Peptidase S1 domain-containing protein

Overview
NamePeptidase S1 domain-containing protein
Smed IDSMED30012713
Length (bp)1501
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase S1 domain-containing protein (SMED30012713) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase S1 domain-containing protein (SMED30012713) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase S1 domain-containing protein (SMED30012713) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase S1 domain-containing protein (SMED30012713) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012713

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30012713SMESG000025209.1 dd_Smed_v4_198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012713SMESG000025209.1 dd_Smed_v6_198_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: CELA1 (chymotrypsin like elastase 1 [Source:HGNC Symbol;Acc:HGNC:3308])

HSP 1 Score: 127.487 bits (319), Expect = 6.425e-33
Identity = 81/290 (27.93%), Postives = 129/290 (44.48%), Query Frame = 2
Query:  578 EIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGS-KLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEILKS 1438
            E   ++ GG +AG+NSWP  + L         + CGGTLI   WV+T AHC+                    D   +F V+ GDH+ S     E    +   ++HP + ++  +  YD+ALL+L   V  N  +    +PQ+     + S  C+  GWG  + N                        + +  LQ+  +P VD+  C       +  K+  +CAG   ++  C+GDSGG L CL      + ++G+T+F S+RGC +S    V+ +VS    WI  ++ S
Sbjct:   14 ETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCV--------------------DYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNS-PCYITGWGKTKTNG-----------------------QLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCL--VNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIAS 257          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: CTRL (chymotrypsin like [Source:HGNC Symbol;Acc:HGNC:2524])

HSP 1 Score: 124.79 bits (312), Expect = 7.774e-32
Identity = 88/296 (29.73%), Postives = 133/296 (44.93%), Query Frame = 2
Query:  548 LPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILK 1435
            +P I  +  +    +I  G++A   SWPW V L     +   + CGG+LI+  WV+T AHC  +  +                      V++G++DRS+ ++      +S  I HPS+ +   +N  DV LLKL SP      +S  C+    N  + E   C   GWG +                         TP     LQ+V +PLV   +C RQY   ++  D  +CAG     +C+GDSGG L C   K N+W L GI ++G+      +  VY RVS+ S WI +++ 
Sbjct:   21 IPAI--KPALSFSQRIVNGENAVLGSWPWQVSL---QDSSGFHFCGGSLISQSWVVTAAHCNVSPGR--------------------HFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNN--DVTLLKLASPAQYTTRISPVCL-ASSNEALTEGLTCVTTGWGRLS-------------------GVGNVTPAH---LQQVALPLVTVNQC-RQYWGSSIT-DSMICAGGAGASSCQGDSGGPLVC--QKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIA 262          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: CELA3B (chymotrypsin like elastase 3B [Source:HGNC Symbol;Acc:HGNC:15945])

HSP 1 Score: 119.013 bits (297), Expect = 9.901e-30
Identity = 80/289 (27.68%), Postives = 125/289 (43.25%), Query Frame = 2
Query:  584 QNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSH--FIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGM--SYGVYIRVSEVSMWITEILKS 1438
             +++  G+DA   SWPW V L         + CGG+LI P WV+T  HC+ +                      ++ V++G++DR+     E    ++     +HP +  +  +   D+AL+KL         +    +P   +   +E+  C+  GWG +  N P                     P K   LQE  +P+VD+E C R     +  K   +CAG  ++  C GDSGG L C   +   WQ++G+T+F SA GC       V+ RVS    WI E + S
Sbjct:   26 SSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSS--------------------RTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNET-PCYITGWGRLYTNGPL--------------------PDK---LQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPT-EDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIAS 269          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: PLG (plasminogen [Source:HGNC Symbol;Acc:HGNC:9071])

HSP 1 Score: 124.79 bits (312), Expect = 1.416e-29
Identity = 89/319 (27.90%), Postives = 144/319 (45.14%), Query Frame = 2
Query:  494 DIPECVKSNFSKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNR-AIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAG--SKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKSS 1441
            D+P+C   +F   G     PK C  R       + GG  A  +SWPW V L    R R  ++ CGGTLI+P WV+T AHCL+                 K+    S+ VI+G H       +    ++S   + P+ +        D+ALLKL SP      +   C+P   NY + +  +CF  GWG+ +        +F                  + +L+E ++P+++ + C R   +    +   +CAG  +   D+C+GDSGG L C +   + + L G+T++G         GVY+RVS    WI  +++++
Sbjct:  556 DVPQCAAPSFD-CGKPQVEPKKCPGR-------VVGGCVAHPHSWPWQVSL----RTRFGMHFCGGTLISPEWVLTAAHCLE-----------------KSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRK--------DIALLKLSSPAVITDKVIPACLP-SPNYVVADRTECFITGWGETQ-------GTF-----------------GAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFE--KDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN 810          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Match: OVCH2 (ovochymase 2 (gene/pseudogene) [Source:HGNC Symbol;Acc:HGNC:29970])

HSP 1 Score: 123.25 bits (308), Expect = 2.238e-29
Identity = 90/330 (27.27%), Postives = 146/330 (44.24%), Query Frame = 2
Query:  545 TLPKI--CGRRPMEIQ--------NKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFN--LNKDIHMCAG--SKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY------------GVYIRVSEVSMWITEILKSSTNEKN 1456
            +LPK   CG+  +++Q        ++I GG    K S+PW V L    + R  +ICGG++++P WVIT AHC+  ++ V+TL                 +V  G++D S T   E T  +   IIHP F      + YD+ALLK+         +   C+P+ +    +    C   GWG +                             S +LQEV +P++ +E+C          ++    +C G     +D C+GDSGG L C + K  +W L G+T++G   GCG  +            G++  +S+V  WI E +++    K+
Sbjct:   26 SLPKAPSCGQSLVKVQPWNYFNIFSRILGGSQVEKGSYPWQVSL----KQRQKHICGGSIVSPQWVITAAHCIANRNIVSTL-----------------NVTAGEYDLSQTDPGEQTLTIETVIIHPHFSTKKPMD-YDIALLKMAGAFQFGHFVGPICLPELRE-QFEAGFICTTAGWGRLTEGGVL-----------------------SQVLQEVNLPILTWEECVAALLTLKRPISGKTFLCTGFPDGGRDACQGDSGGSLMCRN-KKGAWTLAGVTSWG--LGCGRGWRNNVRKSDQGSPGIFTDISKVLPWIHEHIQTGNRRKS 306          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-1 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q23528])

HSP 1 Score: 88.5817 bits (218), Expect = 3.018e-19
Identity = 78/288 (27.08%), Postives = 124/288 (43.06%), Query Frame = 2
Query:  575 MEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYR-IFNLNKDIHMCAGSKLK--DTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGC---GMSYGVYIRVSEVSMWI 1420
            + + +++ GG ++  +SWPW V L         + CGG+LI+P +V+T AHC   KD+  T                S+ V +G H   + S + +T       IHP +   + S+ YD A++++  PV ++      C+P        E+  C   GWG           + E                 +  L+E+ +PL+    C      I  ++    +CAG      D+C+GDSGG L C   +   W+L G+ ++G   GC   GM  GVY  V   S WI
Sbjct:   52 VTLDHRLIGGSESSPHSWPWTVQLL---SRLGHHRCGGSLIDPNFVLTAAHCFA-KDRRPT----------------SYSVRVGGHRSGSGSPHRVTA----VSIHPWYNIGFPSS-YDFAIMRIHPPVNTSTTARPICLPSLPAV---ENRLCVVTGWGS----------TIEGSSL------------SAPTLREIHVPLLSTLFCSSLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMCA--RDGHWELTGVVSWG--IGCARPGMP-GVYGNVHSASTWI 284          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: svh-1 (HGF/MSP/plasminogen-like protein [Source:UniProtKB/TrEMBL;Acc:Q17800])

HSP 1 Score: 77.411 bits (189), Expect = 1.094e-14
Identity = 70/305 (22.95%), Postives = 127/305 (41.64%), Query Frame = 2
Query:  560 CGRRPMEIQNK---------IYGGDDAGKNSWPWHVGLYVIHRNRAI--YICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSP-VPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAG--SKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEIL 1432
            CG R +E+  +         + GG +    ++PW   L    RN+A   + CG ++++   +IT AHC +  ++V+                 S+ V++GD D + T  NE    L     +P ++  ++   +D+A+L++  P +  N      C+P  K++      +C   GWG +               + ER             LQ   IP+++   C    +I++       CAG      D+C+GDSGG   C   +  ++ L G+ ++G         G+Y  V+    WI+ I+
Sbjct:  693 CGLRYVEVNARDAAKSRIARVVGGFETVPGAFPWTAAL----RNKATKAHHCGASILDKTHLITAAHCFEEDERVS-----------------SYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKDIFS---HDIAILEIPYPGIEFNEYAQPICLP-SKDFVYTPGRQCVVSGWGSMGLR------------YAER-------------LQAALIPIINRFDCVNSSQIYSSMSRSAFCAGYLEGGIDSCQGDSGGPFACRR-EDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWISAII 946          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 62.003 bits (149), Expect = 2.174e-10
Identity = 71/298 (23.83%), Postives = 116/298 (38.93%), Query Frame = 2
Query:  590 KIYGGD--DAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHC---LKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPR--KSSILQEVEIPLVDFEKCKRQYRIFNLNK----DIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGC------GMSYGVYIRVSEVSMWITEIL 1432
            +I GG+  D G N   W   L     N    +CG T+I+  W++T AHC   L+T+  V                          + R   ++ E +  +    IH  +      N  D+ALL++ S + S +G+   C+    +  + +      +G+G                  L     +   P+   S  LQ   +P++  + C + +R  +L         +CAG+ L  T  GDSGG L          Q+ GIT++G A G       G   GVY R+S+   WI  ++
Sbjct:   37 RIIGGNSIDDGAN---WMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCALQLQTRSFV--------------------------YVREPKNNRERSFSVKEAYIHSGYNNQTADN--DIALLRISSDL-SKLGIKPVCLVHDDSKLLKQYKNGVVIGYG------------------LTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYLHGTAPGDSGGPLLIHKSNGEYVQI-GITSYG-ADGLDGVIDQGKFPGVYTRISKYVPWIQGVI 282          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 59.3066 bits (142), Expect = 1.119e-9
Identity = 62/267 (23.22%), Postives = 105/267 (39.33%), Query Frame = 2
Query:  677 ICGGTLINPGWVITTAHC---LKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPR--KSSILQEVEIPLVDFEKCKRQYRIFNLNK----DIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGC------GMSYGVYIRVSEVSMWITEIL 1432
            +CG T+I+  W++T AHC   L+T+  V                          + R   ++ E +  +    IH  +      N  D+ALL++ S + S +G+   C+    +  + +      +G+G                  L     +   P+   S  LQ   +P++  + C + +R  +L         +CAG+ L  T  GDSGG L          Q+ GIT++G A G       G   GVY R+S+   WI  ++
Sbjct:   15 LCGATVIDDFWLVTAAHCALQLQTRSFV--------------------------YVREPKNNRERSFSVKEAYIHSGYNNQTADN--DIALLRISSDL-SKLGIKPVCLVHDDSKLLKQYKNGVVIGYG------------------LTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYLHGTAPGDSGGPLLIHKSNGEYVQI-GITSYG-ADGLDGVIDQGKFPGVYTRISKYVPWIQGVI 232          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: CG10663 (gene:FBgn0036287 transcript:FBtr0346570)

HSP 1 Score: 125.561 bits (314), Expect = 2.740e-30
Identity = 83/301 (27.57%), Postives = 134/301 (44.52%), Query Frame = 2
Query:  563 GRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLK--DTCRGDSGGGLFCLDP--KTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKSSTNEK 1453
            GRR M    KI GG  A K  WPW V   +++R +  + CGGTLI P WV+T AHC++                          V IG+H+ +     E+  ++     HP+F      +  DVALL+L   V +   + + C+PQ     + ++  C  +GWG                      ++  R    +S+L +  +P++  + C++ Y  + + K++  CAG +    DTC GDSGG L C D     + W ++GIT+FG        +G+Y +V     W+  ++    N K
Sbjct:  497 GRRSMSNMLKIIGGRAARKGEWPWQVA--ILNRFKEAF-CGGTLIAPRWVLTAAHCVR----------------------KVLFVRIGEHNLNYEDGTEIQLRVMKSYTHPNFDKRTVDS--DVALLRLPKAVNATTWIGYSCLPQPFQ-ALPKNVDCTIIGWG----------------------KRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNM-FCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVNCDGNCK 746          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: CG10663 (gene:FBgn0036287 transcript:FBtr0113167)

