Protein CLP1 homolog

Overview
NameProtein CLP1 homolog
Smed IDSMED30012699
Length (bp)3052
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein CLP1 homolog (SMED30012699) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein CLP1 homolog (SMED30012699) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein CLP1 homolog (SMED30012699) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein CLP1 homolog (SMED30012699) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012699

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012699h1SMcG0017957 SmedASXL_012484SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012699h1SMcG0017957 SmedASXL_012484SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30012699h1SMcG0017957 dd_Smed_v4_11378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012699h1SMcG0017957 dd_Smed_v4_11378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012699h1SMcG0017957 dd_Smed_v4_11378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30012699h1SMcG0017957 dd_Smed_v4_11378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012699h1SMcG0017957 dd_Smed_v4_11378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012699h1SMcG0017957 dd_Smed_v4_11378_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012699h1SMcG0017957 SMED_20491_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012699h1SMcG0017957 SMED_20491_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012699h1SMcG0017957 SMED_14720_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012699h1SMcG0017957 SMED_14720_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein CLP1 homolog vs. Ensembl Human
Match: CLP1 (cleavage and polyadenylation factor I subunit 1 [Source:HGNC Symbol;Acc:HGNC:16999])

HSP 1 Score: 121.709 bits (304), Expect = 1.126e-28
Identity = 108/404 (26.73%), Postives = 180/404 (44.55%), Query Frame = 2
Query: 1724 DSKSGNKIILNSEEIVRFF--CLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKLF---KHELKADEVKIYYTKS---------LNDSNDSNFINI----PFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            D K   K  L  E  +RF      +V++ L  G AEI+GT L  N +          + ++ GCS+ + G      V K     LY     LN H  LE  R +A K + RGPR+++ GP       ST+ R L NY+VR GR    V LD       +P ++    I+   D+  G+     PLV++FG  +P  N +LY +    LA+  N RCE +    + GC+IN   +      + ++ A   FEV+V++++      N L   +P +V+ + +PK               R ERI  YFY     F      +K  +VKIY   +         L  S + N + +    P ++++ + +   +   + + +S + +  ++++T V   +   TV++
Sbjct:    8 DKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSVQLSGRTEVAYVSKDTPMLLY-----LNTHTALEQMRRQAEKEEERGPRVMVVGP--TDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI-QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGSGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLS 403          
BLAST of Protein CLP1 homolog vs. Ensembl Human
Match: CLP1 (cleavage and polyadenylation factor I subunit 1 [Source:HGNC Symbol;Acc:HGNC:16999])

HSP 1 Score: 121.709 bits (304), Expect = 1.126e-28
Identity = 108/404 (26.73%), Postives = 180/404 (44.55%), Query Frame = 2
Query: 1724 DSKSGNKIILNSEEIVRFF--CLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKLF---KHELKADEVKIYYTKS---------LNDSNDSNFINI----PFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            D K   K  L  E  +RF      +V++ L  G AEI+GT L  N +          + ++ GCS+ + G      V K     LY     LN H  LE  R +A K + RGPR+++ GP       ST+ R L NY+VR GR    V LD       +P ++    I+   D+  G+     PLV++FG  +P  N +LY +    LA+  N RCE +    + GC+IN   +      + ++ A   FEV+V++++      N L   +P +V+ + +PK               R ERI  YFY     F      +K  +VKIY   +         L  S + N + +    P ++++ + +   +   + + +S + +  ++++T V   +   TV++
Sbjct:    8 DKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSVQLSGRTEVAYVSKDTPMLLY-----LNTHTALEQMRRQAEKEEERGPRVMVVGP--TDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI-QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGSGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLS 403          
BLAST of Protein CLP1 homolog vs. Ensembl Human
Match: CLP1 (cleavage and polyadenylation factor I subunit 1 [Source:HGNC Symbol;Acc:HGNC:16999])

HSP 1 Score: 122.094 bits (305), Expect = 1.172e-28
Identity = 111/405 (27.41%), Postives = 183/405 (45.19%), Query Frame = 2
Query: 1724 DSKSGNKIILNSEEIVRFF--CLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKLF---KHELKADEVKIYYTKS---------LNDSNDSNFINI----PFQEIILNSVCALSQALSFDE-ISTSPILCYLLITDVSECYSTLTVMT 2866
            D K   K  L  E  +RF      +V++ L  G AEI+GT L  N +          + ++ GCS+ + G      V K     LY     LN H  LE  R +A K + RGPR+++ GP       ST+ R L NY+VR GR    V LD       +P ++    I+   D+  G+     PLV++FG  +P  N +LY +    LA+  N RCE +    + GC+IN   +      + ++ A   FEV+V++++      N L   +P +V+ + +PK               R ERI  YFY     F      +K  +VKIY   +         L  S + N + +    P ++++ + + ++S A   +E +S + +  ++++T V   +   TV++
Sbjct:   19 DKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSVQLSGRTEVAYVSKDTPMLLY-----LNTHTALEQMRRQAEKEEERGPRVMVVGP--TDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI-QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGSGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRDMV-HHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLS 414          
BLAST of Protein CLP1 homolog vs. Ensembl Human
Match: CLP1 (cleavage and polyadenylation factor I subunit 1 [Source:HGNC Symbol;Acc:HGNC:16999])

HSP 1 Score: 63.1586 bits (152), Expect = 9.643e-10
Identity = 45/139 (32.37%), Postives = 64/139 (46.04%), Query Frame = 2
Query: 1724 DSKSGNKIILNSEEIVRFF--CLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSV 2131
            D K   K  L  E  +RF      +V++ L  G AEI+GT L  N +          + ++ GCS+ + G      V K     LY     LN H  LE  R +A K + RGPR+++ GP       ST+ R L NY++
Sbjct:    8 DKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSVQLSGRTEVAYVSKDTPMLLY-----LNTHTALEQMRRQAEKEEERGPRVMVVGP--TDVGKSTVCRLLLNYAI 139          
BLAST of Protein CLP1 homolog vs. Ensembl Human
Match: CLP1 (cleavage and polyadenylation factor I subunit 1 [Source:HGNC Symbol;Acc:HGNC:16999])

HSP 1 Score: 55.4546 bits (132), Expect = 2.158e-8
Identity = 39/120 (32.50%), Postives = 55/120 (45.83%), Query Frame = 2
Query: 1724 DSKSGNKIILNSEEIVRFF--CLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGP 2074
            D K   K  L  E  +RF      +V++ L  G AEI+GT L  N +          + ++ GCS+ + G      V K     LY     LN H  LE  R +A K + RGPR+++ GP
Sbjct:    8 DKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSVQLSGRTEVAYVSKDTPMLLY-----LNTHTALEQMRRQAEKEEERGPRVMVVGP 122          
BLAST of Protein CLP1 homolog vs. Ensembl Celegans
Match: clpf-1 (pep chromosome:WBcel235:III:3397743:3400644:1 gene:WBGene00010304.1 transcript:F59A2.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:clpf-1)

HSP 1 Score: 125.176 bits (313), Expect = 3.414e-30
Identity = 114/405 (28.15%), Postives = 193/405 (47.65%), Query Frame = 2
Query: 1787 NNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNII-LNIHYDLE---LKRIEALK---NDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSFHSSE---IILKAIQLFEVNVLLLISDSSTI-NLSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHK----LFKHELKADEVKI--YYTKSLNDS----------NDSNFINIPFQEIILNSVCALSQALSFDE-ISTSPILCYLLITDVSECYSTLTVMTEREFWPELYSILVLNGI 2917
            ++V + L KG AEI+GT L  N +      +     ++ G +I ++G      V         P +I LNIH  +E    KR E      N  +GPR+L+ GP       +T++R L NYSVR GRT   V LD   N   +P +++  ++Q   D+  G++  N P+VFNFG  SP AN  LY      +A  +N + + ++   IGG IIN   +   E    I+KA   FEV+V++++       +LS ++PE+V++ ++PK         +    +R E +H YFY         F  ++  D+V +     + L DS          +++  + +     I + + A S++   DE +  SP+  + L+T+V     T++++  +   P    +LV + I
Sbjct:   25 SDVCLELVKGYAEIFGTELLLNKKYTFPAKSRVAAFTWKGATIELVGTTESAYVAE-----STPMVIYLNIHAAMEEVRKKREEQAAGNSNKAKGPRLLLVGP--TDVGKTTVSRILCNYSVRQGRTPIFVELDVGQNSVSVPGTVAAVLVQKTADVIDGFER-NQPIVFNFGHTSPSANLSLYEALFKEMATTLNAQIQENDEAKIGGMIINTCGWVDGEGYKCIVKAASAFEVDVVIVLDHERLYSDLSKELPEFVRLTHVPKSGGVEQRTGQIRSKMRGENVHRYFYGTRANNLYPFTFDVSFDDVTLCKIGAEQLPDSCLPFGMEVENHETKLVIMEPSADIKHHLFAFSRSTKADENVLKSPVFGFCLVTEVDLEKRTMSILCPQRTIPS--KVLVFSDI 419          
BLAST of Protein CLP1 homolog vs. Ensembl Fly
Match: cbc (gene:FBgn0033842 transcript:FBtr0087701)

