 2
Query:  104 EKLEKAIKSLYKDLPWIEKMDIVD----SEQIVAAKSLEAEE--------YESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKDPNSV-------DLKNTLEVRPK-KTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQNRP 721
            E L++    + + L W+E+MD+       E+   AK +   +         E  F +QA+ A K+G+  L++ +V   RP+D++AEM+K+D+HM +++  L+   +  E     +++RE KK+GK VQ+EV ++RQK+K + L+ +KKYRK   +        D     E + K K +   +IN+KR+ K+KK+  GGK+  +KRNT++S +D+SSFN  KH   P
Sbjct:   50 EGLKRKYDQISQSLDWLERMDVTHKPTADEENDTAKDITTPDPSVHDDFKREMMFYKQAQEAAKLGLLKLQKLRVSTKRPEDYFAEMVKTDDHMQRVRSKLLSRQQAMERSEKAKKQREIKKYGKKVQQEVLEKRQKEKKDMLEAVKKYRKGKQTAPDFMKEDDFDVNAESKSKGKPQQRNQINHKRKAKDKKFGFGGKKRNIKRNTQKSTSDVSSFNSRKHSKAP 275          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Medaka
Match: ebna1bp2 (EBNA1 binding protein 2 [Source:NCBI gene;Acc:101167862])

HSP 1 Score: 88.5817 bits (218), Expect = 5.327e-20
Identity = 78/236 (33.05%), Postives = 125/236 (52.97%), Query Frame = 2
Query:   56 LEPGVYL---SEKKDIFQKEKLEKAIKSLYKDLPWIEKMDI------------VDSEQIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKD-PNSVD-------LKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSF 694
            L+PG+ +     KK +   E L++ +    KDL W+E++D+            V +E      + +  + E  F  QA+  V   + +L ++ +   RP D++AEM KSD+HM K+++ L       E     ++ RE++KFGK VQ EV Q+RQK+K   +  +KKY+K   + +D       + N     P K    K  + KR++K++K+  GGK+SG K NTKES ND+S F
Sbjct:   76 LKPGMNVLVDKSKKLVNNVEGLKECLADFRKDLSWVERLDLSTLPVLSQVEGKVPAEINGGPDAEDDFQREMFFYRQAQATVLEALPLLRKHDINTRRPDDYFAEMAKSDQHMQKIRQKLTAKQMILEKSEKAKKLREQRKFGKKVQIEVIQKRQKEKKAMMSAVKKYQKGMSDKLDFLEGDQKMGNNSSGGPSKAVNKKGPSAKRKYKDQKFGFGGKKSGKKWNTKESYNDVSGF 311          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Medaka
Match: ebna1bp2 (EBNA1 binding protein 2 [Source:NCBI gene;Acc:101167862])

HSP 1 Score: 87.0409 bits (214), Expect = 1.279e-19
Identity = 78/236 (33.05%), Postives = 125/236 (52.97%), Query Frame = 2
Query:   56 LEPGVYL---SEKKDIFQKEKLEKAIKSLYKDLPWIEKMDI------------VDSEQIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKD-PNSVD-------LKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSF 694
            L+PG+ +     KK +   E L++ +    KDL W+E++D+            V +E      + +  + E  F  QA+  V   + +L ++ +   RP D++AEM KSD+HM K+++ L       E     ++ RE++KFGK VQ EV Q+RQK+K   +  +KKY+K   + +D       + N     P K    K  + KR++K++K+  GGK+SG K NTKES ND+S F
Sbjct:   42 LKPGMNVLVDKSKKLVNNVEGLKECLADFRKDLSWVERLDLSTLPVLSQVEGKVPAEINGGPDAEDDFQREMFFYRQAQATVLEALPLLRKHDINTRRPDDYFAEMAKSDQHMQKIRQKLTAKQMILEKSEKAKKLREQRKFGKKVQIEVIQKRQKEKKAMMSAVKKYQKGMSDKLDFLEGDQKMGNNSSGGPSKAVNKKGPSAKRKYKDQKFGFGGKKSGKKWNTKESYNDVSGF 277          
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Planmine SMEST
Match: SMESG000016864.1 (SMESG000016864.1)