HSP 1 Score: 125.561 bits (314), Expect = 2.740e-30
Identity = 83/301 (27.57%), Postives = 134/301 (44.52%), Query Frame = 2
Query:  563 GRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLK--DTCRGDSGGGLFCLDP--KTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKSSTNEK 1453
            GRR M    KI GG  A K  WPW V   +++R +  + CGGTLI P WV+T AHC++                          V IG+H+ +     E+  ++     HP+F      +  DVALL+L   V +   + + C+PQ     + ++  C  +GWG                      ++  R    +S+L +  +P++  + C++ Y  + + K++  CAG +    DTC GDSGG L C D     + W ++GIT+FG        +G+Y +V     W+  ++    N K
Sbjct:  497 GRRSMSNMLKIIGGRAARKGEWPWQVA--ILNRFKEAF-CGGTLIAPRWVLTAAHCVR----------------------KVLFVRIGEHNLNYEDGTEIQLRVMKSYTHPNFDKRTVDS--DVALLRLPKAVNATTWIGYSCLPQPFQ-ALPKNVDCTIIGWG----------------------KRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNM-FCAGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVVNCDGNCK 746          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: CG4998 (gene:FBgn0036612 transcript:FBtr0075377)

HSP 1 Score: 117.087 bits (292), Expect = 2.336e-27
Identity = 95/327 (29.05%), Postives = 146/327 (44.65%), Query Frame = 2
Query:  500 PECVKSNFSKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNE----MTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPV--PSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYR------IFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGM--SYGVYIRVSEVSMWITEILKS 1438
            P+     F + G V     I GR    I+N +Y   D+    +PWHV +       +IY CGGTLI+   +I+ AHC+K+++  +                    V +G+ D     D E    + R +    IHP + A    N  D+A+LKLD PV    N  +S  C+P K  Y+    A+C+  GWG               D F E  +         +IL+EV++P++  ++C+ Q R       + LN       G + KD C+GD GG L C   +  +  + G+ ++G   GCG     GVY++VS    WI +I +S
Sbjct:  617 PQAPPQQFGRCG-VRNAAGITGR----IKNPVYVDGDSEFGEYPWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIKSQNGFD------------------LRVRLGEWD--VNHDVEFFPYIERDVVSVHIHPEYYAGTLDN--DLAVLKLDQPVDFTKNPHISPACLPDK--YSDFTGARCWTTGWGK--------------DAFGEHGKYQ-------NILKEVDVPILSHQQCESQLRNTRLGYSYKLNPGFVCAGGEEGKDACKGDGGGPLVCD--RNGAMHVVGVVSWGI--GCGQVNVPGVYVKVSAYLPWIQQITQS 889          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: CG4998 (gene:FBgn0036612 transcript:FBtr0110866)

HSP 1 Score: 116.701 bits (291), Expect = 3.614e-27
Identity = 95/327 (29.05%), Postives = 146/327 (44.65%), Query Frame = 2
Query:  500 PECVKSNFSKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNE----MTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPV--PSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYR------IFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGM--SYGVYIRVSEVSMWITEILKS 1438
            P+     F + G V     I GR    I+N +Y   D+    +PWHV +       +IY CGGTLI+   +I+ AHC+K+++  +                    V +G+ D     D E    + R +    IHP + A    N  D+A+LKLD PV    N  +S  C+P K  Y+    A+C+  GWG               D F E  +         +IL+EV++P++  ++C+ Q R       + LN       G + KD C+GD GG L C   +  +  + G+ ++G   GCG     GVY++VS    WI +I +S
Sbjct:  911 PQAPPQQFGRCG-VRNAAGITGR----IKNPVYVDGDSEFGEYPWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIKSQNGFD------------------LRVRLGEWD--VNHDVEFFPYIERDVVSVHIHPEYYAGTLDN--DLAVLKLDQPVDFTKNPHISPACLPDK--YSDFTGARCWTTGWGK--------------DAFGEHGKYQ-------NILKEVDVPILSHQQCESQLRNTRLGYSYKLNPGFVCAGGEEGKDACKGDGGGPLVCD--RNGAMHVVGVVSWGI--GCGQVNVPGVYVKVSAYLPWIQQITQS 1183          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Match: Sp7 (gene:FBgn0037515 transcript:FBtr0081740)

HSP 1 Score: 110.923 bits (276), Expect = 2.525e-26
Identity = 90/316 (28.48%), Postives = 140/316 (44.30%), Query Frame = 2
Query:  524 SKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGL-YVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSD------NEMTRKLS--HFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAV-GWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNK-DIHMCAGSKL-KDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILK 1435
            + LGN+   P  CG  P    NK+Y G+D   + + W   L YV +R R    CGG+LIN  +V+T AHC+    +    E G L   R           +G++D S   D      N+   +L      +HP +     + ++D+ALL+LD PV  N  +   C+P         + +   V GWG                           T RKS+I Q +++P+ D + C R++   N++     +C G +  +D+C GDSGG L        +W   G+ +FG+  G     GVY RV++   WI E ++
Sbjct:  116 AGLGNLLPSPPKCG--PHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHCVIGAVET---EVGHLTTVR-----------LGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRTT------------------------TARKSTIKQRLDLPVNDHDYCARKFATRNIHLISSQLCVGGEFYRDSCDGDSGGPLM-RRGFDQAWYQEGVVSFGNRCGLEGWPGVYTRVADYMDWIVETIR 390          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: cela1.4 (chymotrypsin like elastase family member 1, tandem duplicate 4 [Source:ZFIN;Acc:ZDB-GENE-050626-127])

HSP 1 Score: 136.732 bits (343), Expect = 1.786e-36
Identity = 84/288 (29.17%), Postives = 135/288 (46.88%), Query Frame = 2
Query:  575 MEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEIL 1432
            + I+ ++ GG+ A  NSWPW + L  +      + CGGTLI PGWV+T AHC+                    D+  ++ VI+GDHD +    +E +  +S   IHP++  +  S+ YD+ALL+L +    N  +    +P      +  + +C+  GWG                       + +     SS L++  +P+VD   C R     ++ KD  +C+G      C+GDSGG L CL      + ++G+T+F SA GC  +    V+ RVS  + WI  I+
Sbjct:   24 LAIEERVVGGEVAKPNSWPWQISLQFLSALDYFHTCGGTLIRPGWVLTAAHCV--------------------DIPRNWRVILGDHDITKHEGHEQSLTVSRVYIHPNWNTDSVSSGYDIALLQLSTDATLNSYVQLATLP-PAGQVLPHNNECYITGWG-----------------------RTQTGGSTSSQLKQALLPVVDHNTCSRSDWWGSIVKDTMICSGGGEVSGCQGDSGGPLNCL--VNGKYVVHGVTSFVSAAGCNTNKKPTVFTRVSAYNSWINAII 265          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:123217 (zgc:123217 [Source:ZFIN;Acc:ZDB-GENE-051113-188])

HSP 1 Score: 130.568 bits (327), Expect = 1.492e-33
Identity = 96/293 (32.76%), Postives = 136/293 (46.42%), Query Frame = 2
Query:  560 CGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHC-LKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDI---HMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWI 1420
            CG  P+    +I GG DA   SWPW V ++  + NR  +ICGGTLI+  WV+T AHC + T   V TL  G+                      S  + NE+   L   I+HPSF  +  +N  D++L+KL  PV  +  +   C+    N        C+A GWG++                     K++  P   + LQ+V+IP+V    C  +Y   N N  I    +CAG   K TC+GDSGG   C   + + W   GIT++G++ GC +     VY RVSE   WI
Sbjct:   28 CGVAPLN--TRIVGGTDAPAGSWPWQVSIH--YNNR--HICGGTLIHSQWVMTAAHCIINTNINVWTLYLGR-----------------QTQSTSVANPNEVKVGLQSIIVHPSFNNSLLNN--DISLMKLSQPVNFSQYIRPICL-AANNSIFYNGTSCWATGWGNI--------------------GKDQALPAPQT-LQQVQIPVVANSLCSTEYESVN-NATITPQMICAGKANKGTCQGDSGGPFQC--KQGSVWIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWI 270          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:112160 (zgc:112160 [Source:ZFIN;Acc:ZDB-GENE-050417-229])

HSP 1 Score: 126.716 bits (317), Expect = 7.779e-33
Identity = 91/285 (31.93%), Postives = 133/285 (46.67%), Query Frame = 2
Query:  590 KIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDR--STTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKS 1438
            +I  G++A  +SWPW V L         + CGG+LIN  WV+T AHC                      +  S  VI+G+H++  S T ++  T K+S    HP + +N   N  D+AL+KL +P   N  +S  C+ +  +        C   GWG    N  +                   TP +   LQ+V +PL+  E CK  +   N+ +D  +CAG+    +C GDSGG L C   K N W L GI ++GS+R      GVY RV+E+  W+ +IL S
Sbjct:   33 RIVNGEEAVPHSWPWQVSL---QDFTGFHFCGGSLINEFWVVTAAHC---------------------SVRTSHRVILGEHNKGKSNTQEDIQTMKVSKVFTHPQYNSNTIEN--DIALVKLTAPASLNAHVSPVCLAEASD-NFASGMTCVTSGWGVTRYNALF-------------------TPDE---LQQVALPLLSNEDCKNHWG-SNI-RDTMICAGAAGASSCMGDSGGPLVC--QKDNIWTLVGIVSWGSSRCDPTMPGVYGRVTELRDWVDQILAS 264          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:112160 (zgc:112160 [Source:ZFIN;Acc:ZDB-GENE-050417-229])

HSP 1 Score: 126.716 bits (317), Expect = 7.779e-33
Identity = 91/285 (31.93%), Postives = 133/285 (46.67%), Query Frame = 2
Query:  590 KIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDR--STTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKS 1438
            +I  G++A  +SWPW V L         + CGG+LIN  WV+T AHC                      +  S  VI+G+H++  S T ++  T K+S    HP + +N   N  D+AL+KL +P   N  +S  C+ +  +        C   GWG    N  +                   TP +   LQ+V +PL+  E CK  +   N+ +D  +CAG+    +C GDSGG L C   K N W L GI ++GS+R      GVY RV+E+  W+ +IL S
Sbjct:   33 RIVNGEEAVPHSWPWQVSL---QDFTGFHFCGGSLINEFWVVTAAHC---------------------SVRTSHRVILGEHNKGKSNTQEDIQTMKVSKVFTHPQYNSNTIEN--DIALVKLTAPASLNAHVSPVCLAEASD-NFASGMTCVTSGWGVTRYNALF-------------------TPDE---LQQVALPLLSNEDCKNHWG-SNI-RDTMICAGAAGASSCMGDSGGPLVC--QKDNIWTLVGIVSWGSSRCDPTMPGVYGRVTELRDWVDQILAS 264          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Match: ctrl (chymotrypsin-like [Source:ZFIN;Acc:ZDB-GENE-040912-147])

HSP 1 Score: 124.405 bits (311), Expect = 6.291e-32
Identity = 84/284 (29.58%), Postives = 132/284 (46.48%), Query Frame = 2
Query:  587 NKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKS 1438
            N+I  G++A   SWPW V L    ++   + CGG+LIN  WV+T AHC                  R    Y   +VI+G+HDR +++++   + ++  I HP + +   +N  D+ LLKL SP      +S  C+      ++    +C   GWG                        +  +PR   ILQ+  +PL+   +CK QY   N   D  +CAG+    +C+GDSGG L C    + +W   GI ++G++     +  VY RVS +  WI +I+ S
Sbjct:   30 NRIVNGENAVSGSWPWQVSL---QQSNGFHFCGGSLINQYWVVTAAHC------------------RVQAGYH--YVILGEHDRGSSAESVQVKSIAKAITHPYYNSQNFNN--DITLLKLSSPAQLTSRISPVCLAASST-SIPSGTRCVTTGWGKT---------------------GSTSSPR---ILQQTALPLLSPAQCK-QYWGQNRITDAMICAGASGVSSCQGDSGGPLVC--ESSGAWYQVGIVSWGTSDCNVRTPAVYARVSYLRQWIDQIVAS 260          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: pag1 (phosphoprotein membrane anchor with glycosphingolipid microdomains 1 [Source:Xenbase;Acc:XB-GENE-5852172])

HSP 1 Score: 125.176 bits (313), Expect = 4.510e-32
Identity = 85/283 (30.04%), Postives = 130/283 (45.94%), Query Frame = 2
Query:  590 KIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKS 1438
            +I  G++A   SWPW V L         + CGG+L+N  WV+T AHC  T                      S  VI+G++DRS++++   T  +S    HP++  N   N  D+ LLKL S    N  ++  C+P       +   +C   GWG V+                     ++ +P K   LQ+V +PL+   +C+R +   N      +CAG+    +C GDSGG L C   +  +W L GI ++GS+     S GVY RVS +  W+ +I+ S
Sbjct:   33 RIVNGENAVSGSWPWQVSL---QDRTGFHFCGGSLVNNLWVVTAAHCGVTT---------------------SHRVILGEYDRSSSAEPIQTMSISRVFKHPNYNTNTMIN--DITLLKLSSTASFNSRVAPVCIPTSSE-VFNSPERCITTGWGYVD-------------------AYSKLSPNK---LQQVTLPLLSNTECQRYWG--NKIHSTMICAGASGASSCMGDSGGPLVC--ARNGAWVLAGIVSWGSSTCSPSSPGVYARVSTLRSWMDQIVAS 262          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000011466.1 (chymotrypsin-like elastase family member 2A [Source:NCBI gene;Acc:100498609])