HSP 1 Score: 86.6557 bits (213), Expect = 2.128e-17
Identity = 94/400 (23.50%), Postives = 168/400 (42.00%), Query Frame = 2
Query: 1721 LDSKSGNKIILNSEEIVRFFCLNN---VRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNII--LNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYV------NIRCEXXXXXXXXXXXXXXXSFHSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKL----FKHELKADEVKIYYTKS--LNDS----------NDSNFINIPFQEIILNSVCALSQALSF-DEISTSPILCYLLITDV 2833
            +    G    L S+  +RF        V + L  G AE++GT L    + E        I ++ GC + V G ++      +C+   +  ++  +N H  LE  R+EA + D  GP  ++ GP       STL R L NY+VR GR     +LD       +  S++  +I+   ++  G+     PLV++FG  SP  N  LY   +  +A         N R ++   ++     + G  +     +L A + +    + ++      N L   VP+ V ++ +PK         +     R +RI  YFY   +     F  E+K  ++++Y   +  L DS          N +  + +     +++ V ALS A S  D++  + +  +  +T+V
Sbjct:    1 MSEDQGKDYTLESDSELRFEIEQKDAKVLVSLVSGFAELFGTELVKKKQYEFGVGAKVAIFTYQGCVLHVSGKMD------VCYISKETPMVQYVNCHAALEQFRMEAEEKDRYGPVAMVVGP--MDVGKSTLCRILLNYAVRVGRRPLYADLDVGQGSIAISGSVATILIERPANVEEGFA-KTAPLVYHFGHKSPSGNSVLYNAVVSKMAEVTLQSLNSNKRTKSSGIIINTCGWVKGSGYAH---LLHAAKAYGACAIFVLDQERLYNELLRDVPKGVHVVLLPKSGGVVERSKELRHEARDQRIKEYFYGNTRAPFYPFSFEVKFQDLRLYKIGAPPLPDSCMPIGMKAEDNKTKVVAVTPTPALIHHVLALSFAESVEDDVIGTNVAGFCCVTEV 388          
BLAST of Protein CLP1 homolog vs. Ensembl Fly
Match: Pcf11 (gene:FBgn0264962 transcript:FBtr0302560)

HSP 1 Score: 54.299 bits (129), Expect = 6.568e-7
Identity = 33/117 (28.21%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSV------IDIREKSKYYFIRKSWENHFP 439
            E+ + L  L+ N+  LI  L++ AEE   N   A   V ++   I +   + K+  LY++D I+KNV   Y++LF + +  +F+ +  SV      +  + + + Y +R++W   FP
Sbjct:   18 EYLSSLQDLNCNSKPLINMLTMLAEE---NINYAHIIVKVVEYYISQVAPEFKLPILYLIDSIVKNVKSSYVQLFGQCIVNIFLHAFESVQHSQSQVLEKVRERMYALRQTWNEVFP 131          
BLAST of Protein CLP1 homolog vs. Ensembl Fly
Match: Pcf11 (gene:FBgn0264962 transcript:FBtr0345528)

HSP 1 Score: 54.299 bits (129), Expect = 6.568e-7
Identity = 33/117 (28.21%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSV------IDIREKSKYYFIRKSWENHFP 439
            E+ + L  L+ N+  LI  L++ AEE   N   A   V ++   I +   + K+  LY++D I+KNV   Y++LF + +  +F+ +  SV      +  + + + Y +R++W   FP
Sbjct:   18 EYLSSLQDLNCNSKPLINMLTMLAEE---NINYAHIIVKVVEYYISQVAPEFKLPILYLIDSIVKNVKSSYVQLFGQCIVNIFLHAFESVQHSQSQVLEKVRERMYALRQTWNEVFP 131          
BLAST of Protein CLP1 homolog vs. Ensembl Fly
Match: Pcf11 (gene:FBgn0264962 transcript:FBtr0339986)

HSP 1 Score: 54.299 bits (129), Expect = 6.784e-7
Identity = 33/117 (28.21%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSV------IDIREKSKYYFIRKSWENHFP 439
            E+ + L  L+ N+  LI  L++ AEE   N   A   V ++   I +   + K+  LY++D I+KNV   Y++LF + +  +F+ +  SV      +  + + + Y +R++W   FP
Sbjct:   18 EYLSSLQDLNCNSKPLINMLTMLAEE---NINYAHIIVKVVEYYISQVAPEFKLPILYLIDSIVKNVKSSYVQLFGQCIVNIFLHAFESVQHSQSQVLEKVRERMYALRQTWNEVFP 131          
BLAST of Protein CLP1 homolog vs. Ensembl Fly
Match: Pcf11 (gene:FBgn0264962 transcript:FBtr0339985)

HSP 1 Score: 54.299 bits (129), Expect = 6.915e-7
Identity = 33/117 (28.21%), Postives = 61/117 (52.14%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSV------IDIREKSKYYFIRKSWENHFP 439
            E+ + L  L+ N+  LI  L++ AEE   N   A   V ++   I +   + K+  LY++D I+KNV   Y++LF + +  +F+ +  SV      +  + + + Y +R++W   FP
Sbjct:   18 EYLSSLQDLNCNSKPLINMLTMLAEE---NINYAHIIVKVVEYYISQVAPEFKLPILYLIDSIVKNVKSSYVQLFGQCIVNIFLHAFESVQHSQSQVLEKVRERMYALRQTWNEVFP 131          
BLAST of Protein CLP1 homolog vs. Ensembl Zebrafish
Match: clp1 (cleavage and polyadenylation factor I subunit 1 [Source:NCBI gene;Acc:565621])

HSP 1 Score: 114.39 bits (285), Expect = 2.781e-26
Identity = 108/401 (26.93%), Postives = 183/401 (45.64%), Query Frame = 2
Query: 1751 LNSEEIVRFF--CLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFY--EQHKLFKH--ELKADEVKIYY--TKSLNDS--------NDSNFINIPFQE--------IILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            L+ E  +RF       V++ L  G AEI+G+ L  N +      +   + ++ GC + + G      V K     LY     LN H  LE  R +A K++ RGPR+++ GP       ST+ R L NY+VR GR   LV LD   +   +P ++S   I+   D+  G+     PLVF+FG  +P  N +LY +   +LA+  + RCE +    +GGCIIN   +      + ++     F+V+V+L++      N L   +P +V+++ +PK               R E+I  YFY       + H  +++  +V+IY     S+ DS        +D+    +P           + ++SV   ++      I  SP   ++++T V      +TV++
Sbjct:   29 LDKETELRFEVEAGERVQLELLSGLAEIFGSELNRNKKYTFGPGSKIAVFTWQGCGVALSGKTEVAYVSKDTPMLLY-----LNTHAALEQMRRQAEKDNERGPRVMVVGP--TDVGKSTVCRMLLNYAVRLGRRPTLVELDVGQSSVSVPGTMSALCIERPADVEEGFSV-QAPLVFHFGSTTPGTNIKLYNKLTSSLADAFSQRCEVNRRASVGGCIINTCGWVKGSGYQALVHCASAFQVDVVLVLDQERLYNELKRDLPHFVRVVLLPKSGGVVERSKDCRRETRDEKIREYFYGFRGTSFYPHAFDVRFSDVRIYKIGAPSIPDSCLPLGMSQDDTQLKLVPVSPGRDLTHHVLSVSSVDDEAEVGQSRGILESPACGFIVVTAVDTQAQVMTVLS 421          
BLAST of Protein CLP1 homolog vs. Ensembl Zebrafish
Match: pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:ZFIN;Acc:ZDB-GENE-041114-175])

HSP 1 Score: 60.4622 bits (145), Expect = 1.232e-8
Identity = 50/154 (32.47%), Postives = 83/154 (53.90%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKE--NDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDIREKSKYYFIRKSWENHFPXXXXXXXXXXXXXXXPLWRNDSLAFNTAIVNKSINKNNETL 562
            E+++ L  L  N+   I  L++ AEE+ +   DI+A     +I  +I +AP   K+  LY++D I+KNVG  Y+++F+K+L   FI  V   +D   +   + +R +W+  FP   L  +D  ++ +DP W    L  N   VN SI+ N + L
Sbjct:   13 EYQSSLEDLTFNSKPHINMLTILAEENIQFTKDIVA-----IIEAQIAKAPPVEKLPVLYLVDSIVKNVGGAYLEVFAKNLVNSFI-CVFEKVDEGTRKSLFKLRSTWDEIFPLKKLYALDVRVNSVDPAWPIKPLPPN---VNASIHVNPKFL 157          
BLAST of Protein CLP1 homolog vs. Ensembl Zebrafish
Match: pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:ZFIN;Acc:ZDB-GENE-041114-175])