HSP 1 Score: 371.703 bits (953), Expect = 8.640e-132
Identity = 186/188 (98.94%), Postives = 187/188 (99.47%), Query Frame = 2
Query:  161 MDIVDSEQIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKDPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQNRPV 724
            MDIVDS+QIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRM VRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKDPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQNRPV
Sbjct:    1 MDIVDSDQIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEMLKSDEHMAKMKEALIKDLKNEEMRMQVRQKREEKKFGKDVQREVTQQRQKDKTEFLKEIKKYRKDPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYSKGGKRSGMKRNTKESANDISSFNPSKHQNRPV 188          
The following BLAST results are available for this feature:
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
EBNA1BP22.815e-1730.65EBNA1 binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
EBNA1BP23.294e-1730.65EBNA1 binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C18A3.31.207e-1532.47Probable rRNA-processing protein EBP2 homolog [So... [more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG15428.216e-1027.84gene:FBgn0039828 transcript:FBtr0085757[more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ebna1bp23.884e-3034.69EBNA1 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ebna1bp24.266e-3034.69EBNA1 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ebna1bp21.292e-1139.81EBNA1 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ebna1bp21.338e-2336.80uncharacterized loc100135222 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ebna1bp22.650e-1830.42EBNA1 binding protein 2 [Source:MGI Symbol;Acc:MGI... [more]
Ebna1bp21.031e-1332.24EBNA1 binding protein 2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O13802|EBP2_SCHPO7.276e-2131.76Probable rRNA-processing protein ebp2 OS=Schizosac... [more]
sp|P36049|EBP2_YEAST1.908e-1837.99rRNA-processing protein EBP2 OS=Saccharomyces cere... [more]
sp|Q9D903|EBP2_MOUSE1.853e-1730.42Probable rRNA-processing protein EBP2 OS=Mus muscu... [more]
sp|Q9I8J6|EBP2_XENLA2.843e-1734.50Probable rRNA-processing protein EBP2 OS=Xenopus l... [more]
sp|Q99848|EBP2_HUMAN1.582e-1630.65Probable rRNA-processing protein EBP2 OS=Homo sapi... [more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0D2WM137.863e-3236.15Uncharacterized protein OS=Capsaspora owczarzaki (... [more]
A0A0D2VLT76.602e-3136.62Uncharacterized protein OS=Capsaspora owczarzaki (... [more]
A0A3R7CFM41.660e-3033.99Putative rRNA-processing protein EBP2 OS=Clonorchi... [more]
A0A4S2KYW02.028e-3033.60Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A504YJA59.744e-3036.15rRNA-processing protein EBP2 (Fragment) OS=Fasciol... [more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ebna1bp21.757e-2531.49EBNA1 binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
EBNA1BP24.504e-826.88EBNA1 binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
EBP22.748e-2037.99Required for 25S rRNA maturation and 60S ribosomal... [more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO469297.535e-3034.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ebna1bp25.327e-2033.05EBNA1 binding protein 2 [Source:NCBI gene;Acc:1011... [more]
ebna1bp21.279e-1933.05EBNA1 binding protein 2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Arf-GAP with dual PH domain-containing 1 isoform X2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000016864.18.640e-13298.94SMESG000016864.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012725 ID=SMED30012725|Name=Arf-GAP with dual PH domain-containing 1 isoform X2|organism=Schmidtea mediterranea sexual|type=transcript|length=823bp
CTTTTAATTGCTTTTACTAAATTTACTCATGATTGACATAGAATTTTCAG
ATCCACTTGAACCTGGAGTTTATTTATCTGAAAAGAAAGATATATTTCAA
AAAGAAAAGTTAGAAAAAGCAATTAAAAGCCTTTATAAAGACCTTCCATG
GATTGAAAAAATGGACATTGTTGATAGCGAGCAAATTGTTGCTGCTAAAT
CATTAGAAGCTGAAGAATATGAATCTCAATTTTTGGAGCAAGCGAAACGT
GCAGTAAAAATTGGAATTCAAATGCTTGAAGAAAATAAAGTTCTGATAAA
TCGTCCAAAGGATTTCTATGCAGAAATGTTAAAATCTGATGAACATATGG
CTAAGATGAAAGAAGCGTTAATCAAAGATTTGAAAAACGAAGAAATGAGA
ATGCTAGTTCGTCAAAAACGTGAAGAAAAGAAATTTGGTAAAGATGTACA
AAGAGAAGTTACCCAACAAAGACAGAAGGATAAAACAGAATTTTTGAAGG
AAATAAAAAAATATCGAAAAGATCCAAACAGTGTCGATTTGAAAAATACT
TTGGAAGTAAGACCCAAGAAAACTGAGCCATTGAAGCGAATCAATTATAA
ACGAGAGTTTAAAAATAAGAAATACAGCAAAGGTGGCAAGCGTTCTGGAA
TGAAAAGAAACACGAAGGAATCAGCAAACGATATCAGCAGTTTCAATCCG
TCTAAGCACCAAAATAGACCAGTTAAAATTCAAGATAAGAAATTTAAAAA
GCCAAAGAATAAAAAATAAATTTTTGATTTTAATCAATTCTTTGGTTGTA
AATTATTCTGTAATATAGTGATT
back to top

protein sequence of SMED30012725-orf-1

>SMED30012725-orf-1 ID=SMED30012725-orf-1|Name=SMED30012725-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=247bp
MIDIEFSDPLEPGVYLSEKKDIFQKEKLEKAIKSLYKDLPWIEKMDIVDS
EQIVAAKSLEAEEYESQFLEQAKRAVKIGIQMLEENKVLINRPKDFYAEM
LKSDEHMAKMKEALIKDLKNEEMRMLVRQKREEKKFGKDVQREVTQQRQK
DKTEFLKEIKKYRKDPNSVDLKNTLEVRPKKTEPLKRINYKREFKNKKYS
KGGKRSGMKRNTKESANDISSFNPSKHQNRPVKIQDKKFKKPKNKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
GO:0046872metal ion binding
GO:1902936phosphatidylinositol bisphosphate binding
GO:0005515protein binding
GO:0042802identical protein binding
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
GO:0000280nuclear division
GO:0006364rRNA processing
GO:0042254ribosome biogenesis
GO:0042273ribosomal large subunit biogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR008610Ebp2
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0030687preribosome, large subunit precursor
GO:0034399nuclear periphery
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 106..140
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 196..211
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 218..234
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 135..155
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 175..195
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 175..251
IPR008610Eukaryotic rRNA processingPFAMPF05890Ebp2coord: 23..246
e-value: 1.3E-49
score: 169.2
IPR008610Eukaryotic rRNA processingPANTHERPTHR13028RRNA PROCESSING PROTEIN EBNA1-BINDING PROTEIN-RELATEDcoord: 22..250