HSP 1 Score: 124.79 bits (312), Expect = 1.113e-31
Identity = 79/286 (27.62%), Postives = 133/286 (46.50%), Query Frame = 2
Query:  581 IQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGS-KLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEI 1429
            +++++  G +   +SWPW V L  I+     + CGG+LI P WV+T AHC+ +                      ++ V +G H+   +   + T  +   I H  +  N  SN +D++L+KL+  V  +  +   C+P    Y +     C   GWG+++ N P                    +P K   LQ+  + +VDF  C ++   FN  K   +CAG   +  +C GDSGG L C +     W+++G+ +FGS+ GC  +    V+ RVS+ + WI E+
Sbjct:   31 VESRVVNGQEVAPHSWPWQVSLQYIYDGYWYHTCGGSLIAPNWVLTAAHCISSA--------------------YTYRVQLGKHNLRQSESGQKTINVIKLINHSKWNPNKLSNGFDISLIKLEEEVDYSDTIQPACLP-PAGYILPNQFGCHVTGWGNIQTNGP--------------------SPDK---LQQGLLLVVDFPTCSQRDWWFNSVKPNMICAGGDGIISSCYGDSGGPLNCKN-ADGGWEVHGVVSFGSSAGCNYAKKPSVFSRVSDYNSWIEEV 271          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000000210.1 (chymotrypsin-like elastase family member 2A [Source:NCBI gene;Acc:100498609])

HSP 1 Score: 124.405 bits (311), Expect = 1.280e-31
Identity = 79/286 (27.62%), Postives = 133/286 (46.50%), Query Frame = 2
Query:  581 IQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGS-KLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEI 1429
            +++++  G +   +SWPW V L  I+     + CGG+LI P WV+T AHC+ +                      ++ V +G H+   +   + T  +   I H  +  N  SN +D++L+KL+  V  +  +   C+P    Y +     C   GWG+++ N P                    +P K   LQ+  + +VDF  C ++   FN  K   +CAG   +  +C GDSGG L C +     W+++G+ +FGS+ GC  +    V+ RVS+ + WI E+
Sbjct:   23 VESRVVNGQEVAPHSWPWQVSLQYIYDGYWYHTCGGSLIAPNWVLTAAHCISSA--------------------YTYRVQLGKHNLRQSESGQKTINVIKLINHSKWNPNKLSNGFDISLIKLEEEVDYSDTIQPACLP-PAGYILPNQFGCHVTGWGNIQTNGP--------------------SPDK---LQQGLLLVVDFPTCSQRDWWFNSVKPNMICAGGDGIISSCYGDSGGPLNCKN-ADGGWEVHGVVSFGSSAGCNYAKKPSVFSRVSDYNSWIEEV 263          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000000226.1 (chymotrypsin-like elastase family member 2A [Source:NCBI gene;Acc:100498609])

HSP 1 Score: 124.405 bits (311), Expect = 1.385e-31
Identity = 79/286 (27.62%), Postives = 133/286 (46.50%), Query Frame = 2
Query:  581 IQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGS-KLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEI 1429
            +++++  G +   +SWPW V L  I+     + CGG+LI P WV+T AHC+ +                      ++ V +G H+   +   + T  +   I H  +  N  SN +D++L+KL+  V  +  +   C+P    Y +     C   GWG+++ N P                    +P K   LQ+  + +VDF  C ++   FN  K   +CAG   +  +C GDSGG L C +     W+++G+ +FGS+ GC  +    V+ RVS+ + WI E+
Sbjct:   35 VESRVVNGQEVAPHSWPWQVSLQYIYDGYWYHTCGGSLIAPNWVLTAAHCISSA--------------------YTYRVQLGKHNLRQSESGQKTINVIKLINHSKWNPNKLSNGFDISLIKLEEEVDYSDTIQPACLP-PAGYILPNQFGCHVTGWGNIQTNGP--------------------SPDK---LQQGLLLVVDFPTCSQRDWWFNSVKPNMICAGGDGIISSCYGDSGGPLNCKN-ADGGWEVHGVVSFGSSAGCNYAKKPSVFSRVSDYNSWIEEV 275          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Match: rgs8 (regulator of G-protein signaling 8 [Source:Xenbase;Acc:XB-GENE-990044])

HSP 1 Score: 126.331 bits (316), Expect = 4.820e-30
Identity = 97/315 (30.79%), Postives = 149/315 (47.30%), Query Frame = 2
Query:  551 PKICGRR--PMEIQNKIYGGDDAGKNSWPWHVGLYV--IHRNRAIYI--CGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNL-YDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKR-QYRIFNLNKDIHMCAG----SKLKDTCRGDSGGGLFCLDPKTNS---WQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEILKSST 1444
            P  CG+   P +I  +I  G+ A  ++WPW V + V    RN  I+   CGGTLI+  W++T AHC      +N            ++LY  + + +G H+ +     E   K+     H  F       L +DVAL+K+D  V ++  + F C+P   +  ++ + +C A GWGD                       N   P+ +  L +V +P++ +E CK  QY  F L + + +CAG     +LK  C+GDSGG L C  P T+    W+++GIT+FG   GC M     V+ R S    WI +I+K  T
Sbjct:  542 PNTCGKPTYPPQINTRIVNGEPAAPHTWPWQVSMQVWPSSRNETIFFHTCGGTLIHKNWILTAAHCF-----IN----------YADELY-RWQMCLGKHNLTLVEPTEKCFKVLGIYRHELFVYPEIPALEFDVALVKIDGEVAASDVIDFACLP-PYDEVLNPNYRCHATGWGDE--------------------TGNSAAPKVAESLNQVVLPVIPYETCKTPQYWWFQLKQSM-ICAGYILPDELKSVCQGDSGGPLVC--PSTSQSGIWEVHGITSFGPI-GCIMDKKPSVFTRASAHLDWIDQIIKKDT 815          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Ctrl (chymotrypsin-like [Source:MGI Symbol;Acc:MGI:88558])

HSP 1 Score: 129.413 bits (324), Expect = 1.076e-33
Identity = 86/287 (29.97%), Postives = 130/287 (45.30%), Query Frame = 2
Query:  575 MEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILK 1435
            +    +I  G++A   SWPW V L     N   + CGG+LI+P WV+T AHC  T  +                      V++G++DRS+ ++      ++  I HP++ AN  +N  D+ LLKL SP      +S  C+    N  +     C   GWG +                         TP +   LQ+V +PLV   +C RQY    +  D  +CAG     +C+GDSGG L C   K N+W L GI ++G+      +  +Y RVS+ S WI +++ 
Sbjct:   28 LSYNQRIVNGENAVPGSWPWQVSL---QDNTGFHFCGGSLISPNWVVTAAHCQVTPGR--------------------HFVVLGEYDRSSNAEPVQVLSIARAITHPNWNANTMNN--DLTLLKLASPARYTAQVSPVCL-ASTNEALPSGLTCVTTGWGRIS-------------------GVGNVTPAR---LQQVVLPLVTVNQC-RQYWGARI-TDAMICAGGSGASSCQGDSGGPLVCQ--KGNTWVLIGIVSWGTKNCNIQAPAMYTRVSKFSTWINQVMA 262          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Cela2a (chymotrypsin-like elastase family, member 2A [Source:MGI Symbol;Acc:MGI:95316])

HSP 1 Score: 125.176 bits (313), Expect = 4.293e-32
Identity = 80/298 (26.85%), Postives = 128/298 (42.95%), Query Frame = 2
Query:  560 CGRRPMEIQN---KIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGS-KLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEILK 1435
            CG    E+++   ++ GG +A  N+WPW V L V+   R  + CGG+L+   WV+T AHCL                      Y ++ V++G H  S         ++S  ++H  + +    N YD+AL+KL SPV  +  +   C+P      +  +  C+  GWG ++ N                             L++  + +VD+  C       +  K   +CAG   +  +C GDSGG L C       WQ++GI +FGS+ GC       V+ RVS    WI  ++ 
Sbjct:   17 CGYPTYEVEDDVSRVVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSN--------------------YQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLP-PAGTILPRNYVCYVTGWGLLQTNG-----------------------NSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNC-RASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMA 269          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Cela3b (chymotrypsin-like elastase family, member 3B [Source:MGI Symbol;Acc:MGI:1915118])

HSP 1 Score: 124.405 bits (311), Expect = 7.194e-32
Identity = 84/298 (28.19%), Postives = 130/298 (43.62%), Query Frame = 2
Query:  560 CGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKL--SHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLN-KDIHMCAGSKLKDTCRGDSGGGLFCLDPKTN-SWQLYGITNFGSARGCGM--SYGVYIRVSEVSMWITEILK 1435
            CG+      +++  G++A  +SWPW V L         + CGG+LI P WV+T  HC+ T                      ++ V++G+H+R      E    +      +HP + +   S   D+AL+KL         +   C+P      +   A C+  GWG +  N P                     P K   LQ+  +P+VD+E C R +  + L+ K   +CAG  ++  C GDSGG L C  P  N +WQ++G+T+F S+ GC       V+ RVS    WI E + 
Sbjct:   17 CGQPSHNPSSRVVNGEEAVPHSWPWQVSLQYEKDGSFHHTCGGSLITPDWVLTAGHCISTS--------------------RTYQVVLGEHERGVEEGQEQVIPINAGDLFVHPKWNSMCVSCGNDIALVKLSRSAQLGDAVQLACLP-PAGEILPNGAPCYISGWGRLSTNGPL--------------------PDK---LQQALLPVVDYEHCSR-WNWWGLSVKTTMVCAGGDIQSGCNGDSGGPLNC--PADNGTWQVHGVTSFVSSLGCNTLRKPTVFTRVSAFIDWIEETIA 267          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Prss30 (protease, serine 30 [Source:MGI Symbol;Acc:MGI:1353645])

HSP 1 Score: 120.168 bits (300), Expect = 5.145e-30
Identity = 94/311 (30.23%), Postives = 139/311 (44.69%), Query Frame = 2
Query:  548 LPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSF-HVIIGDHDRSTTSDNEMTRKLSHFIIHPSFR-ANYTSNLYDVALLKLDSPV-PSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFN--------LNKDIHMCAG--SKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEILK 1435
            LP +CG        KI GG DA +  WPW V L++       +ICGG+LI+  WV+T AHC                   +  L  SF HV +G    S    +     + +  +HP++  A+ +S   D+AL++LD+P+ PS    +  C+P  +   +     C+  GWG  +  +                         +S+LQE+ +PL+D E C++ Y            +  D+ +CAG     KD+C+GDSGG L C     +SW   GIT++G   GC   Y  GVY RV     WI  IL 
Sbjct:   24 LPSVCGHS--RDAGKIVGGQDALEGQWPWQVSLWITEDG---HICGGSLIHEVWVLTAAHCF------------------RRSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSG--DIALVQLDTPLRPSQ--FTPVCLPAAQT-PLTPGTVCWVTGWGATQERD------------------------MASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDM-LCAGYVEGQKDSCQGDSGGPLVC--SINSSWTQVGITSWG--IGCARPYRPGVYTRVPTYVDWIQRILA 277          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Match: Prss30 (protease, serine 30 [Source:MGI Symbol;Acc:MGI:1353645])