HSP 1 Score: 60.4622 bits (145), Expect = 1.306e-8
Identity = 50/154 (32.47%), Postives = 83/154 (53.90%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKE--NDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDIREKSKYYFIRKSWENHFPXXXXXXXXXXXXXXXPLWRNDSLAFNTAIVNKSINKNNETL 562
            E+++ L  L  N+   I  L++ AEE+ +   DI+A     +I  +I +AP   K+  LY++D I+KNVG  Y+++F+K+L   FI  V   +D   +   + +R +W+  FP   L  +D  ++ +DP W    L  N   VN SI+ N + L
Sbjct:   13 EYQSSLEDLTFNSKPHINMLTILAEENIQFTKDIVA-----IIEAQIAKAPPVEKLPVLYLVDSIVKNVGGAYLEVFAKNLVNSFI-CVFEKVDEGTRKSLFKLRSTWDEIFPLKKLYALDVRVNSVDPAWPIKPLPPN---VNASIHVNPKFL 157          
BLAST of Protein CLP1 homolog vs. Ensembl Xenopus
Match: clp1 (cleavage and polyadenylation factor I subunit 1 [Source:NCBI gene;Acc:493364])

HSP 1 Score: 125.561 bits (314), Expect = 6.020e-30
Identity = 106/383 (27.68%), Postives = 181/383 (47.26%), Query Frame = 2
Query: 1787 NNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFY-EQHKLFKH--ELKADEVKIYYTKS---------LNDSNDSNFINI----PFQEII--LNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            + VR+ L  G AE++GT L  N +      +   I ++ GC++ + G+ +   V +     LY     LN    LE  R +A +   RGPR+L+ GP       STL R L NY+VR GR   LV LD       +P ++    ++   D+  G+     PLV++FG  +P  N +LY +    LA+  N+RC+++    + GC+IN   +      + ++ A   FEV+V+L++      N L   +P +V+ + +PK    +    +     R +R+  YFY  +  L+ H  E+K  EV++Y   +         L  S + N + +    P +++   L SV  L    + + I    +  +++IT V     TLTV++
Sbjct:   41 DPVRVELVSGLAEVFGTELTRNKKYTFPPGSRAAIFTWHGCTVQLWGSPDVAYVSRDTPMLLY-----LNTQVGLEQMRAQAEREGERGPRVLVAGP--SDVGKSTLCRLLLNYAVRRGRRPTLVELDVGQGSVSVPGTVGALCVERPADVEEGFS-AQAPLVYHFGSTTPGTNIKLYNKLTSRLAHVFNLRCDSNRRASVSGCLINTCGWVKGSGYQALIHAASAFEVDVVLVLDQERLYNDLLRDLPHFVRTLLLPKSGGASERSKECRRESRDQRVREYFYGPRGSLYPHAFEIKFSEVRVYKVGAPSIPDSCLPLGMSQEDNQLKLVPVTPGRDMAHHLLSVVPLDGGGAEEGIEERSVAGFIVITGVDTERQTLTVLS 415          
BLAST of Protein CLP1 homolog vs. Ensembl Xenopus
Match: pcf11 (PCF11, cleavage and polyadenylation factor subunit [Source:NCBI gene;Acc:100170197])

HSP 1 Score: 57.7658 bits (138), Expect = 1.160e-7
Identity = 54/208 (25.96%), Postives = 98/208 (47.12%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDIREKSKYYFIRKSWENHFPXXXXXXXXXXXXXXXPLW---------RNDSLAFNTAIVNKSINKNNETLQSLPIVSSKLKSESYVYWKDNMCTPN--IDCNKENVEIDFPSTNELL 697
            ++++ L  L  N+   I  L++ AEE+ +    A   V LI  +I +A    K+  +Y++D I+KNVG  Y+  F+K+L   FI  V   +D   +   Y +R +W+  FP   L  +D  + +IDP W            S+  N   +NKS+   + T    P+ + K  S+  +  +  +      ++  ++ +E++   T E L
Sbjct:   14 DYQSSLEDLTFNSKPHINMLTILAEENVQ---FAKDIVILIEAQIAKARATEKLPVMYLMDSIVKNVGRDYLAAFAKNLVTTFI-CVFEKVDENTRKSLYKLRSTWDELFPSKKLYALDVRVSQIDPAWPVKPLPPNVNTSSIHVNPKFLNKSLGLYSPTKALPPVQAQKHLSQEQLIRQQLLVKQKQLLELQQKKLELELEQTREQL 217          
BLAST of Protein CLP1 homolog vs. Ensembl Xenopus
Match: pcf11 (PCF11, cleavage and polyadenylation factor subunit [Source:NCBI gene;Acc:100170197])

HSP 1 Score: 55.8398 bits (133), Expect = 4.608e-7
Identity = 41/129 (31.78%), Postives = 68/129 (52.71%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDIREKSKYYFIRKSWENHFPXXXXXXXXXXXXXXXPLW 493
            ++++ L  L  N+   I  L++ AEE+ +    A   V LI  +I +A    K+  +Y++D I+KNVG  Y+  F+K+L   FI  V   +D   +   Y +R +W+  FP   L  +D  + +IDP W
Sbjct:   14 DYQSSLEDLTFNSKPHINMLTILAEENVQ---FAKDIVILIEAQIAKARATEKLPVMYLMDSIVKNVGRDYLAAFAKNLVTTFI-CVFEKVDENTRKSLYKLRSTWDELFPSKKLYALDVRVSQIDPAW 138          
BLAST of Protein CLP1 homolog vs. Ensembl Mouse
Match: Clp1 (CLP1, cleavage and polyadenylation factor I subunit [Source:MGI Symbol;Acc:MGI:2138968])

HSP 1 Score: 122.865 bits (307), Expect = 3.358e-29
Identity = 108/404 (26.73%), Postives = 181/404 (44.80%), Query Frame = 2
Query: 1724 DSKSGNKIILNSEEIVRFF--CLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKLF---KHELKADEVKIYYTKS---------LNDSNDSNFINI----PFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            D K   K  L  E  +RF      +V++ L  G AEI+GT L  N +          + ++ GCS+ + G      V K     LY     LN H  LE  R +A K + RGPR+++ GP       ST+ R L NY+VR GR    V LD       +P ++    I+   D+  G+     PLV++FG  +P  N +LY +    LA+  N RCE +    + GC+IN   +   +  + ++ A   FEV+V++++      N L   +P +V+ + +PK               R ERI  YFY     F      +K  +VKIY   +         L  S + N + +    P ++++ + +   +   + + +S + +  ++++T V   +   TV++
Sbjct:    8 DKKPTTKFELERETELRFEVEASQSVQLELLAGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSLQLSGRTEVAYVSKDTPMLLY-----LNTHTALEQMRRQAEKEEERGPRVMVVGP--TDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI-QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGYGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDVEHQVFTVLS 403          
BLAST of Protein CLP1 homolog vs. Ensembl Mouse
Match: Clp1 (CLP1, cleavage and polyadenylation factor I subunit [Source:MGI Symbol;Acc:MGI:2138968])

HSP 1 Score: 122.865 bits (307), Expect = 3.358e-29
Identity = 108/404 (26.73%), Postives = 181/404 (44.80%), Query Frame = 2
Query: 1724 DSKSGNKIILNSEEIVRFF--CLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKLF---KHELKADEVKIYYTKS---------LNDSNDSNFINI----PFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            D K   K  L  E  +RF      +V++ L  G AEI+GT L  N +          + ++ GCS+ + G      V K     LY     LN H  LE  R +A K + RGPR+++ GP       ST+ R L NY+VR GR    V LD       +P ++    I+   D+  G+     PLV++FG  +P  N +LY +    LA+  N RCE +    + GC+IN   +   +  + ++ A   FEV+V++++      N L   +P +V+ + +PK               R ERI  YFY     F      +K  +VKIY   +         L  S + N + +    P ++++ + +   +   + + +S + +  ++++T V   +   TV++
Sbjct:    8 DKKPTTKFELERETELRFEVEASQSVQLELLAGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSLQLSGRTEVAYVSKDTPMLLY-----LNTHTALEQMRRQAEKEEERGPRVMVVGP--TDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI-QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGYGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDVEHQVFTVLS 403          
BLAST of Protein CLP1 homolog vs. Ensembl Mouse
Match: Pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:MGI Symbol;Acc:MGI:1919579])

HSP 1 Score: 60.8474 bits (146), Expect = 1.027e-8
Identity = 49/171 (28.65%), Postives = 85/171 (49.71%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDIREKSKYYFIRKSWENHFPXXXXXXXXXXXXXXXPLW---------RNDSLAFNTAIVNKSINKNNE--TLQSLPIVSS 586
            ++++ L  L  N+   I  L++ AEE   N   A   V+LI  +  +AP   K+  +Y++D I+KNVG  Y+  F+K+L   FI  V   +D   +   + +R +W+  FP   L  +D  ++ +DP W            S+  N   +NKS ++ +   T+ S P +S+
Sbjct:   21 DYQSSLEDLTFNSKPHINMLTILAEE---NLPFAKEIVSLIEAQTAKAPSSEKLPVMYLMDSIVKNVGREYLTAFTKNLVATFI-CVFEKVDENTRKSLFKLRSTWDEIFPLKKLYALDVRVNSLDPAWPIKPLPPNVNTSSIHVNPKFLNKSPDEPSTPGTVVSSPSIST 187          
BLAST of Protein CLP1 homolog vs. UniProt/SwissProt
Match: sp|Q6NS21|CLP1_XENLA (Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Xenopus laevis OX=8355 GN=clp1 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.217e-30
Identity = 105/383 (27.42%), Postives = 182/383 (47.52%), Query Frame = 2
Query: 1787 NNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFY-EQHKLFKH--ELKADEVKIYYTKS---------LNDSNDSNFINI----PFQEII--LNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            + VR+ L  G AE++GT L  N +      +   I ++ GC++ + G+ +   V +     LY     LN    LE  R++A +   RGPR+L+ GP       STL R L NY+VR GR   LV LD       +P ++    ++   D+  G+     PLV++FG  +P  N +LY +    LA+  N+RC+++    + GC+IN   +      + ++ A   FEV+V+L++      N L   +P +V+ + +PK    +    +     R +R+  YFY  +  L+ H  E+K  EV++Y   +         L  S + N + +    P +++   L SV  L    + + I    +  +++IT V     TLT+++
Sbjct:   43 DPVRVELVSGLAEVFGTELTRNKKYTFPPGSRAAIFTWHGCTVQLWGSPDMAYVSRDTPMLLY-----LNTQVGLEQMRVQAEREGERGPRVLVAGP--SDVGKSTLCRLLLNYAVRRGRRPTLVELDVGQGSVSVPGTMGALCVERPADVEEGFS-AQAPLVYHFGSTTPGTNIKLYNKLTSRLAHVFNLRCDSNRRASVSGCLINTCGWVKGSGYQALIHAASAFEVDVVLVLDQERLYNDLLRDLPHFVRTLLLPKSGGASERSKECRRESRDQRVREYFYGPRGSLYPHAFEIKFSEVRVYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRDMAHHLLSVVPLDGGSAEEGIEERSVAGFIVITGVDTERQTLTLLS 417          
BLAST of Protein CLP1 homolog vs. UniProt/SwissProt
Match: sp|Q66JK4|CLP1_XENTR (Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Xenopus tropicalis OX=8364 GN=clp1 PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 3.189e-29
Identity = 106/383 (27.68%), Postives = 181/383 (47.26%), Query Frame = 2
Query: 1787 NNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFY-EQHKLFKH--ELKADEVKIYYTKS---------LNDSNDSNFINI----PFQEII--LNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            + VR+ L  G AE++GT L  N +      +   I ++ GC++ + G+ +   V +     LY     LN    LE  R +A +   RGPR+L+ GP       STL R L NY+VR GR   LV LD       +P ++    ++   D+  G+     PLV++FG  +P  N +LY +    LA+  N+RC+++    + GC+IN   +      + ++ A   FEV+V+L++      N L   +P +V+ + +PK    +    +     R +R+  YFY  +  L+ H  E+K  EV++Y   +         L  S + N + +    P +++   L SV  L    + + I    +  +++IT V     TLTV++
Sbjct:   41 DPVRVELVSGLAEVFGTELTRNKKYTFPPGSRAAIFTWHGCTVQLWGSPDVAYVSRDTPMLLY-----LNTQVGLEQMRAQAEREGERGPRVLVAGP--SDVGKSTLCRLLLNYAVRRGRRPTLVELDVGQGSVSVPGTVGALCVERPADVEEGFS-AQAPLVYHFGSTTPGTNIKLYNKLTSRLAHVFNLRCDSNRRASVSGCLINTCGWVKGSGYQALIHAASAFEVDVVLVLDQERLYNDLLRDLPHFVRTLLLPKSGGASERSKECRRESRDQRVREYFYGPRGSLYPHAFEIKFSEVRVYKVGAPSIPDSCLPLGMSQEDNQLKLVPVTPGRDMAHHLLSVVPLDGGGAEEGIEERSVAGFIVITGVDTERQTLTVLS 415          
BLAST of Protein CLP1 homolog vs. UniProt/SwissProt
Match: sp|P52874|CLP1_CAEEL (Protein clpf-1 OS=Caenorhabditis elegans OX=6239 GN=clpf-1 PE=1 SV=2)