HSP 1 Score: 120.168 bits (300), Expect = 5.145e-30
Identity = 94/311 (30.23%), Postives = 139/311 (44.69%), Query Frame = 2
Query:  548 LPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSF-HVIIGDHDRSTTSDNEMTRKLSHFIIHPSFR-ANYTSNLYDVALLKLDSPV-PSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFN--------LNKDIHMCAG--SKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEILK 1435
            LP +CG        KI GG DA +  WPW V L++       +ICGG+LI+  WV+T AHC                   +  L  SF HV +G    S    +     + +  +HP++  A+ +S   D+AL++LD+P+ PS    +  C+P  +   +     C+  GWG  +  +                         +S+LQE+ +PL+D E C++ Y            +  D+ +CAG     KD+C+GDSGG L C     +SW   GIT++G   GC   Y  GVY RV     WI  IL 
Sbjct:   24 LPSVCGHS--RDAGKIVGGQDALEGQWPWQVSLWITEDG---HICGGSLIHEVWVLTAAHCF------------------RRSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSG--DIALVQLDTPLRPSQ--FTPVCLPAAQT-PLTPGTVCWVTGWGATQERD------------------------MASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDM-LCAGYVEGQKDSCQGDSGGPLVC--SINSSWTQVGITSWG--IGCARPYRPGVYTRVPTYVDWIQRILA 277          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P08419|CEL2A_PIG (Chymotrypsin-like elastase family member 2A OS=Sus scrofa OX=9823 GN=CELA2A PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.013e-33
Identity = 84/285 (29.47%), Postives = 130/285 (45.61%), Query Frame = 2
Query:  590 KIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGS-KLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEILK 1435
            ++ GG+DA  NSWPW V L      +  + CGGTL++  WV+T AHC+ +                      ++ V++G H  ST     +  K+S  ++H  + +N  SN  D+ALLKL SPV     +   C+P      +  +  C+  GWG                    R + N  +P    ILQ+ ++ +VD+  C +     +  K   +CAG   +  +C GDSGG L C       WQ++GI +FGS+ GC   +   V+ RVS    WI  ++ 
Sbjct:   28 RVVGGEDARPNSWPWQVSLQYDSSGQWRHTCGGTLVDQSWVLTAAHCISSS--------------------RTYRVVLGRHSLSTNEPGSLAVKVSKLVVHQDWNSNQLSNGNDIALLKLASPVSLTDKIQLGCLP-AAGTILPNNYVCYVTGWG--------------------RLQTNGASP---DILQQGQLLVVDYATCSKPGWWGSTVKTNMICAGGDGIISSCNGDSGGPLNC-QGANGQWQVHGIVSFGSSLGCNYYHKPSVFTRVSNYIDWINSVIA 267          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P00774|CEL2A_RAT (Chymotrypsin-like elastase family member 2A OS=Rattus norvegicus OX=10116 GN=Cela2a PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 5.267e-33
Identity = 84/298 (28.19%), Postives = 130/298 (43.62%), Query Frame = 2
Query:  560 CGRRPMEIQ---NKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGS-KLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEILK 1435
            CG    E+Q   +++ GG +A  NSWPW V L  +   +  + CGG+L+   WV+T AHC+                        ++ V++G H  ST+    +  ++S  ++H  + A   SN  D+AL+KL SPV     +   C+P      +  +  C+  GWG                    R + N  TP    +LQ+  + +VD+  C       +  K   +CAG   +  +C GDSGG L C       WQ++GI +FGS  GC       V+ RVS    WI  ++ 
Sbjct:   17 CGYPTYEVQHDVSRVVGGQEASPNSWPWQVSLQYLSSGKWHHTCGGSLVANNWVLTAAHCISNS--------------------RTYRVLLGRHSLSTSESGSLAVQVSKLVVHEKWNAQKLSNGNDIALVKLASPVALTSKIQTACLP-PAGTILPNNYPCYVTGWG--------------------RLQTNGATP---DVLQQGRLLVVDYATCSSASWWGSSVKTNMVCAGGDGVTSSCNGDSGGPLNC-QASNGQWQVHGIVSFGSTLGCNYPRKPSVFTRVSNYIDWINSVIA 269          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P80646|CTRB_GADMO (Chymotrypsin B OS=Gadus morhua OX=8049 PE=1 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 6.906e-33
Identity = 89/297 (29.97%), Postives = 138/297 (46.46%), Query Frame = 2
Query:  560 CGRRPMEIQ----NKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKS 1438
            CG   ++ Q     +I  G++A  +SWPW V L    ++   + CGG+LIN  WV+T AHC                     ++     VI+G+HD++ + +N    K S    HP + +   +N  D++L+KL SP      +S  C+ +  +       KC   GWG    N P                    TP K   LQ+  +PL+  E+C + +   N+  D+ +CAG+    +C GDSGG L C   K N W L GI ++GS+R    +  VY RV+E+  W+ +IL +
Sbjct:    1 CGSPAIQPQVTGYARIVNGEEAVPHSWPWQVSL---QQSNGFHFCGGSLINENWVVTAAHC---------------------NVRTYHRVIVGEHDKA-SDENIQILKPSMVFTHPKWDSRTINN--DISLIKLASPAVLGTNVSPVCLGESSD-VFAPGMKCVTSGWGLTRYNAP-------------------GTPNK---LQQAALPLMSNEECSQTWG-NNMISDVMICAGAAGATSCMGDSGGPLVCQ--KDNVWTLVGIVSWGSSRCSVTTPAVYARVTELRGWVDQILAA 244          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|O46644|CELA1_MACFA (Chymotrypsin-like elastase family member 1 OS=Macaca fascicularis OX=9541 GN=CELA1 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.323e-32
Identity = 83/290 (28.62%), Postives = 132/290 (45.52%), Query Frame = 2
Query:  578 EIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGS-KLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEILKS 1438
            E   ++ GG +AG+NSWP  + L  +      + CGGTLI   WV+T AHC               +D+ K     +F V++GDH+ S     E    +   ++HP + +N  +  YD+ALL+L   V  N  +    +PQ+     ++S  C+  GWG  + N                        + +  LQ+  +P VD+  C       +  K+  +CAG   +   C+GDSGG L CL      + ++G+T+F S +GC +S    V+ RVS    WI + + S
Sbjct:   22 ETNARVVGGTEAGRNSWPSQISLQYLSGGSWYHTCGGTLIRQNWVMTAAHC---------------VDSPK-----TFRVVVGDHNLSQNDGTEQYVSVQKIVVHPYWNSNNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANDS-PCYITGWGRTKTNG-----------------------QLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVHSGCQGDSGGPLHCL--VNGKYSVHGVTSFVSKQGCNVSRKPTVFTRVSAYISWINKTIAS 265          
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UNI1|CELA1_HUMAN (Chymotrypsin-like elastase family member 1 OS=Homo sapiens OX=9606 GN=CELA1 PE=1 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 3.085e-32
Identity = 81/290 (27.93%), Postives = 129/290 (44.48%), Query Frame = 2
Query:  578 EIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGS-KLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEILKS 1438
            E   ++ GG +AG+NSWP  + L         + CGGTLI   WV+T AHC+                    D   +F V+ GDH+ S     E    +   ++HP + ++  +  YD+ALL+L   V  N  +    +PQ+     + S  C+  GWG  + N                        + +  LQ+  +P VD+  C       +  K+  +CAG   ++  C+GDSGG L CL      + ++G+T+F S+RGC +S    V+ +VS    WI  ++ S
Sbjct:   14 ETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGTLIRQNWVMTAAHCV--------------------DYQKTFRVVAGDHNLSQNDGTEQYVSVQKIVVHPYWNSDNVAAGYDIALLRLAQSVTLNSYVQLGVLPQEGAILANNS-PCYITGWGKTKTNG-----------------------QLAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCL--VNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIAS 257          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A0V0J9M6 (Chymotrypsin-like elastase family member 2A (Fragment) OS=Schistocephalus solidus OX=70667 GN=CEL2A PE=3 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 1.007e-82
Identity = 170/479 (35.49%), Postives = 246/479 (51.36%), Query Frame = 2
Query:   80 ELCNSIMRWIITLLAVAMIVILSEIVSTRHLKSSHNLNRRRFNKFWDNDGDEEFKERRKYQRRYGERKYTRLMLSRKMFYYWTSNYDNWTNWTACSPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSNFSKLGNVSTLPKICGRRPME--IQNKIYGGDDAGKNSWPWHVGLYVIHRN---RAIY---------ICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRK-NDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEF-------DYFLERW------RKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEIL 1432
            E  N I   I+ LL +A ++I S +V ++++++      R       +  +++F  +  + R         L+L R++  Y  + Y  W++W  CS ++CT+ R+R+CKD S+E  + D    K CP  +I E   C D   C     S+L  +  L   CG R ++   Q KI GG  A  +SWPW   LY   RN   RA Y          CGGTLI P WV+T AHCL        L  G+     +  D+       +GDH RS     +    +   IIHP +R  ++ N +DVALLKL         +   CVP K N ++ E   C+A GWGD+  ++  +   F+F       D+F+  +      R++RR P++   L EVE+PLV  ++C+R +   NL + +H+CAG+K KDTCRGDSGGGLFC +P    W LYG+T+FGS RGCG  YGVY     +S WI  IL
Sbjct:   14 ERSNRIPGSIVPLL-LAQLLIASCLVDSQNVETPE----RDLMDPMASQTEDKFFTQYVFDR-------NTLILRRRIMLYKDNLYTEWSDWGNCSVKDCTEFRFRRCKDESYENRITDLFRTKSCPFLYIAETRECRDTSLCKADGPSEL--LKNLSTTCGVRNVDAPFQTKILGGKTAVPHSWPWQAALYAGMRNAGLRAHYSRRKYIEAPFCGGTLIAPSWVVTAAHCLTELIPHKELPIGQPFSIEEVGDII--VRARLGDHSRSVIEKKQRDHNIQTAIIHPDYRRGFSENGFDVALLKLAEDAEFQETIGHICVPDK-NMSLPEGLVCYAAGWGDMSADSAQDNNFFDFIYGTGLSDFFVNPFFNQQPPRRSRR-PQQPLQLVEVELPLVSLQRCRRYFN--NLREGVHVCAGAKGKDTCRGDSGGGLFCQNPVDKRWYLYGVTSFGSGRGCGKYYGVYTCTRGISDWIHGIL 472          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: U6JH05 (Enteropeptidase OS=Echinococcus granulosus OX=6210 GN=EGR_06280 PE=3 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 1.476e-81
Identity = 157/411 (38.20%), Postives = 217/411 (52.80%), Query Frame = 2
Query:  293 LMLSRKMFYYWTSNYDNWTNWTACSPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSNFSKLGNVSTLPKICGRRP-----MEIQNKIYGGDDAGKNSWPWHVGLYV---IHRNRAIY-------ICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRST-TSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEF-DYFL-----------ERWRKNRRT--PRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILK 1435
            L+L RK+F Y    Y  W+ W+ CS R+CT+ RYR+C ++S+E  + +      CP +FI E   C +   C K   SKL  +  L   CG+RP       +  KI GG +A  +SWPW V LYV   +   R++         CG TLI P W+IT AHCL        L  G      + +L  +    IGDH R      +E+TR++   IIHP +R  ++   +DVALLKLD PV     +S  C+P +  + + E   C+A GWG   P+         F D+F            +    NRR   PR+   L EV++PLV  ++C+R +R  NL + +H+CAG K KDTCRGDSGGGLFC +P+   W +YG+T+FGS  GCG  YGVY     +S WI E +K
Sbjct:   53 LLLRRKIFIYKNELYTPWSEWSNCSTRDCTELRYRQCLNDSYESWIPNLFQTNNCPFQFIAETRRCTNDAGCRKEAPSKL--LKELSSTCGKRPNFKGKRGVSPKILGGREAKPHSWPWQVALYVRPLVVEGRSLRSPAIESPFCGATLIAPSWLITAAHCLSELVPDKVLTVGHFFSV-EEELEQTIRARIGDHVRGKRDGSHEVTRQIELAIIHPDYRRGFSEQGFDVALLKLDQPVEFGDKVSSICIPNRSLH-LPEGQICYAAGWGATAPDTAVLPEPLGFIDFFSGGLFPRPCGLGQTLASNRRCRGPRQPLRLLEVDLPLVSLQRCRRTFR--NLREWVHICAGEKGKDTCRGDSGGGLFCQNPEDGRWYIYGVTSFGSVLGCGEHYGVYACTRGISDWIHENVK 457          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A087VY24 (Mastin OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000085400 PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 4.531e-81
Identity = 158/414 (38.16%), Postives = 216/414 (52.17%), Query Frame = 2
Query:  293 LMLSRKMFYYWTSNYDNWTNWTACSPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSNFSKLGNVSTLPKICGRRP-----MEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIY------------ICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRST-TSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEF-DYF--------------LERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILK 1435
            L+L RK+F Y    Y  W+ W+ CS R+CT+ RYR+C ++S+E  + +      CP +FI E   C +   C K   SKL  +  L   CG+RP       +  KI GG +A  +SWPW V LYV  R  A+              CG TLI P W+IT AHCL        L  G      + +L  + H  IGDH R      +E+TR++   I HP +R  ++   +DVALLKLD PV     +S  C+P +  + + E   C+A GWG   P+         F D+F              L   R+ R  PR+   L EV++PLV  ++C+R +R  NL + +H+CAG K KDTCRGDSGGGLFC +P+   W +YG+T+FGS  GCG  YGVY     +S WI E +K
Sbjct:   53 LLLRRKIFIYKNELYTPWSEWSNCSTRDCTELRYRQCLNDSYESWIPNLFQTNNCPFQFIAETRRCTNDAGCRKEAPSKL--LKELSSTCGKRPNFKGKRGVSPKILGGREAKPHSWPWQVALYV--RPLAVEGRSLRSPTIESPFCGATLIAPSWLITAAHCLSELVPDKVLTVGHFFSV-EEELEQTIHARIGDHVRGKRDGSHEVTRQIELAITHPDYRRGFSEQGFDVALLKLDQPVEFGDKVSSICIPNRSLH-LPEGQICYAAGWGATAPDTSVLPEPLGFIDFFSGGLFPRPCGLGQTLASSRRCR-GPRQPLRLLEVDLPLVSLQRCRRTFR--NLREWVHICAGEKGKDTCRGDSGGGLFCQNPEDGRWYIYGVTSFGSVLGCGEHYGVYACTRGISDWIHENVK 457          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A158R6J8 (Peptidase S1 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS358 PE=3 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 8.081e-81
Identity = 154/403 (38.21%), Postives = 215/403 (53.35%), Query Frame = 2
Query:  293 LMLSRKMFYYWTSNYDNWTNWTACSPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSNFSKLGNVSTLPKICGRRP-----MEIQNKIYGGDDAGKNSWPWHVGLYVI------HRNRAIYI----CGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRST-TSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEF-DYF----------LERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWI 1420
            L+L RK+F +    Y  W++W+ CS R+CT+ RYR+C ++S+E  + +      CP ++I E   C +  EC K   SK+  +  L   CG+RP          KI GG +A  +SWPW V LYV         +R+  I    CG TLI P W+IT AHCL        L  G++    + +L  S    IGDH R       E++R +   IIHP +R  ++   +DVALLKLD PV     +S  C+P K  + + E   C+A GWG   P+         F D+F          L +  +  R PR+   L EV++PLV  ++C+R +R  NL + +H+CAG K KDTCRGDSGGGLFC +P+   W +YG+T+FGS  GCG  YGVY     +S WI
Sbjct:   53 LLLRRKIFIFRNELYTPWSDWSNCSTRDCTELRYRQCLNDSYENYIPNLFRTNNCPFQYIVETRRCANDAECHKEAPSKI--LKELASTCGKRPNFKSKRGTSPKILGGREAKPHSWPWQVALYVRPLAVEGRSSRSATIESPFCGATLIAPSWLITAAHCLSELVPDKVLTVGQVFSV-EEELEQSIRARIGDHVRGRRDGPQEVSRLIELAIIHPDYRRGFSEQGFDVALLKLDEPVEFGDKVSPICIPDKSLH-LPEGHTCYAAGWGATSPDTAVLPEPLGFIDFFSASLFPRPCGLGQSNRRCRGPRQPLRLLEVDLPLVSLQRCRRTFR--NLREWVHVCAGEKGKDTCRGDSGGGLFCQNPEDGKWYIYGVTSFGSVVGCGEHYGVYACTRGISDWI 449          
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Match: A0A0R3X081 (Peptidase S1 domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS6494 PE=3 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 9.014e-81
Identity = 156/407 (38.33%), Postives = 218/407 (53.56%), Query Frame = 2
Query:  293 LMLSRKMFYYWTSNYDNWTNWTACSPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSNFSKLGNVSTLPKICGRRP-----MEIQNKIYGGDDAGKNSWPWHVGLYV---IHRNRAIY------ICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRST-TSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEF-DYFL-----------ERWRKNRRT--PRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITE 1426
            L+L RK+F +    Y  W+ W+ CS R+CT+ RYR+C ++S+E  + +      CP ++I E   C +  EC K   SK+ N   L   CG+RP       + +KI GG +A  +SWPW V LYV   +   R+         CG TLI P W+IT AHCL        L  G++    + +L  S    IGDH R       E++R +   IIHP +R  ++   +DVALLKLD PV  +  +S  C+P +  + + E   C+A GWG   P+       F F D+F            +    NRR   PR+   L EV++PLV  ++C+R +R  NL + +H+CAG K KDTCRGDSGGGLFC +P+   W +YG+T+FGS  GCG  YGVY     +S WI E
Sbjct:   53 LVLRRKIFIFRAELYTPWSKWSNCSTRDCTELRYRQCMNDSYENPIPNLFRTNNCPFQYIVETRRCVNDSECHKDAPSKILN--ELSDTCGKRPNFKSKRGVLSKILGGREAKPHSWPWQVALYVRTPVVEGRSSRSAIESPFCGATLIAPSWLITAAHCLSELVPDKVLTVGQIFSV-EEELELSIRARIGDHIRGRRDGPQEVSRLIELAIIHPDYRRGFSEQGFDVALLKLDEPVEFSEKVSSICIPDRSLH-LPEGHTCYAAGWGATSPDTTVLPEPFGFIDFFSASLFPRPCGLGQSSASNRRCRGPRQPLRLLEVDLPLVSLQRCRRTFR--NLREWVHVCAGEKGKDTCRGDSGGGLFCQNPEDGRWYIYGVTSFGSVLGCGEHYGVYACTRGISDWIHE 453          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-32n7.9 (chymotrypsin-like protease CTRL-1 [Source:NCBI gene;Acc:103029386])

HSP 1 Score: 135.191 bits (339), Expect = 2.443e-35
Identity = 93/298 (31.21%), Postives = 147/298 (49.33%), Query Frame = 2
Query:  560 CGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRI---FNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKSST 1444
            CG  P+    +I GG +A   +WPW V ++  H+++  +ICGGTLI+  WV+T AHC+ + D  N + +                  +G  ++ST + NE++R +   I+HPS+     +N  DV L++L SPV  +  +   C+    + T   +  C++ GWG +  N                          S  LQEVE+P+V   +C   Y++    N+   + +CAGS  K TC+GDSGG L C   + + W   G+T++G +   G+   VY RVSE   WITE +  S+
Sbjct:   28 CGFAPLN--TRIVGGANAQAGNWPWQVSMH--HQDQ--HICGGTLIHQEWVLTAAHCILSLDTSNWMLY------------------LGRENQSTANPNEVSRGVQEIIMHPSYNNTLFNN--DVTLMRLSSPVNFSDYIRPICLASNSS-TFYSNTTCWSTGWGLLRHNESL----------------------ASETLQEVEVPVVGNSQCACNYQVAKDANITAQM-ICAGSAGKGTCQGDSGGPLQC--KQGSVWVQAGVTSYGISCAAGIPE-VYARVSEFQSWITENVAGSS 272          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048530.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:20283923:20290642:1 gene:ENSAMXG00000040955.1 transcript:ENSAMXT00000048530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 6.776e-34
Identity = 94/297 (31.65%), Postives = 140/297 (47.14%), Query Frame = 2
Query:  560 CGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAG--SKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMS--YGVYIRVSEVSMWITEILKS 1438
            CG R      ++ GG DA +  WPW   L V  R    +ICGG LI   WV++ AHC    D++ +                 + V +G      TS  E   +LSH  IH  +  +  ++ YD+ALL+LD PV +       C+P    + ++    C+  GWG ++                      +R P  S++LQ+V++ LV  E C R Y      +   +CAG  S  KD C+GDSGG L C +P +  W L G+ ++G  RGCG    YGVY R++ +S WI +++ S
Sbjct:   20 CGLR--HFTTRVVGGADAVEGEWPWQASLQVSGR----HICGGALIASQWVVSAAHCFY-DDRLYSPSV--------------WTVYLGKLRLRGTSQTEEALRLSHIHIHQYY--DDENHDYDLALLRLDRPVSAGTLAQPACLP-SHTHQLEPGLLCWVTGWGAMKEGG------------------EKRGP--SNVLQKVDVRLVSEEACVRSYGYIITPR--MLCAGYRSGGKDACQGDSGGPLVCQEP-SGRWFLAGVVSWG--RGCGRPDYYGVYTRITRLSDWIKQVISS 267          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000014359.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:20902992:20905615:-1 gene:ENSAMXG00000013952.2 transcript:ENSAMXT00000014359.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.257 bits (321), Expect = 3.752e-33
Identity = 85/283 (30.04%), Postives = 128/283 (45.23%), Query Frame = 2
Query:  590 KIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKS 1438
            +I  G++A  +SWPW V L     +   + CGG+L+N  WV+T AHC                      +  S +VI+G+HDRS+ ++   T ++   I HPS+ +N  +N  D+ L+KL S    N  +S  C+P   +       KC   GWG                  L R+      PR    LQ+  +PL+    C+R +        + +CAG+    +C GDSGG L C   K   W L G+ ++GS+     S GVY RV+    WI + + S
Sbjct:   61 RIVNGEEAVPHSWPWQVSL---QDSTGWHFCGGSLVNQNWVVTAAHC---------------------GVRTSHYVILGEHDRSSNAEAIQTLRIGKVIQHPSYNSNTINN--DITLVKLASTAQLNTRVSPVCLPASSD-DYAGGLKCVTTGWG------------------LTRYNAANTPPR----LQQTALPLLTNSNCQRYWGTS--ITSVMICAGAAGASSCMGDSGGPLVC--QKGGVWNLVGVVSWGSSTCSTSSPGVYARVTSFRSWIDQTIAS 290          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000014374.2 (chymotrypsinogen A-like [Source:NCBI gene;Acc:103033709])

HSP 1 Score: 127.487 bits (319), Expect = 4.031e-33
Identity = 86/283 (30.39%), Postives = 129/283 (45.58%), Query Frame = 2
Query:  590 KIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKS 1438
            +I  G++A  +SWPW V L     +   + CGG+L+N  WV+T AHC                      +  S +VI+G+HDRS+ ++   T ++   I HPS+ +N  +N  DV L+KL S    N  +S  C+P   +       KC   GWG                  L R+      PR    LQ+  +PL+    C+R +   +    + +CAG+    +C GDSGG L C   K   W L G+ ++GS+     S GVY RV+    WI + + S
Sbjct:   33 RIVNGEEAVPHSWPWQVSL---QDSTGWHFCGGSLLNQNWVLTAAHC---------------------GVRTSHYVILGEHDRSSNAEAIQTLRIGKVIQHPSYNSNTINN--DVTLIKLASTAQLNTRVSPVCLPASSD-DYAGGLKCVTTGWG------------------LTRYNAANTPPR----LQQTALPLLTNSNCQRYWG--SSITSVMVCAGAAGSSSCMGDSGGPLVC--QKGGVWNLVGVVSWGSSTCSTSSPGVYARVTSFRSWIDQTIAS 262          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000018418.2 (plasminogen [Source:NCBI gene;Acc:103036400])

HSP 1 Score: 134.035 bits (336), Expect = 6.399e-33
Identity = 95/317 (29.97%), Postives = 145/317 (45.74%), Query Frame = 2
Query:  497 IPEC-VKSNFSKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNR-AIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGS--KLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILK 1435
            IPEC + + + K G  +  P+ C  R       I GG  +  +SWPW + L    R+R  ++ CGGTLI+  WV+T AHCL+               +R+   Y    V +G H  + T  ++  R +   ++ P+ +        D+ALLKLD P   N  +S  C+P  K+Y +    +C+  GWGD +                              +L+E   P+++ + C R   + N  KD  MCAG+     D+C+GDSGG L C     N++ L G+T++G      M  GVY RVS+   WI +  K
Sbjct:  562 IPECALDTEYLKCGQPAVKPRRCFGR-------IVGGCVSKPHSWPWQISL----RDRFGVHFCGGTLIDAQWVLTAAHCLEA--------------SRRPSFY---KVYMGTHTEAATESSKQIRDVEKIVLEPTGK--------DIALLKLDRPAVLNEKVSTACLPD-KDYIVPSGTECYVTGWGDTKGTG------------------------GEGVLKETGFPVIENKVCNRPAYLNNRVKDHEMCAGNIEGGSDSCQGDSGGPLVCF--SQNTFILQGVTSWGLGCANAMKPGVYARVSKFIDWIEKETK 815          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009363.1 (pep scaffold:Pmarinus_7.0:GL476822:37454:60557:-1 gene:ENSPMAG00000008427.1 transcript:ENSPMAT00000009363.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 8.008e-34
Identity = 83/289 (28.72%), Postives = 130/289 (44.98%), Query Frame = 2
Query:  584 QNKIYGGDDAGKNSWPWHVGLYVIHRNRAI----YICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTN-SWQLYGITNFGSARGCG--MSYGVYIRVSEVSMWITEI 1429
            Q +I  G+DA  NSWPW + L       +     + CGG L+N  WV+T AHC+ T                      S  V +G H+  T  + ++  ++ +  +HP++ A +    +D+AL++L+  VP    +    +P    + +  + +C+A GWG +  + P                         S LQ+V++P V + +C        + K   +CAG  L   C GDSGG L C   KT+  W+++GIT+F S  GC       V+ RVS  S WIT I
Sbjct:   26 QARIVNGEDAAPNSWPWQISLATAWDPESPDVINHTCGGVLLNTDWVLTAAHCINTSF--------------------SQSVCLGKHNLITLEEGQLHVQIKNIHVHPNWNATFVERGFDLALIELNESVPITNKIQPATLP-YPGHILSNNPECYATGWGILSTDGP-----------------------SPSTLQQVKLPFVSYAECNSSEYWGTIVKPSMICAGDSLHSACNGDSGGPLNC---KTDRGWEVHGITSFVSNFGCNYYTKPSVFTRVSGYSAWITSI 267          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006511.1 (pep scaffold:Pmarinus_7.0:GL476457:197255:208031:1 gene:ENSPMAG00000005872.1 transcript:ENSPMAT00000006511.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 5.859e-33
Identity = 76/289 (26.30%), Postives = 137/289 (47.40%), Query Frame = 2
Query:  575 MEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQ-YRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEIL 1432
            +  QN+I  G +A  ++WPW   L         ++CGG+L+   WV+T AHC++  D+V                   + +++G H+       +    ++  ++HPS+  + T   +D+AL+KL S  P +  +    +P+      D +  C A GWG +  +  +                        S+LQE ++P V++  C +Q +  + +N ++ +CAG      C GDSGG L C +P   SW +YGIT+FG  + C + +   V+ RVS  + W+++++
Sbjct:   24 VSAQNRIVNGVEAAPHTWPWQASLQAQTGTGWYHVCGGSLVQQQWVMTAAHCIQ-ADRV-------------------YRMVLGKHNLRINEPAQFESTIALSVVHPSWNNHPTRGWFDIALMKLSSAAPLSEQIKLAVLPRVGQELWD-NVTCMATGWGLLASDGKF-----------------------PSVLQEAKLPFVNYSTCSQQEWWWYGVNTNL-ICAGDD-HAVCNGDSGGPLSCQEPN-GSWVVYGITSFGH-KNCSVFHKPSVFTRVSAYTDWVSQVM 264          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002946.1 (pep scaffold:Pmarinus_7.0:GL477988:107792:112981:-1 gene:ENSPMAG00000002665.1 transcript:ENSPMAT00000002946.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 1.243e-31
Identity = 86/284 (30.28%), Postives = 130/284 (45.77%), Query Frame = 2
Query:  587 NKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKS 1438
            ++I  G++A   SWPW V L     N   + CGG+LI+P W++T AHC     K+   E                 VI+G+HDRS++S+   T  ++  I HP +     +N  DVAL+KL  P     G+S  C+    +  +     C   GWG    NN      F+ D           TP +   LQ+  + +V    C++ +   N   D+ +CAG     +CR DSGG L C   K  +W L GI ++GS+        VY RV+ +  WI + + +
Sbjct:   34 SRIVKGEEAMPGSWPWQVSL---QNNTGFHFCGGSLIDPYWIVTAAHC-----KIRPSE---------------HRVILGEHDRSSSSEKVQTMTIAKVINHPQWDDVSFNN--DVALIKLPQPAQMTDGVSAVCLSSTSD-NVPAGLNCVTSGWGIT--NN------FDSD-----------TPPR---LQQTALAIVATPTCQQLFASMNKITDVMICAGGAGASSCRCDSGGPLVC--KKNGAWNLVGIVSWGSSVCSTSMPVVYTRVTAIRSWIDQTIAA 267          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006844.1 (pep scaffold:Pmarinus_7.0:GL476534:178654:183652:1 gene:ENSPMAG00000006169.1 transcript:ENSPMAT00000006844.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 1.543e-31
Identity = 78/282 (27.66%), Postives = 125/282 (44.33%), Query Frame = 2
Query:  584 QNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGM--SYGVYIRVSEVSMWIT 1423
            Q ++  G +A  NSWPW   +      R +  CGGTLI+  WV+++A C  +                      S+ V++G H  STT   ++T  LS    H S+  +  +N YD+A+ K+ SPV  +  +   C+P   N  +  +  C+  GWG +  + P+                        S LQ+  +P+VD+  C +     +  K   +CAG   +  C GD GG L C     N+W + GI+++ S+ GC       V+ RVS  + WI+
Sbjct:   28 QIRVVNGVEARANSWPWQALVQRYSGGRWVNYCGGTLIDSQWVLSSASCYTSGY--------------------SYRVVLGKHSVSTTESGQVTPALSLIAWHSSWNPSIPANGYDIAMFKIASPVTLSSKVRLACLP-SANQILPNNYPCYVTGWGSLYTSGPF-----------------------PSELQQASLPVVDYATCSQASWWGSSLKSSVICAGGSTRSACYGDGGGPLNC-QRSDNAWVVQGISSYVSSLGCNTIRKPTVFTRVSAYNSWIS 264          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009421.1 (pep scaffold:Pmarinus_7.0:GL476822:99973:112424:1 gene:ENSPMAG00000008474.1 transcript:ENSPMAT00000009421.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 3.523e-31
Identity = 80/289 (27.68%), Postives = 125/289 (43.25%), Query Frame = 2
Query:  584 QNKIYGGDDAGKNSWPWHVGL----YVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTN-SWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEI 1429
            Q +I  G+DA  NSWPW + L    +    N   + CGG L+N  WV+T AHC+ T                      S  V++G  +     + ++  ++ +  +HP + A +    +D+A ++L+   P    +    +P    + +  + +C+A GWG +  + P                         S LQ+ ++P V + KC          K   +CAG  L  TC GDSGG L C   KT+  W+++GIT+FG    C       V+ RVS  S WIT I
Sbjct:   29 QARIVNGEDAVPNSWPWQISLATAWFPESPNDIYHTCGGVLLNSDWVLTAAHCIVTNY--------------------SQSVLLGKQNLHLFEEGQLHVQIKNIHVHPKWNALFPEYGFDLAFIELNESAPITNKIQPATLPYP-GHILSNNPECYATGWGSLSTDGP-----------------------SPSTLQQAKLPFVSYAKCSSSEYWGTTVKPSMICAGDSLHSTCYGDSGGPLNC---KTDRGWEVHGITSFGFPTSCNFDTKPNVFTRVSGYSAWITSI 270          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO38900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN0])