HSP 1 Score: 125.176 bits (313), Expect = 4.343e-29
Identity = 114/405 (28.15%), Postives = 193/405 (47.65%), Query Frame = 2
Query: 1787 NNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNII-LNIHYDLE---LKRIEALK---NDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSFHSSE---IILKAIQLFEVNVLLLISDSSTI-NLSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHK----LFKHELKADEVKI--YYTKSLNDS----------NDSNFINIPFQEIILNSVCALSQALSFDE-ISTSPILCYLLITDVSECYSTLTVMTEREFWPELYSILVLNGI 2917
            ++V + L KG AEI+GT L  N +      +     ++ G +I ++G      V         P +I LNIH  +E    KR E      N  +GPR+L+ GP       +T++R L NYSVR GRT   V LD   N   +P +++  ++Q   D+  G++  N P+VFNFG  SP AN  LY      +A  +N + + ++   IGG IIN   +   E    I+KA   FEV+V++++       +LS ++PE+V++ ++PK         +    +R E +H YFY         F  ++  D+V +     + L DS          +++  + +     I + + A S++   DE +  SP+  + L+T+V     T++++  +   P    +LV + I
Sbjct:   25 SDVCLELVKGYAEIFGTELLLNKKYTFPAKSRVAAFTWKGATIELVGTTESAYVAE-----STPMVIYLNIHAAMEEVRKKREEQAAGNSNKAKGPRLLLVGP--TDVGKTTVSRILCNYSVRQGRTPIFVELDVGQNSVSVPGTVAAVLVQKTADVIDGFER-NQPIVFNFGHTSPSANLSLYEALFKEMATTLNAQIQENDEAKIGGMIINTCGWVDGEGYKCIVKAASAFEVDVVIVLDHERLYSDLSKELPEFVRLTHVPKSGGVEQRTGQIRSKMRGENVHRYFYGTRANNLYPFTFDVSFDDVTLCKIGAEQLPDSCLPFGMEVENHETKLVIMEPSADIKHHLFAFSRSTKADENVLKSPVFGFCLVTEVDLEKRTMSILCPQRTIPS--KVLVFSDI 419          
BLAST of Protein CLP1 homolog vs. UniProt/SwissProt
Match: sp|Q5PQL4|CLP1_RAT (Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Rattus norvegicus OX=10116 GN=Clp1 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.349e-28
Identity = 108/404 (26.73%), Postives = 181/404 (44.80%), Query Frame = 2
Query: 1724 DSKSGNKIILNSEEIVRFF--CLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKLF---KHELKADEVKIYYTKS---------LNDSNDSNFINI----PFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            D K   K  L  E  +RF      +V++ L  G AEI+GT L  N +          + ++ GCS+ + G      V K     LY     LN H  LE  R +A K + RGPR+++ GP       ST+ R L NY+VR GR    V LD       +P ++    I+   D+  G+     PLV++FG  +P  N +LY +    LA+  N RCE +    + GC+IN   +   +  + ++ A   FEV+V++++      N L   +P +V+ + +PK               R ERI  YFY     F      +K  +VKIY   +         L  S + N + +    P ++++ + +   +   + + +S + +  ++++T V   +   TV++
Sbjct:    8 DKKPTTKFELERETELRFEVEASQSVQLELLAGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSLQLSGRTEVAYVSKDTPMLLY-----LNTHTALEQMRRQAEKEEERGPRVMVVGP--TDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI-QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGYGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDVEHQVFTVLS 403          
BLAST of Protein CLP1 homolog vs. UniProt/SwissProt
Match: sp|Q99LI9|CLP1_MOUSE (Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Mus musculus OX=10090 GN=Clp1 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.349e-28
Identity = 108/404 (26.73%), Postives = 181/404 (44.80%), Query Frame = 2
Query: 1724 DSKSGNKIILNSEEIVRFF--CLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKLF---KHELKADEVKIYYTKS---------LNDSNDSNFINI----PFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            D K   K  L  E  +RF      +V++ L  G AEI+GT L  N +          + ++ GCS+ + G      V K     LY     LN H  LE  R +A K + RGPR+++ GP       ST+ R L NY+VR GR    V LD       +P ++    I+   D+  G+     PLV++FG  +P  N +LY +    LA+  N RCE +    + GC+IN   +   +  + ++ A   FEV+V++++      N L   +P +V+ + +PK               R ERI  YFY     F      +K  +VKIY   +         L  S + N + +    P ++++ + +   +   + + +S + +  ++++T V   +   TV++
Sbjct:    8 DKKPTTKFELERETELRFEVEASQSVQLELLAGMAEIFGTELTRNKKFTFDAGAKVAVFTWHGCSLQLSGRTEVAYVSKDTPMLLY-----LNTHTALEQMRRQAEKEEERGPRVMVVGP--TDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI-QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGYGYQALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDERIREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRDMVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDVEHQVFTVLS 403          
BLAST of Protein CLP1 homolog vs. TrEMBL
Match: A0A0R3UH12 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6569 PE=3 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.049e-41
Identity = 129/420 (30.71%), Postives = 208/420 (49.52%), Query Frame = 2
Query: 1721 LDSKSGNKIILNSEEIVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSFHSS--------EIILKAIQLFEVNVLLLISDS--STINLSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYE---QHKLFKHELK--ADEVKIYYT------------KSLNDSNDSNFINIPF-----QEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMTEREFWP 2884
            L S    + +L   +++R+     V++ L  G AEI+GT L    E+ +       I++F GC I+V G+  +  V +   D   P++ +NIH +L++ R +A +   RGPR+L+ GP  E    S L RTLANY+ R G    LV+++   N   +P++I+   +   +DL  GW    DPLVF FG   P AN  L+ EQ+  LA+ VNIR END+ +   GCIIN G F  +        E I      FEV+++L+I D   ST  L   + + V+II +P+     N  P++    R  R+ AYF+    Q +L  H LK  A E  +Y               + +   ++     P      ++ + N + A+SQA   + I +SP+  ++++  V++  S+  V++     P
Sbjct:    6 LPSVQTTEYVLKKYQMLRYEANAQVKLVLVSGKAEIFGTELVCGTELIMENGQRGTIVTFHGCKILVRGSGLDAFVMTAVEDHDLPHVYMNIHANLQVARKKATEEQSRGPRVLVCGP--ECVGKSVLCRTLANYATRRGSKPILVDVNVGLNQVCIPSTIAALAVTKPYDLLEGWGLEEDPLVFCFGHLDPSANLNLFREQVSQLADLVNIRSENDSKVFSSGCIINMGGFSKTADRKQAGLEAIRTTASAFEVDIVLVIEDGFLSTF-LHEDLSKEVKIIRLPRSSGAVNCSPEQCMLQRDLRVSAYFHGENLQRRLHPHHLKLNASEYTVYKVGNEVIPDSLLPHGARDAEEETKGWRTPIALTVSRDTLKNRLLAVSQATELERIPSSPVYGFVVVLSVADDRSSFNVLSPSPELP 422          
BLAST of Protein CLP1 homolog vs. TrEMBL
Match: A0A0X3NU72 (Protein CLP1 homolog OS=Schistocephalus solidus OX=70667 GN=CLP1 PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 8.956e-40
Identity = 126/399 (31.58%), Postives = 194/399 (48.62%), Query Frame = 2
Query: 1748 ILNSEEIVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSFHSS---------EIILKAIQLFEVNVLLLISDS-STINLSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFY---EQHKLFKHE--LKADEVKIYY--TKSLNDS----------NDSNFINIPFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVM 2863
            +L   +++RF    +V I L  G AEI+GT +    ++ L       I++F GC I V        + +   D   P++ +NIH +LE  R +A++   RGPR+LI G   E+   STL RTL NY+ R      LV+++   N   +P +++   +   +DL  GW    DPLVF FG   P AN  L+ EQ++ LA+ VNIR END  +   GCIIN G F            + I      FEV+ +L+I D   T  L   +P+ V II +PK        P++    R  R+ AYF+    Q +L  H+  L   E  +Y   T+++ D+               I +P    + N + A+SQA   D+I  +PI  ++++  VSE  ++  V+
Sbjct:   16 VLEKYQMLRFEASCSVSIVLISGMAEIFGTEIVCGTDLLLEAGQRGTIVTFHGCKIAVKDQGLAAYIMTAAEDQEIPHVFINIHANLEAARKKAVETQSRGPRVLICGQ--ESVGKSTLCRTLVNYATRKNAKPILVDVNVGLNQICIPTTMAAMAVTKPYDLYEGWGLEEDPLVFCFGHLDPAANLNLFREQVNQLADLVNIRSENDAKVFTSGCIINMGGFSKGGKDGKQGGIQAIRTTAAAFEVDTVLVIEDGFLTSFLQEDLPKEVTIIRLPKSSGVVTRSPEQWMRQRDLRVRAYFHGENPQRRLHPHQLTLSTSEYSVYKVGTEAIPDALLPHGAREEETWRTPIPVPINRDLKNRLLAVSQATEVDQIPEAPIYGFMVVLSVSEDRTSFNVL 412          
BLAST of Protein CLP1 homolog vs. TrEMBL
Match: A0A087VYM0 (Polyribonucleotide 5' hydroxyl kinase Clp1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000118700 PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.602e-39
Identity = 128/410 (31.22%), Postives = 204/410 (49.76%), Query Frame = 2
Query: 1751 LNSEEIVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSFHSS----EIILKAIQ----LFEVNVLLLISDS--STINLSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQ---HKLFKHELK--ADEVKIYYTKS------------LNDSNDSNFINIPF-----QEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMTEREFWP 2884
            L   +++R+   + V+I +  GTAEI+GT L    ++ L       +++F GC I V G+  +  V     D    ++ +NIH +L+  R +A ++  RGPR+L+ GP  E    S L RTLANY+ R G    LV+ +   N   +P++I+   +   +DL  GW    DPLVF FG   P AN  L+ EQ++ LA+ VNIR END  +   GCII  G F  +    +  L AI+     FEV++ L+I D   ST  L   + + V II +P+     NF PK+    R  RI AYF+ +    +L  H L+  A E  +Y   S             +   ++     P      ++ + N + A+SQA   ++I++SP+  ++++  V+E  +   V++     P
Sbjct:   17 LEKYQMLRYEANSQVKIVMTSGTAEIFGTELVCGTDLVLEAGERGTVVTFHGCKITVKGSGLDAFVMDAVEDHDLLHVYVNIHANLQEARKKATEDQSRGPRVLVCGP--ENVGKSVLCRTLANYAARRGSKPILVDANVGLNQVCIPSTIAALAVTKPYDLLEGWGLEEDPLVFCFGHLDPSANLNLFREQVNQLADLVNIRSENDAKVFSSGCIIKMGGFSKTPEKKQAGLDAIRTTAAAFEVDIALVIEDGFLSTF-LQEDLSKDVTIIRLPRSSGAINFTPKQSMRQRDLRISAYFHGENLKRRLHPHHLRLSASEYTVYRVGSEAIPDALLPHGARDAEEETQSWRTPIALTVSRDALKNRLLAVSQATDPEQIASSPVFGFVVVLSVAEDRTHFNVLSPSPELP 423          
BLAST of Protein CLP1 homolog vs. TrEMBL
Match: A0A0R3W855 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6519 PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 9.757e-37
Identity = 131/417 (31.41%), Postives = 207/417 (49.64%), Query Frame = 2
Query: 1751 LNSEEIVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQ-----LDALANYVNIRCEXXXXXXXXXXXXXXXSFHSS----EIILKAIQ----LFEVNVLLLISDS--STINLSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQ---HKLFKHELK--ADEVKIYYTKS------------LNDSNDSNFINIPF-----QEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMTEREFWPEL 2890
            L   +++R+     V+I +  GTAEI+GT L    ++ L++     +++F GC I V G   +  V     D    ++ +NIH +L+  R +A ++  RGPR+L+ GP  E    S L RTL NY+ R G    LV+++   N   +P++I+   +   +DL  GW    DPLVF FG   P AN  L+ EQ     ++ LA  VNIR END  +   GCII  G F  +    E  L+AI+     FEV+++L+I D   ST  L   + + V II +P+     NF PK+    R  RI AYF+ +    +L  H LK  A E  +Y   S             +   ++     P      ++ + N + A+SQA   ++I++SP+  ++++  V+E  +   V++     PEL
Sbjct:   17 LEKYQMLRYEANAQVKIVMTSGTAEIFGTELVCGTDLVLQEGERGTVVTFHGCKITVKGLGLDAFVMDAVEDHDLLHVYMNIHANLQEARKKATEDQSRGPRVLVCGP--ENVGKSVLCRTLVNYAARRGSKPILVDVNVGLNQVCIPSTIAALAVTKPYDLLEGWGLEEDPLVFCFGHLDPSANLNLFTEQASSNIVNQLAELVNIRSENDAKVFSSGCIIKMGGFSKTPEKKEAGLEAIRTTAAAFEVDIVLVIEDGFLSTF-LQEDLLKDVTIIRLPRSSGAVNFNPKQSMRQRDLRISAYFHGENFKRRLHPHHLKLSASEYTVYRVGSEAIPDALLPHGARDAEAETQSWRTPIALAVSRDALKNRLLAVSQATEPEQIASSPVYGFVVVLSVAEDRTFFNVLSPS---PEL 427          
BLAST of Protein CLP1 homolog vs. TrEMBL
Match: A0A430QGI2 (Polyribonucleotide 5'-hydroxyl-kinase OS=Schistosoma bovis OX=6184 GN=DC041_0005868 PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 3.974e-36
Identity = 119/403 (29.53%), Postives = 193/403 (47.89%), Query Frame = 2
Query: 1766 IVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSFH--------SSEIILKAIQ----LFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQ---HKLFKHE--LKADEVKIYYTKS------------LNDSNDSNFINIPFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMTEREFWP 2884
            ++RF   +   + L  G AE++GT L    E++L       +++F GC ++V        + +   D    ++ +NIH +LE+ R +A+K   RGPR+L+ G   E+   STL RTLA+Y+ R      LV+++   N   +P +I+   +   +DL  GW    DPLVF FG   P +N  L+ EQ++ LA  +NIR END ++   GCIIN   F         S E  ++AI+     FEV+ LL+I D    + L   +P  V I+ +PK        P +    R  R+ AY + +    +L  H+  LK+ E  IY   S              +    N I +     + N + A+SQA    ++  +P+  ++++  VSE  S  T+++     P
Sbjct:    1 MLRFEVTSPSGLTLVSGAAEVFGTELVCGWELQLYPGQRGTVVTFHGCKLIVQDQGVAAYIIASSEDQEIVHVYMNIHANLEVSRQKAVKEQSRGPRVLVCG--QESVGKSTLCRTLASYAARRKHKPILVDVNVGLNQVCIPTTIAAISVTKPYDLMEGWSLEEDPLVFCFGHTDPASNLNLFREQVNRLAELINIRSENDMSIFTSGCIINMSGFRKDDSDGGSSKEKGIQAIRTTAAAFEVDTLLVIEDGFLASFLREDLPPEVTIVRLPKSSGAITRSPDQWTRQRDARVCAYLHGENPLRRLHPHQITLKSSEYSIYKVGSEAIPDALLPHGAQEEETWRNPIQVSVSRDLKNRLLAVSQASEPYQVPEAPVYGFIVVVSVSEDKSAFTILSPSSHPP 401          
BLAST of Protein CLP1 homolog vs. Ensembl Cavefish
Match: clp1 (cleavage and polyadenylation factor I subunit 1 [Source:NCBI gene;Acc:103032393])