HSP 1 Score: 129.413 bits (324), Expect = 3.429e-34
Identity = 91/297 (30.64%), Postives = 140/297 (47.14%), Query Frame = 2
Query:  560 CGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIF--NLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGC-GMSYGVYIRVSEVSMWITEILKSS 1441
            CGRRP  +  +I GGD+A  +SWPW V +    R +  +ICGG+L++P W++T AHC+                 R N+  D + VI+G H R     +    KLS F  H  +        +D+AL+KL  P   +  +S  C+P++ +  M E   CFA GWG V  +  ++                     ++  LQ+ + P+VD + C R+   +   +++   +CAG      C GDSGG L C   ++  W L G  ++ S+  C G  Y +Y+RVS    WI  I   S
Sbjct:   22 CGRRPDGV--RIVGGDEAVPHSWPWQVSI----RLKGSHICGGSLLSPLWLLTAAHCV----------------IRSNNSAD-YTVIVGAHKRVL---DGTEHKLSTFYKHEKYVGGKDKK-HDLALIKLAKPATFSTKVSPVCLPKQGDL-MKERENCFATGWGRVSSSLLHS---------------------RAKKLQQGKAPIVDHQTCIRKISQWKDGIDQQSMVCAGGAGNSVCHGDSGGPLVC--EESGHWVLRGAASWVSSMTCPGKKYAIYVRVSSYIDWIKRITSGS 267          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO30506 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0K9])

HSP 1 Score: 123.25 bits (308), Expect = 2.752e-32
Identity = 87/284 (30.63%), Postives = 122/284 (42.96%), Query Frame = 2
Query:  587 NKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWG-DVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSK---LKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITE 1426
             +I GG DA  +SWPW V L    R    + CGGTLI P WV+T  HC+                   N    S+ V +G H R +++  E   K+     H  F      +  D+ALL+L+ P   N  ++  C+P   +      +KC+  GWG  V+ + P                          ILQ+  IP+   E CKR+Y    +    H+CAG         C+GDSGG L C   +   W LYG+ +FG+      SY VY +VS    WIT+
Sbjct:    3 TRIVGGHDAAPHSWPWQVSL----REELGHTCGGTLIAPEWVVTATHCIIM-----------------NPSPSSYTVALGAHRRLSSNTAEQVIKVKRIFKHSGFSMWRYRD--DIALLQLERPAQLNDRVNVACLPSPGDVP-PVGSKCWLTGWGRQVDSSGPL-----------------------PDILQQARIPIASHEDCKRKYG-SGIYSYTHLCAGEAKPNAAGACQGDSGGPLVC--ERNGQWTLYGVVSFGAGNCEVTSYTVYTKVSNYLDWITK 236          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO31703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX50])

HSP 1 Score: 122.094 bits (305), Expect = 2.637e-31
Identity = 78/288 (27.08%), Postives = 132/288 (45.83%), Query Frame = 2
Query:  587 NKIYGGDDAGKNSWPWHVGLYVIHR--NRAIYICGGTLINPGWVITTAHCLK-TKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHM-CAGSKLK--DTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEIL 1432
             +I GG  A K +WPW + +  +H    +  +ICGG+++ P W++T AHC   +KD  +                  + + +G+HD + T   E    +   I+HP + A + ++ YDVAL+KL SP+  N  +   C+P  K   ++E+ +C+  GWG ++    +  W                      +L +  +PLV  + C++ Y   +      M CAG      D C+GDSGG L C +   + W L G  ++G     G  YGVY  + ++  W+   +
Sbjct:   46 TRIVGGTRAKKGAWPWQISMNYVHNKVTKTPHICGGSVVAPEWIVTAAHCFAYSKDAKD------------------YTIAVGEHDLNATDGYEQRPDVERIILHPKY-APHNNHDYDVALIKLASPLQYNDRVRPVCLPSLKE-DLEENTQCYISGWGHLQEAG-HGPW----------------------VLHQAAVPLVSRDTCQKAYNDLHYKVSSRMRCAGYGAGGIDACQGDSGGPLVCKE--GDVWYLMGAISWGVGCARGGRYGVYADMMDLKYWVQSTI 288          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO47761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKX8])

HSP 1 Score: 119.398 bits (298), Expect = 6.267e-31
Identity = 78/282 (27.66%), Postives = 124/282 (43.97%), Query Frame = 2
Query:  590 KIYGGDDAGKNSWPWHVGL-YVIHRNRAIYICGGTLINPGWVITTAHCLK-TKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLK--DTCRGDSGGGLFCLDPKT-NSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWI 1420
            +I GG  A   +WPW V L +    ++    CGG+LI+P WV+T AHC + TKDK                    + + +G+H+ +     E    +  + IHP +    T N  D+AL+KLD P   N  ++  C+P+  +       KC   GWG ++                            S +L + ++PLV  ++C  Q    +   +  +CAG +    D+C+GDSGG   C +P+    W L G+T++G      + YG+Y  V     WI
Sbjct:    1 RIVGGVVAKPGAWPWQVALIWAKGHDKGAQFCGGSLIDPEWVLTAAHCFEITKDK------------------SQYMLRLGEHNFNEDEGTEQDFYIEKYYIHPKYDEKTTDN--DMALIKLDRPATLNKRVNTICLPEADD-EFKPGTKCTISGWGALQEG----------------------AGSTSKVLMQAKVPLVSRDQCSHQQSYGDRITENMLCAGMRQGGVDSCQGDSGGPFVCTNPENPRQWTLVGVTSWGKGCARALKYGIYANVRRYLHWI 239          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Match: EDO30908 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZF8])

HSP 1 Score: 119.013 bits (297), Expect = 1.017e-30
Identity = 84/293 (28.67%), Postives = 133/293 (45.39%), Query Frame = 2
Query:  560 CGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYR-IFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMS-YGVYIRVSEVSMWITEIL 1432
            CG+RP   Q+++  GD+A ++SWPW + L V  R    +ICGG+LI P WV+T AHC++     +                  + V++G H     S  +   +L+    H  F  ++  N  DVALLKLD+P+  +  ++  C+P++ N      A+CF  GWG +                           + S ILQ+  +P+     C R+   +  + +   +CAG      C+GDSGG   C +     W L G  ++G    CG   Y V+ RVS    WI +++
Sbjct:    2 CGQRPF--QSRVVNGDNAAQHSWPWQISLRVNGR----HICGGSLITPEWVLTAAHCVEDFPHPS-----------------GYTVVVGAHRIKERSAIQQEFRLTKLFKHKDFSMSHLKN--DVALLKLDNPIQPSDKVNTVCLPER-NSRAQVGAQCFITGWGRLVGGG-----------------------QPSEILQQAMLPVASHSACDRKNSYLVPVEEKSMICAGGMGMGGCQGDSGGPFVCNE--GGRWVLRGAVSWGQPM-CGTDHYTVFARVSSFIDWINDMM 242          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: CELA1 (elastase-1 [Source:NCBI gene;Acc:101156080])

HSP 1 Score: 130.568 bits (327), Expect = 3.283e-34
Identity = 85/287 (29.62%), Postives = 129/287 (44.95%), Query Frame = 2
Query:  578 EIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSY--GVYIRVSEVSMWITEIL 1432
            +I+ ++ GG+ A  NSWPW + L  +      + CGGTLI  GWV+T AHC               +D+ +     ++ V++G+HD  ++   E    +S   +HP + +N  SN YD+ALL+L S V  N  +    +P      +  +  C+  GWG                               SS L+E  +P+VD   C R     +  K   +CAG   +  C GDSGG L C    +  + ++GIT+FGSA GC       V+ RVS    W+  I+
Sbjct:   27 DIRERVVGGEVASPNSWPWQISLQYLSGGSYYHTCGGTLIQRGWVMTAAHC---------------VDSSR-----TWRVVLGEHDIYSSGGTEQYIGVSQVYVHPQWDSNRVSNGYDIALLRLASDVTLNSYVQLASLPPSGQ-ILPHNNLCYITGWGLTSTGG-----------------------SLSSQLKEAYLPVVDHSTCSRSDWWGSTVKTTMVCAGGGAESGCNGDSGGPLNC--QVSGKYYVHGITSFGSAYGCNYPQKPTVFTRVSAYIDWMNSIM 267          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000043330.1 (pep primary_assembly:ASM223467v1:8:2448988:2451077:1 gene:ENSORLG00000025659.1 transcript:ENSORLT00000043330.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.028 bits (323), Expect = 1.686e-33
Identity = 95/307 (30.94%), Postives = 145/307 (47.23%), Query Frame = 2
Query:  563 GRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAG--SKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMS--YGVYIRVSEVSMWI-TEILKSSTNEKN*IAI 1468
            GR+P   + +I GG +A   SWPW V L       + + CGG+LIN  WV+T AHC  +   VN                     ++G      ++ N ++R +   I+HP++ +   +N  D+ALL+L SPV  N  ++  C+P   + T     K +  GWGD+                      N  +      LQE++IP+V   +CK  Y   ++  ++ MCAG  +  KD+C+GDSGG L  +  + N W   G+ +FG+  GC      GVY RVS    WI T+I   +TN+   IA+
Sbjct:   12 GRKPKSRKERIVGGQNALPGSWPWQVSL-----QSSYHFCGGSLINNQWVLTAAHCFPSASGVN--------------------AVLGLQSLQGSNPNRVSRTIKTVIVHPNYNSGTQNN--DIALLQLSSPVTFNNYITPVCLPSTGS-TFYSGVKTWVTGWGDI---------------------GNGVSLPAPETLQEIQIPIVGNRRCKCSYGASSITDNM-MCAGLLAGGKDSCQGDSGGPL--VIKQNNRWIQAGVVSFGN--GCAEPDFPGVYTRVSRYQTWINTQI---TTNKPGFIAV 261          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000008752.2 (elastase-1 [Source:NCBI gene;Acc:101156319])

HSP 1 Score: 127.872 bits (320), Expect = 3.227e-33
Identity = 80/286 (27.97%), Postives = 128/286 (44.76%), Query Frame = 2
Query:  581 IQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGM--SYGVYIRVSEVSMWITEIL 1432
            +Q+++ GG+ A  NSWPW + L  +      + CGG+LI  GWV+T AHC+                    D   ++ V++GDHD  T    E    +S   +HPS+  N  +  YD+ALL+L +P   N  +    +P                  G V P+N         + ++  W + +   + S+ L++  +P+VD   C       +  K   +CAG   +  C+GDSGG L C       W ++G+T+F S+ GC       V+ RVS    W+  I+
Sbjct:   30 LQDRVVGGEVARPNSWPWQISLQYLSGGSYYHTCGGSLIKTGWVMTAAHCV--------------------DRSMTWRVVVGDHDIYTNEGREQYLSVSQVYVHPSWNTNNVAAGYDIALLRLSTPATLNSYVQLASLPPS----------------GQVLPHN--------NNCYISGWGRTQTGGQLSAQLKQAYLPVVDHNTCSSSGWWGSTVKSSMVCAGGGSESGCQGDSGGPLNC--SVNGQWVVHGVTSFVSSSGCNAYRKPTVFTRVSAYISWMNGIM 269          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035554.1 (elastase-1 [Source:NCBI gene;Acc:101156319])

HSP 1 Score: 126.331 bits (316), Expect = 1.123e-32
Identity = 79/285 (27.72%), Postives = 127/285 (44.56%), Query Frame = 2
Query:  581 IQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGM--SYGVYIRVSEVSMWITEI 1429
            +Q+++ GG+ A  NSWPW + L  +      + CGG+LI  GWV+T AHC+                    D   ++ V++GDHD  T    E    +S   +HPS+  N  +  YD+ALL+L +P   N  +    +P                  G V P+N         + ++  W + +   + S+ L++  +P+VD   C       +  K   +CAG   +  C+GDSGG L C       W ++G+T+F S+ GC       V+ RVS    W+  +
Sbjct:   30 LQDRVVGGEVARPNSWPWQISLQYLSGGSYYHTCGGSLIKTGWVMTAAHCV--------------------DRSMTWRVVVGDHDIYTNEGREQYLSVSQVYVHPSWNTNNVAAGYDIALLRLSTPATLNSYVQLASLPPS----------------GQVLPHNN--------NCYISGWGRTQTGGQLSAQLKQAYLPVVDHNTCSSSGWWGSTVKSSMVCAGGGSESGCQGDSGGPLNC--SVNGQWVVHGVTSFVSSSGCNAYRKPTVFTRVSAYISWMNGV 268          
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000041614.1 (pep primary_assembly:ASM223467v1:8:2529637:2537084:1 gene:ENSORLG00000026241.1 transcript:ENSORLT00000041614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 1.829e-32
Identity = 100/324 (30.86%), Postives = 150/324 (46.30%), Query Frame = 2
Query:  509 VKSNFSKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAG--SKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMS--YGVYIRVSEVSMWI-TEILKSSTNEKN*IA 1465
            V  N S+  +V     +CGR    + N+I GG DA    WPW V L       + + CGG+LIN  WV+T AHC  ++                        V++G      ++ N ++R ++  I+HP+F +   +N  D+ALL+L SPV     ++  C+P   + T       +  GWG +                    R +   P+    LQEV+IP+V   +CK  Y   +L  D  MCAG  +  KD+C+GDSGG L  +  +   W   GI +FG  +GC +    G+Y RVS+   WI T+I   +TN+   IA
Sbjct:    2 VLENTSQFCSVLLFFPVCGR--ANLNNRIVGGQDAPAGFWPWQVSL-----QGSRHFCGGSLINNQWVLTAAHCFPSRSA------------------SGVTVVLGLQSLQGSNPNRVSRTITTLIVHPNFNSATQNN--DIALLQLSSPVTFTNYITPVCLPSTGS-TFYSGVNTWVTGWGTI--------------------RISLPAPQT---LQEVQIPIVGNRRCKCSYGA-SLITDNMMCAGLLAGGKDSCQGDSGGPL--VIKQNIRWIQAGIVSFG--KGCALPNFPGIYTRVSQYQTWINTQI---TTNKPGFIA 266          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000025209.1 (SMESG000025209.1)

HSP 1 Score: 965.681 bits (2495), Expect = 0.000e+0
Identity = 463/464 (99.78%), Postives = 464/464 (100.00%), Query Frame = 2
Query:   65 MRTFNELCNSIMRWIITLLAVAMIVILSEIVSTRHLKSSHNLNRRRFNKFWDNDGDEEFKERRKYQRRYGERKYTRLMLSRKMFYYWTSNYDNWTNWTACSPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSNFSKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKSSTNEKN 1456
            MRTFNELCNSIMRWIITLLAVAMIVILSEIVSTRHLKSSHNLNRRRFNKFWDNDGDEEFKERRKYQRRYGERKYTRLMLSRKMFYYWTSNYDNWTNWTACSPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSNFSKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKV+TLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKSSTNEKN
Sbjct:    1 MRTFNELCNSIMRWIITLLAVAMIVILSEIVSTRHLKSSHNLNRRRFNKFWDNDGDEEFKERRKYQRRYGERKYTRLMLSRKMFYYWTSNYDNWTNWTACSPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSNFSKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVSTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKSSTNEKN 464          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000025143.1 (SMESG000025143.1)

HSP 1 Score: 410.223 bits (1053), Expect = 2.131e-140
Identity = 189/393 (48.09%), Postives = 273/393 (69.47%), Query Frame = 2
Query:  260 QRRYGERKYTRLMLSRKMFYYWTSNYDNWTNWTACSPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSNFSKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKS 1438
            QR+  + ++T   +++++F +W  +Y++W+ WT C   +CTKSR+R C+ NS +     +  Q+KC  K+I+EK TC+D  EC  +N+SK   +S LPK CG       NKIYGG +A K+ W  HVG YVI      Y+CGGTLINPGWV+T AHCL+T   V  LE GK+I+TR   ++D F++++GDH+     ++E+ + LSHFIIHPS+R +     YDVALLKLD P+PS++ +++PC+ + +++ M+ + KC+AVGWG +    P      E D+ LERW++N R  RKSS+LQEVE+PLVD + C +++  FNLNK IH+CAG+ LKDTC GDSGGGLFC+D  +    LYGITNFG A GCG+SYG+Y+RV +V++WI +++K+
Sbjct:    8 QRQIEKEEFT---MNKEIFTFWDDDYESWSGWTICQSDSCTKSRFRVCR-NSLKRTKNYWPRQRKCETKYIYEKSTCNDTAECATNNYSKEERISKLPKKCGIMSNNAANKIYGGKEAEKDKWKAHVGFYVIKDYNVYYVCGGTLINPGWVLTAAHCLETIKIVRYLEIGKIINTRLAGIFDDFYILVGDHNTRIYGEHEIMKSLSHFIIHPSYRFDRYLKQYDVALLKLDLPLPSSLDINYPCIAESRDFFMNLTNKCYAVGWGLLNRYKPKRSNYIELDFDLERWQRNPRISRKSSVLQEVELPLVDLKVCSKEHSSFNLNKTIHVCAGTYLKDTCSGDSGGGLFCVDDTSKRLHLYGITNFGLAEGCGLSYGIYMRVPQVALWIRKMIKN 396          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000025143.1 (SMESG000025143.1)

HSP 1 Score: 409.453 bits (1051), Expect = 2.878e-140
Identity = 189/393 (48.09%), Postives = 273/393 (69.47%), Query Frame = 2
Query:  260 QRRYGERKYTRLMLSRKMFYYWTSNYDNWTNWTACSPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSNFSKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKS 1438
            QR+  + ++T   +++++F +W  +Y++W+ WT C   +CTKSR+R C+ NS +     +  Q+KC  K+I+EK TC+D  EC  +N+SK   +S LPK CG       NKIYGG +A K+ W  HVG YVI      Y+CGGTLINPGWV+T AHCL+T   V  LE GK+I+TR   ++D F++++GDH+     ++E+ + LSHFIIHPS+R +     YDVALLKLD P+PS++ +++PC+ + +++ M+ + KC+AVGWG +    P      E D+ LERW++N R  RKSS+LQEVE+PLVD + C +++  FNLNK IH+CAG+ LKDTC GDSGGGLFC+D  +    LYGITNFG A GCG+SYG+Y+RV +V++WI +++K+
Sbjct:    5 QRQIEKEEFT---MNKEIFTFWDDDYESWSGWTICQSDSCTKSRFRVCR-NSLKRTKNYWPRQRKCETKYIYEKSTCNDTAECATNNYSKEERISKLPKKCGIMSNNAANKIYGGKEAEKDKWKAHVGFYVIKDYNVYYVCGGTLINPGWVLTAAHCLETIKIVRYLEIGKIINTRLAGIFDDFYILVGDHNTRIYGEHEIMKSLSHFIIHPSYRFDRYLKQYDVALLKLDLPLPSSLDINYPCIAESRDFFMNLTNKCYAVGWGLLNRYKPKRSNYIELDFDLERWQRNPRISRKSSVLQEVELPLVDLKVCSKEHSSFNLNKTIHVCAGTYLKDTCSGDSGGGLFCVDDTSKRLHLYGITNFGLAEGCGLSYGIYMRVPQVALWIRKMIKN 393          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000035925.1 (SMESG000035925.1)

HSP 1 Score: 229.18 bits (583), Expect = 2.607e-70
Identity = 144/388 (37.11%), Postives = 198/388 (51.03%), Query Frame = 2
Query:  302 SRKMFYYWTSNYDNWTNWTACSPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSN-FSKLGNVSTLPKICGR--RPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYI-CGGTLINPGWVITTAHCLKTKDKVNTLEFG--KLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSF-RANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEILKSST 1444
            S  MF    + Y +WT W+ C    CTK R + CK+        D R+   CPV  I E   C D   C +SN       +  LPK CG+      + NKI GG  A K++WPW V  Y     +  Y  CG TLI+  W IT AHC+  ++ + T   G  K+ D       D   + IG + ++  +       +SH  IHPS+  + Y SN YD ALLKL + +  N  M+FPC+   +N+ + E++ C+A+GWG  +              F +R             LQEV++PL+ +E CK  Y    +N  IH+CAG+K KDTC GDSGGGL+C+ P TN W LYGI +FG++ GCG   GVY RVS    WI + +K S 
Sbjct:   29 SESMFVINDNYYGDWTAWSECVLE-CTKYRSKHCKN-------ADSRV---CPVSMIKEITACHDKVNCKQSNSVYHEKTLHNLPKNCGQTINTQFLLNKIVGGRPADKSAWPWIVS-YGFKSGKDFYFKCGATLISENWAITAAHCINYENTIFTKNGGLNKIDD-------DKIFLRIGAYHKTKLTKEAYITFVSHISIHPSYSNSEYYSN-YDFALLKLKTAIKPNKNMTFPCIFADENFQLPETSTCYALGWGKQDIKGS--------KVFDDR-------------LQEVQLPLISYEACKLDYEGIYINYTIHVCAGTKNKDTCSGDSGGGLYCIHPATNRWVLYGIISFGTSEGCGEISGVYARVSSAIYWIQQTIKYSV 375          
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Match: SMESG000035926.1 (SMESG000035926.1)