HSP 1 Score: 108.997 bits (271), Expect = 1.085e-24
Identity = 102/389 (26.22%), Postives = 178/389 (45.76%), Query Frame = 2
Query: 1787 NNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNII-LNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFY--EQHKLFKH--ELKADEVKIY--YTKSLNDS--------NDSNFINIPFQEIILNSVCALSQALSFDEIST----------SPILCYLLITDVSECYSTLTVMT 2866
              V++ L  G  E++G+ L  N        +   + ++ GCS+ + G   + +V  I  D   P ++ LN H  LE  R +A +++ RGPR+++ GP       ST+ R L NY+VR GR   LV LD   +   +P ++S   I+   D+  G+     PLVF+FG  +P  N +LY +    LA   + RCE +    +GGCIIN   +      + ++     F+V+V+L++      N L   +P +V+++ +PK               R ++I  YFY       + H  +++  +V+IY     S+ DS        +D+    +P       +   LS +   DE+            SP+  ++++T V      +TV++
Sbjct:   29 ERVQLELLTGMGEVFGSELNRNKRYTFGPGSKIAVFTWQGCSLSLSG---KTEVAYISKD--TPMLLYLNTHAALEQMRRQAERDNERGPRVMVVGP--TDVGKSTVCRVLLNYAVRLGRRPTLVELDVGQSSVSVPGTMSALCIERPADVEEGFSV-QAPLVFHFGSTTPGTNIKLYNKLTSCLAEVFSQRCEVNRRASVGGCIINTCGWVKGSGYQALVHCASAFQVDVVLVLDQERLYNELKRDLPHFVRVVLLPKSGGVVERSKDCRRETRDDKIREYFYGFRGTSFYPHAFDVRFSDVRIYKIGAPSIPDSCLPLGMSQDDTQLKLVPVSPGRDLTHHVLSVSCVEDEVDGGSGQSRGILESPVCGFIVVTAVDTQAQVMTVLS 409          
BLAST of Protein CLP1 homolog vs. Ensembl Cavefish
Match: clp1 (cleavage and polyadenylation factor I subunit 1 [Source:NCBI gene;Acc:103032393])

HSP 1 Score: 108.997 bits (271), Expect = 1.316e-24
Identity = 103/404 (25.50%), Postives = 185/404 (45.79%), Query Frame = 2
Query: 1787 NNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNII-LNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFY--EQHKLFKH--ELKADEVKIYY--TKSLNDS--------NDSNFINIPFQEIILNSVCALSQALSFDEIST----------SPILCYLLITDVSECYSTLTVMTEREFWPELYSILVLN 2911
              V++ L  G  E++G+ L  N        +   + ++ GCS+ + G   + +V  I  D   P ++ LN H  LE  R +A +++ RGPR+++ GP       ST+ R L NY+VR GR   LV LD   +   +P ++S   I+   D+  G+     PLVF+FG  +P  N +LY +    LA   + RCE +    +GGCIIN   +      + ++     F+V+V+L++      N L   +P +V+++ +PK               R ++I  YFY       + H  +++  +V+IY     S+ DS        +D+    +P       +   LS +   DE+            SP+  ++++T V      +TV++        +++L+++
Sbjct:   43 ERVQLELLTGMGEVFGSELNRNKRYTFGPGSKIAVFTWQGCSLSLSG---KTEVAYISKD--TPMLLYLNTHAALEQMRRQAERDNERGPRVMVVGP--TDVGKSTVCRVLLNYAVRLGRRPTLVELDVGQSSVSVPGTMSALCIERPADVEEGFSV-QAPLVFHFGSTTPGTNIKLYNKLTSCLAEVFSQRCEVNRRASVGGCIINTCGWVKGSGYQALVHCASAFQVDVVLVLDQERLYNELKRDLPHFVRVVLLPKSGGVVERSKDCRRETRDDKIREYFYGFRGTSFYPHAFDVRFSDVRIYKIGAPSIPDSCLPLGMSQDDTQLKLVPVSPGRDLTHHVLSVSCVEDEVDGGSGQSRGILESPVCGFIVVTAVDTQAQVMTVLSPAPRPLPRHTLLIMD 438          
BLAST of Protein CLP1 homolog vs. Ensembl Cavefish
Match: pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:NCBI gene;Acc:103026916])

HSP 1 Score: 59.6918 bits (143), Expect = 1.867e-8
Identity = 50/155 (32.26%), Postives = 84/155 (54.19%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKE--NDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDIREKSKYYFIRKSWENHFPXXXXXXXXXXXXXXXPLWRNDSLAFNTAIVNKSINKNNETLQ 565
            E+++ L  L  N+   I  L++ AEE+ +   DI+A     +I  +I +AP   K+  LY++D I+KNVG  Y+++F+K+L   FI  V   +D   +   + +R +W++ F    L  +D  ++ IDP W    L  N   VN SI+ N + L+
Sbjct:   13 EYQSSLEDLTFNSKPHINMLTILAEENLQFTKDIVA-----IIEAQITKAPTAEKLPVLYLVDSIVKNVGGQYLEVFAKNLVTSFI-CVFEKVDENTRKSLFKLRSTWDDIFTLKKLYALDVRVNSIDPAWPIKPLPPN---VNASIHVNPKFLK 158          
BLAST of Protein CLP1 homolog vs. Ensembl Sea Lamprey
Match: clp1 (cleavage and polyadenylation factor I subunit 1 [Source:NCBI gene;Acc:565621])

HSP 1 Score: 103.219 bits (256), Expect = 1.681e-23
Identity = 105/407 (25.80%), Postives = 184/407 (45.21%), Query Frame = 2
Query: 1724 DSKSGNKIILNSEEIVRFFC--LNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVK--VKSICFDLYKPNIILNIHYDLELKRIEALKNDV-RGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSST-INLSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYE-QHKLFKH--ELKADEVKIYYTKS---------LNDSNDSNFINI----PFQEIILNSVCALSQALSFDE-ISTSPILCYLLITDVSECYSTLTVMT 2866
            D +   K  L  E  +RF         + L  G  EI+GT L  N        +   + ++ GCS+ + G + EV    K     LY     LN+H  LE  R++A + +  RGPR+++ GPG      STL R L +Y+ R GR   LV LD       +P ++++  I+   D   G++    PLV++FG  +P +N +LY + +  LA+  + RC+ +    I GC+IN   +      + ++ A   FE+ ++     +     L   +  +V+ + +PK               R E +  YFY  ++  F H  ++K  +VK+Y   +         L  S + N + +    P ++++ + V +LS A S  E +  + +  +L++T V       TV++
Sbjct:    6 DDRPMQKFDLEKEMELRFEVEPQQTATLELLSGMGEIFGTELTRNKRYVFDAGSKVAVFTWHGCSVQLTG-LTEVAYVAKETPMLLY-----LNVHAALEQMRVQAERQEEERGPRVMVAGPG--DVGKSTLCRLLCSYAARLGRRPTLVELDVGQGSVSIPGTLALLYIERPADTEEGFNL-QAPLVYHFGSTTPSSNVKLYNKVVSKLADVFDQRCKVNRRAAISGCVINTCGWVKGAGYQALIHAATAFELPIVDKYHRAKLYTELKRDLTHFVKTVLLPKSGGVVERSKNFRREGRDELVRRYFYGFRNAYFPHAFDVKFSDVKLYKVGAPPIPDSCLPLGMSQEENQLKVVPITPGRDLV-HHVLSLSMAESTQENLVEASVAGFLVVTAVDSERQVFTVLS 402          
BLAST of Protein CLP1 homolog vs. Ensembl Nematostella
Match: EDO49377 (Protein CLP1 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7RG82])