HSP 1 Score: 219.935 bits (559), Expect = 1.821e-67
Identity = 132/351 (37.61%), Postives = 186/351 (52.99%), Query Frame = 2
Query:  389 RYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVKSNFS-KLGNVSTLPKICGRRPME-IQNKIYGGDDAGKNSWPWHVGLYVIHRNRAIYI-CGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFHVIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVPSNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLERWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLKDTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSMWITEIL 1432
            R + CKD S    + D R+   CPVK I E  +CD    C   N S KL  +  LPK CG+RP + ++NKI GG     N WPW V L  +  NR ++I CG TLI+ GW IT AHC+      +  + G L        +    + IG++ R      E    +SH ++HP +  + T  +YD ALLKL++ +  +    FPC+  + N+ + ++  C+ VGW     NN           F +R             LQE++IPLV ++KC  +Y    +N  +H+CAGSK KDTC GDSG GL+C DP T SW LYGI +FG++ GCG + GVY R+S    WI  ++
Sbjct:    3 RRKMCKDMS----ITDTRV---CPVKIIMEMKSCD---CCGCDNISVKLTTLEGLPKTCGKRPTDNVRNKIIGGKPTQVNKWPWMVDLGSV-INREMFINCGATLISDGWAITAAHCMIPYISQD-YKLGVLTKVESKTKF----INIGNYHRGFIDKGEYKAYISHIVVHPLYYNDDTVTIYDFALLKLENRIKDS-NAKFPCIANEINFRLTQNPLCYTVGWATETQNN---------QIFDDR-------------LQEIQIPLVSYQKCHEEYFNIYINYTLHICAGSKKKDTCTGDSGNGLYCFDPFTKSWLLYGIVSFGTSLGCGNTIGVYARISAAIEWIANVV 314          
The following BLAST results are available for this feature:
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CELA16.425e-3327.93chymotrypsin like elastase 1 [Source:HGNC Symbol;A... [more]
CTRL7.774e-3229.73chymotrypsin like [Source:HGNC Symbol;Acc:HGNC:252... [more]
CELA3B9.901e-3027.68chymotrypsin like elastase 3B [Source:HGNC Symbol;... [more]
PLG1.416e-2927.90plasminogen [Source:HGNC Symbol;Acc:HGNC:9071][more]
OVCH22.238e-2927.27ovochymase 2 (gene/pseudogene) [Source:HGNC Symbol... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
try-13.018e-1927.08TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
svh-11.094e-1422.95HGF/MSP/plasminogen-like protein [Source:UniProtK... [more]
try-32.174e-1023.83TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-31.119e-923.22TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG106632.740e-3027.57gene:FBgn0036287 transcript:FBtr0346570[more]
CG106632.740e-3027.57gene:FBgn0036287 transcript:FBtr0113167[more]
CG49982.336e-2729.05gene:FBgn0036612 transcript:FBtr0075377[more]
CG49983.614e-2729.05gene:FBgn0036612 transcript:FBtr0110866[more]
Sp72.525e-2628.48gene:FBgn0037515 transcript:FBtr0081740[more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cela1.41.786e-3629.17chymotrypsin like elastase family member 1, tandem... [more]
zgc:1232171.492e-3332.76zgc:123217 [Source:ZFIN;Acc:ZDB-GENE-051113-188][more]
zgc:1121607.779e-3331.93zgc:112160 [Source:ZFIN;Acc:ZDB-GENE-050417-229][more]
zgc:1121607.779e-3331.93zgc:112160 [Source:ZFIN;Acc:ZDB-GENE-050417-229][more]
ctrl6.291e-3229.58chymotrypsin-like [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pag14.510e-3230.04phosphoprotein membrane anchor with glycosphingoli... [more]
ENSXETT00000011466.11.113e-3127.62chymotrypsin-like elastase family member 2A [Sourc... [more]
ENSXETT00000000210.11.280e-3127.62chymotrypsin-like elastase family member 2A [Sourc... [more]
ENSXETT00000000226.11.385e-3127.62chymotrypsin-like elastase family member 2A [Sourc... [more]
rgs84.820e-3030.79regulator of G-protein signaling 8 [Source:Xenbase... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctrl1.076e-3329.97chymotrypsin-like [Source:MGI Symbol;Acc:MGI:88558... [more]
Cela2a4.293e-3226.85chymotrypsin-like elastase family, member 2A [Sour... [more]
Cela3b7.194e-3228.19chymotrypsin-like elastase family, member 3B [Sour... [more]
Prss305.145e-3030.23protease, serine 30 [Source:MGI Symbol;Acc:MGI:135... [more]
Prss305.145e-3030.23protease, serine 30 [Source:MGI Symbol;Acc:MGI:135... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08419|CEL2A_PIG1.013e-3329.47Chymotrypsin-like elastase family member 2A OS=Sus... [more]
sp|P00774|CEL2A_RAT5.267e-3328.19Chymotrypsin-like elastase family member 2A OS=Rat... [more]
sp|P80646|CTRB_GADMO6.906e-3329.97Chymotrypsin B OS=Gadus morhua OX=8049 PE=1 SV=1[more]
sp|O46644|CELA1_MACFA1.323e-3228.62Chymotrypsin-like elastase family member 1 OS=Maca... [more]
sp|Q9UNI1|CELA1_HUMAN3.085e-3227.93Chymotrypsin-like elastase family member 1 OS=Homo... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J9M61.007e-8235.49Chymotrypsin-like elastase family member 2A (Fragm... [more]
U6JH051.476e-8138.20Enteropeptidase OS=Echinococcus granulosus OX=6210... [more]
A0A087VY244.531e-8138.16Mastin OS=Echinococcus multilocularis OX=6211 GN=E... [more]
A0A158R6J88.081e-8138.21Peptidase S1 domain-containing protein OS=Taenia a... [more]
A0A0R3X0819.014e-8138.33Peptidase S1 domain-containing protein OS=Hydatige... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-32n7.92.443e-3531.21chymotrypsin-like protease CTRL-1 [Source:NCBI gen... [more]
ENSAMXT00000048530.16.776e-3431.65pep primary_assembly:Astyanax_mexicanus-2.0:13:202... [more]
ENSAMXT00000014359.23.752e-3330.04pep primary_assembly:Astyanax_mexicanus-2.0:8:2090... [more]
ENSAMXT00000014374.24.031e-3330.39chymotrypsinogen A-like [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000018418.26.399e-3329.97plasminogen [Source:NCBI gene;Acc:103036400][more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009363.18.008e-3428.72pep scaffold:Pmarinus_7.0:GL476822:37454:60557:-1 ... [more]
ENSPMAT00000006511.15.859e-3326.30pep scaffold:Pmarinus_7.0:GL476457:197255:208031:1... [more]
ENSPMAT00000002946.11.243e-3130.28pep scaffold:Pmarinus_7.0:GL477988:107792:112981:-... [more]
ENSPMAT00000006844.11.543e-3127.66pep scaffold:Pmarinus_7.0:GL476534:178654:183652:1... [more]
ENSPMAT00000009421.13.523e-3127.68pep scaffold:Pmarinus_7.0:GL476822:99973:112424:1 ... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO389003.429e-3430.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305062.752e-3230.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317032.637e-3127.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477616.267e-3127.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309081.017e-3028.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CELA13.283e-3429.62elastase-1 [Source:NCBI gene;Acc:101156080][more]
ENSORLT00000043330.11.686e-3330.94pep primary_assembly:ASM223467v1:8:2448988:2451077... [more]
ENSORLT00000008752.23.227e-3327.97elastase-1 [Source:NCBI gene;Acc:101156319][more]
ENSORLT00000035554.11.123e-3227.72elastase-1 [Source:NCBI gene;Acc:101156319][more]
ENSORLT00000041614.11.829e-3230.86pep primary_assembly:ASM223467v1:8:2529637:2537084... [more]
back to top
BLAST of Peptidase S1 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025209.10.000e+099.78SMESG000025209.1[more]
SMESG000025143.12.131e-14048.09SMESG000025143.1[more]
SMESG000025143.12.878e-14048.09SMESG000025143.1[more]
SMESG000035925.12.607e-7037.11SMESG000035925.1[more]
SMESG000035926.11.821e-6737.61SMESG000035926.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012713 ID=SMED30012713|Name=Peptidase S1 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1501bp
CAGATGTGGAGTGTGCTGAACAATTAATAATTAGAGTTCAAGGTACTAAG
TGAAAACCTATATAATGCGAACATTCAACGAACTGTGCAATTCAATCATG
CGCTGGATCATTACCTTACTCGCTGTTGCCATGATTGTCATTTTGTCCGA
GATCGTTTCGACCCGCCATTTGAAATCATCACACAATTTGAATAGGAGAC
GATTTAATAAGTTTTGGGATAATGATGGTGACGAGGAGTTTAAGGAACGA
AGGAAATACCAAAGAAGATATGGAGAGAGGAAGTACACAAGGCTGATGTT
AAGTAGGAAAATGTTCTATTATTGGACTAGCAATTATGACAATTGGACGA
ATTGGACTGCTTGCTCACCTCGTAATTGCACGAAAAGCAGATATAGGAAA
TGCAAGGACAACTCCTGGGAAGAAAACGTTATAGATTTTAGATTGCAGAA
GAAATGCCCAGTAAAGTTTATTTTTGAAAAAATGACTTGCGATGATATAC
CGGAATGTGTTAAAAGTAACTTTTCAAAGCTGGGAAATGTATCAACACTA
CCAAAGATATGCGGCCGTAGACCAATGGAGATTCAGAACAAAATTTACGG
TGGTGACGACGCCGGTAAAAATTCTTGGCCGTGGCATGTGGGGCTGTACG
TCATTCACAGAAATCGAGCGATATATATCTGTGGGGGGACATTGATCAAT
CCAGGATGGGTAATCACTACTGCACATTGTTTGAAAACGAAAGACAAAGT
TAACACATTGGAATTTGGCAAATTAATTGATACCAGAAAGAACGATCTAT
ACGATAGTTTTCATGTGATTATTGGTGACCATGATAGGTCGACAACAAGT
GACAATGAGATGACGAGGAAACTCAGTCATTTCATTATTCATCCTTCATT
CCGAGCCAATTACACTTCAAATCTCTACGATGTTGCTCTCTTGAAATTGG
ACTCTCCTGTGCCATCAAATGTTGGGATGTCTTTCCCGTGTGTTCCGCAG
AAAAAGAACTACACCATGGACGAGTCGGCCAAATGTTTCGCAGTCGGCTG
GGGAGACGTGGAACCGAACAATCCGTACAATATTTGGAGCTTCGAATTTG
ATTACTTTTTAGAAAGATGGAGAAAGAACAGAAGAACACCGAGAAAATCT
AGCATATTACAGGAAGTTGAAATTCCTTTGGTTGATTTTGAAAAGTGCAA
ACGGCAATATCGAATATTCAATTTAAACAAAGATATTCACATGTGCGCCG
GATCAAAACTGAAGGACACATGTCGCGGAGATAGCGGAGGAGGATTGTTC
TGTCTCGATCCCAAAACGAATAGTTGGCAATTATATGGAATTACTAATTT
TGGGTCAGCGCGAGGTTGCGGCATGAGTTACGGGGTCTACATTAGAGTTT
CAGAAGTATCCATGTGGATCACAGAAATCTTAAAATCATCAACAAATGAA
AAAAATTGAATTGCAATAATATAAACTTTTTGATGTTAAAAAAAAAGATC
G
back to top

protein sequence of SMED30012713-orf-1

>SMED30012713-orf-1 ID=SMED30012713-orf-1|Name=SMED30012713-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=465bp
MRTFNELCNSIMRWIITLLAVAMIVILSEIVSTRHLKSSHNLNRRRFNKF
WDNDGDEEFKERRKYQRRYGERKYTRLMLSRKMFYYWTSNYDNWTNWTAC
SPRNCTKSRYRKCKDNSWEENVIDFRLQKKCPVKFIFEKMTCDDIPECVK
SNFSKLGNVSTLPKICGRRPMEIQNKIYGGDDAGKNSWPWHVGLYVIHRN
RAIYICGGTLINPGWVITTAHCLKTKDKVNTLEFGKLIDTRKNDLYDSFH
VIIGDHDRSTTSDNEMTRKLSHFIIHPSFRANYTSNLYDVALLKLDSPVP
SNVGMSFPCVPQKKNYTMDESAKCFAVGWGDVEPNNPYNIWSFEFDYFLE
RWRKNRRTPRKSSILQEVEIPLVDFEKCKRQYRIFNLNKDIHMCAGSKLK
DTCRGDSGGGLFCLDPKTNSWQLYGITNFGSARGCGMSYGVYIRVSEVSM
WITEILKSSTNEKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001314Peptidase_S1A
IPR001254Trypsin_dom
IPR009003Peptidase_S1_PA
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001314Peptidase S1A, chymotrypsin familyPRINTSPR00722CHYMOTRYPSINcoord: 400..412
score: 59.91
coord: 207..222
score: 55.58
coord: 285..299
score: 37.85
IPR001254Serine proteases, trypsin domainSMARTSM00020trypsin_2coord: 176..452
e-value: 2.1E-59
score: 213.3
IPR001254Serine proteases, trypsin domainPFAMPF00089Trypsincoord: 177..452
e-value: 3.5E-44
score: 151.2
IPR001254Serine proteases, trypsin domainPROSITEPS50240TRYPSIN_DOMcoord: 177..457
score: 28.55
IPR001254Serine proteases, trypsin domainCDDcd00190Tryp_SPccoord: 177..455
e-value: 6.44694E-63
score: 201.736
NoneNo IPR availableGENE3DG3DSA:2.40.10.10coord: 189..452
e-value: 2.4E-60
score: 206.0
NoneNo IPR availableGENE3DG3DSA:2.40.10.10coord: 179..446
e-value: 2.4E-60
score: 206.0
NoneNo IPR availablePANTHERPTHR24256:SF497coord: 16..457
NoneNo IPR availablePANTHERPTHR24256TRANSMEMBRANE PROTEASE, SERINEcoord: 16..457
NoneNo IPR availableTMHMMTMhelixcoord: 13..32
IPR009003Peptidase S1, PA clanSUPERFAMILYSSF50494Trypsin-like serine proteasescoord: 156..457