HSP 1 Score: 115.546 bits (288), Expect = 2.502e-27
Identity = 105/378 (27.78%), Postives = 186/378 (49.21%), Query Frame = 2
Query: 1799 IRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDV--RGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSFHSS---EIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFY-EQHKLFKH--ELKADEVKIYYTKS--LNDS----------NDSNFINIPFQEIILNSVCALSQALSFDE-ISTSPILCYLLITDVSECYSTLTVMT 2866
            I L  G AE++GT L  N +   R  +   I ++ GCS+ + G + EV  KS    +    + LN+H  LE  R  A K++    GPR+++ GP       ST+ + L NY+VR GR    V+LD       +P S+   +++   D+  G+     PLV+ FG  SP  N++LY      +A+ V  R E +      GC+IN   + +     II+ A   F+VNV++++      N L +Q  + VQI+++PK         +    +R ER+ +YFY +Q  L+ H  E+K  +VK++   +  + DS          N++  + +   + + + + A+S A S +E +  + ++ +L++ +V      + V++
Sbjct:   36 IVLLSGNAEVFGTELVKNKKFTFRPGSKLAIFTWQGCSVEIQGPL-EVAYKSKETPMV---MYLNLHMALEQMRERADKHEAVELGPRVMVVGP--TDVGKSTVCQLLLNYAVRMGRRPISVDLDVGQGTASVPGSMGALLLERPADIEEGFSL-QAPLVYLFGHTSPSPNEKLYNMLSSKIADIVFQRFERNKKACASGCVINTCGWVTGMGYRIIVHAATAFKVNVIVVLDQERLYNDLKNQFGDKVQIVHLPKSGGVVVRSRETRRKVRDERLRSYFYGQQANLYPHSFEVKFSDVKLFKIGAPLVPDSCLPLGMDQGQNETKLVPVVPTKDLKHCLLAISAAESLEEDLVQTNVIGFLVVNEVDLDREVMVVLS 406          
BLAST of Protein CLP1 homolog vs. Ensembl Nematostella
Match: EDO49720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFH3])

HSP 1 Score: 44.669 bits (104), Expect = 6.896e-6
Identity = 29/74 (39.19%), Postives = 41/74 (55.41%), Query Frame = 2
Query:  101 INEFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYI 322
            I E+ + L  L  N+  LI  L++ AEE   N   A + V LI  +I    Q+ ++  LY+LD IIKNVG  Y+
Sbjct:    9 IEEYASSLADLTFNSKPLINVLTMLAEE---NGQYAASIVKLIEKRIQTVAQQYRLPSLYLLDSIIKNVGGDYL 79          
BLAST of Protein CLP1 homolog vs. Ensembl Medaka
Match: CLP1 (cleavage and polyadenylation factor I subunit 1 [Source:NCBI gene;Acc:101158455])

HSP 1 Score: 113.235 bits (282), Expect = 5.409e-26
Identity = 89/306 (29.08%), Postives = 146/306 (47.71%), Query Frame = 2
Query: 1787 NNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKL----FKHELKADEVKIY 2677
              V + L  G AE++G+ L  N +      +   + ++ GCS+ + G      V K     LY     LN H  LE  R +A + + RGPR+++ GP       ST+ R L NY+VR GR   LV LD   +   +P ++S   I+   D+  G+     PLV++FG  +P  N +LY +    LA   + RCE +    +GGCIIN   +      + ++     F+V+V+L++      N L   +P +V+++ +PK         +     R E+I  YFY    +    F +E++  +V+IY
Sbjct:   42 EQVELELLSGLAEVFGSELNRNKKYVFGPGSKIAVFTWQGCSVNLHGKPEVAYVSKDTPMLLY-----LNTHAALEQMRKQAERENERGPRVMVVGP--TDVGKSTVCRMLLNYAVRVGRRPTLVELDVGQSGVSVPGTVSALCIERPADVEEGFSV-QAPLVYHFGSTTPGTNIKLYNKLTSCLAEMFSQRCEVNRKASVGGCIINTCGWVKGSGYQALVHCASTFQVDVVLVLDHERLYNELKRDLPHFVRVVLLPKSGGVVERSKECRRDTRDEKIREYFYGFRGVSYYPFSYEVRFSDVRIY 339          
BLAST of Protein CLP1 homolog vs. Ensembl Medaka
Match: CLP1 (cleavage and polyadenylation factor I subunit 1 [Source:NCBI gene;Acc:101158455])

HSP 1 Score: 108.227 bits (269), Expect = 1.566e-24
Identity = 84/284 (29.58%), Postives = 135/284 (47.54%), Query Frame = 2
Query: 1787 NNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKV-KSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSF---HSSEIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFY 2623
              V + L  G AE++G+ L  N +      +   + ++ GCS+ + G      V K     LY     LN H  LE  R +A + + RGPR+++ GP       ST+ R L NY+VR GR   LV LD   +   +P ++S   I+   D+  G+     PLV++FG  +P  N +LY +    LA   + RCE +    +GGCIIN   +      + ++     F+V+V+L++      N L   +P +V+++ +PK         +     R E+I  YFY
Sbjct:   42 EQVELELLSGLAEVFGSELNRNKKYVFGPGSKIAVFTWQGCSVNLHGKPEVAYVSKDTPMLLY-----LNTHAALEQMRKQAERENERGPRVMVVGP--TDVGKSTVCRMLLNYAVRVGRRPTLVELDVGQSGVSVPGTVSALCIERPADVEEGFSV-QAPLVYHFGSTTPGTNIKLYNKLTSCLAEMFSQRCEVNRKASVGGCIINTCGWVKGSGYQALVHCASTFQVDVVLVLDHERLYNELKRDLPHFVRVVLLPKSGGVVERSKECRRDTRDEKIREYFY 317          
BLAST of Protein CLP1 homolog vs. Ensembl Medaka
Match: pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:NCBI gene;Acc:101164244])

HSP 1 Score: 59.6918 bits (143), Expect = 1.809e-8
Identity = 47/148 (31.76%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDIREKSKYYFIRKSWENHFPXXXXXXXXXXXXXXXPLWRNDSLAFNTAIVNKSINKN 550
            E+++ L  L  N+   I  L++ AEE+ +    A   V +I  +I +AP   K+  LY++D I+KNVG  Y+  F+K+L   FI  V   +D   +   + +R +W+  FP   L  +D  ++ +DP W    L      VN SI+ N
Sbjct:   13 EYQSSLEDLTFNSKPHINMLTILAEENLQ---FAKDIVAIIEAQITKAPSSEKLPVLYLVDSIVKNVGGEYLAEFAKNLVTSFI-CVFEKVDENTRKSLFKLRSTWDEVFPTKKLYLLDVKVNSLDPAWPIKPLP---PTVNSSIHIN 153          
BLAST of Protein CLP1 homolog vs. Ensembl Medaka
Match: pcf11 (PCF11 cleavage and polyadenylation factor subunit [Source:NCBI gene;Acc:101164244])

HSP 1 Score: 59.6918 bits (143), Expect = 1.818e-8
Identity = 47/148 (31.76%), Postives = 76/148 (51.35%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDIREKSKYYFIRKSWENHFPXXXXXXXXXXXXXXXPLWRNDSLAFNTAIVNKSINKN 550
            E+++ L  L  N+   I  L++ AEE+ +    A   V +I  +I +AP   K+  LY++D I+KNVG  Y+  F+K+L   FI  V   +D   +   + +R +W+  FP   L  +D  ++ +DP W    L      VN SI+ N
Sbjct:   13 EYQSSLEDLTFNSKPHINMLTILAEENLQ---FAKDIVAIIEAQITKAPSSEKLPVLYLVDSIVKNVGGEYLAEFAKNLVTSFI-CVFEKVDENTRKSLFKLRSTWDEVFPTKKLYLLDVKVNSLDPAWPIKPLP---PTVNSSIHIN 153          
BLAST of Protein CLP1 homolog vs. Planmine SMEST
Match: SMESG000020165.1 (SMESG000020165.1)

HSP 1 Score: 1820.05 bits (4713), Expect = 0.000e+0
Identity = 939/951 (98.74%), Postives = 947/951 (99.58%), Query Frame = 2
Query:   80 MKYYLETINEFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDIREKSKYYFIRKSWENHFPXXXXXXXXXXXXXXXPLWRNDSLAFNTAIVNKSINKNNETLQSLPIVSSKLKSESYVYWKDNMCTPNIDCNKENVEIDFPSTNELLWKVDIPDYPLFPDIGTDPRLLRQWYTNEINQKIVINNTTHELLLNRIQPCIFLNETLHAVRFQCKNIQLFINGKLFDXXXXXXXXXXXXNQTFYVCLGGPWHEIVILGLPFHVPLDGQRHRIRFNNDNVFLQWLISSPIQIDLMPAIPSHIGEWGWRGMFGSPKYLNQRPLNPMKPPETFTRSRNSKINLKSNKFDNVKSCRTPLEMKRINSPQTNTKDSNNNSCEYSDNIKDNISLKLRQKLNQEAICQLYSSRLCLICSQTLNYADDMNFNLHMLQHSSCERHYQLLNDWIISDFVTDSTLNVHNCNTVVDYSDQIPKDRQLLKTISFDELINVEVTHALDSKSGNKIILNSEEIVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSFHSSEIILKAIQLFEVNVLLLISDSSTINLSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKLFKHELKADEVKIYYTKSLNDSNDSNFINIPFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMTEREFWPELYSILVLNGIVLEKK 2932
            MKYYLETINEFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDI+EKSKYYFIRKSWENHFPDDILND+DNALDKIDPLWRNDSLAFNT IVNKSINKNNETLQSLPIVSSKLKSESYVYWKDNMCTPNIDCNKENVEIDFPSTNELLWKVDIPDYPLFPDIGTDPRLLRQWYTNEINQKIVINNTTHELLLNRIQPCIFL+ETLHAVRFQCKNIQLFINGKLFDISISGAS+IQISNQTFYVCLGGPWHEIVILGLPFHVPLDGQRHRIRFNNDNVFLQWLISSPIQID+MPAIPSHIGEWGWRGMFGSPKYLNQRPLNPMKPPETFTRSRNSKINLKSNKFDNVKSCRTPLEMKRINSPQTNTKDSNNNSCEYSDNIK NISLKLRQKLNQEAICQLYSSRLC ICSQTLNY+DDMNFNLHMLQHSSCERHYQLLNDWIISDFVTDSTLNVHNCNTVVDYSDQIPKDRQLLKTISFDELINVEVTHAL+SKSGNKIILNSEEIVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDL+RGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCENDNNLLIGGCIINGGSFHSSEIILKAIQLFEVNVLLLISDSSTINLSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKLFKHELKADEVKIYYTKSLNDSNDSNFINIPFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVM EREFWPELYSILVLNGIVLEKK
Sbjct:    1 MKYYLETINEFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDIQEKSKYYFIRKSWENHFPDDILNDVDNALDKIDPLWRNDSLAFNTDIVNKSINKNNETLQSLPIVSSKLKSESYVYWKDNMCTPNIDCNKENVEIDFPSTNELLWKVDIPDYPLFPDIGTDPRLLRQWYTNEINQKIVINNTTHELLLNRIQPCIFLHETLHAVRFQCKNIQLFINGKLFDISISGASMIQISNQTFYVCLGGPWHEIVILGLPFHVPLDGQRHRIRFNNDNVFLQWLISSPIQIDVMPAIPSHIGEWGWRGMFGSPKYLNQRPLNPMKPPETFTRSRNSKINLKSNKFDNVKSCRTPLEMKRINSPQTNTKDSNNNSCEYSDNIKANISLKLRQKLNQEAICQLYSSRLCPICSQTLNYSDDMNFNLHMLQHSSCERHYQLLNDWIISDFVTDSTLNVHNCNTVVDYSDQIPKDRQLLKTISFDELINVEVTHALNSKSGNKIILNSEEIVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLQRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCENDNNLLIGGCIINGGSFHSSEIILKAIQLFEVNVLLLISDSSTINLSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQHKLFKHELKADEVKIYYTKSLNDSNDSNFINIPFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMAEREFWPELYSILVLNGIVLEKK 951          
BLAST of Protein CLP1 homolog vs. Planmine SMEST
Match: SMESG000047440.1 (SMESG000047440.1)

HSP 1 Score: 182.185 bits (461), Expect = 1.834e-49
Identity = 139/409 (33.99%), Postives = 215/409 (52.57%), Query Frame = 2
Query: 1742 KIILNSEEIVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSFHSS-----------EIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQ--HKLFKHELK--ADEV------KIYY------TKSLNDSNDS------NFINIPFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            ++ L +++++RF C +   I+L +G+AE++GT L     + L++     IL+F GC++    N           D   PN+ LN H  LE  R  A  ND+RGPR++I G   E+   +TL R L+NY+ R  R V L++ +   ND  LP SI   ++   +++  GWD   DPL+++FG  SPV N +L+  QL+ LA  VNIR END  +  GGCIIN      S           E I  AI  FEVN+L++I D    N L   +P+YV +I IPK     +  P++ +  RT  I +YF+ +  HKL  H+L   A+ V      KIY       T +L  ++D+        + +PF   + N V A+S+AL  DEI  +    ++++  V+   S++TV++
Sbjct:    9 EVKLKAQQMMRFECTSVTIIKLVEGSAELFGTELSTKGALNLQQGFLGTILTFNGCTLKYTSNTIIQFTVGFNEDQELPNVYLNFHAALEKIRNNA-NNDIRGPRLMICGN--ESVGKTTLCRILSNYAARKYRKVILIDANVGMNDICLPGSIGALIVTKPYEVVEGWDIFEDPLIYSFGHLSPVENLKLFSLQLNNLAELVNIRSENDPEVFAGGCIINMSGVSKSDDSGESQKKGIEAIRAAISAFEVNLLIIIEDGFLENLLRKDLPDYVSVIRIPKSSGAHSRTPEQWQKERTSNIASYFHGRGLHKLQPHKLTLLAENVVAFFQYKIYKIDLKKSTLALLPNDDTMEDEWCKLVEVPFSRSLSNRVLAVSEALDVDEIPGAACYGFVVVLSVAPDNSSITVLS 414          
BLAST of Protein CLP1 homolog vs. Planmine SMEST
Match: SMESG000028257.1 (SMESG000028257.1)

HSP 1 Score: 182.185 bits (461), Expect = 1.834e-49
Identity = 139/409 (33.99%), Postives = 215/409 (52.57%), Query Frame = 2
Query: 1742 KIILNSEEIVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSFHSS-----------EIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQ--HKLFKHELK--ADEV------KIYY------TKSLNDSNDS------NFINIPFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            ++ L +++++RF C +   I+L +G+AE++GT L     + L++     IL+F GC++    N           D   PN+ LN H  LE  R  A  ND+RGPR++I G   E+   +TL R L+NY+ R  R V L++ +   ND  LP SI   ++   +++  GWD   DPL+++FG  SPV N +L+  QL+ LA  VNIR END  +  GGCIIN      S           E I  AI  FEVN+L++I D    N L   +P+YV +I IPK     +  P++ +  RT  I +YF+ +  HKL  H+L   A+ V      KIY       T +L  ++D+        + +PF   + N V A+S+AL  DEI  +    ++++  V+   S++TV++
Sbjct:    9 EVKLKAQQMMRFECTSVTIIKLVEGSAELFGTELSTKGALNLQQGFLGTILTFNGCTLKYTSNTIIQFTVGFNEDQELPNVYLNFHAALEKIRNNA-NNDIRGPRLMICGN--ESVGKTTLCRILSNYAARKYRKVILIDANVGMNDICLPGSIGALIVTKPYEVVEGWDIFEDPLIYSFGHLSPVENLKLFSLQLNNLAELVNIRSENDPEVFAGGCIINMSGVSKSDDSGESQKKGIEAIRAAISAFEVNLLIIIEDGFLENLLRKDLPDYVSVIRIPKSSGAHSRTPEQWQKERTSNIASYFHGRGLHKLQPHKLTLLAENVVAFFQYKIYKIDLKKSTLALLPNDDTMEDEWCKLVEVPFSRSLSNRVLAVSEALDVDEIPGAACYGFVVVLSVAPDNSSITVLS 414          
BLAST of Protein CLP1 homolog vs. Planmine SMEST
Match: SMESG000047440.1 (SMESG000047440.1)

HSP 1 Score: 182.956 bits (463), Expect = 7.455e-49
Identity = 139/409 (33.99%), Postives = 215/409 (52.57%), Query Frame = 2
Query: 1742 KIILNSEEIVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNNHYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEALKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYNDTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQLDALANYVNIRCEXXXXXXXXXXXXXXXSFHSS-----------EIILKAIQLFEVNVLLLISDSSTIN-LSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQ--HKLFKHELK--ADEV------KIYY------TKSLNDSNDS------NFINIPFQEIILNSVCALSQALSFDEISTSPILCYLLITDVSECYSTLTVMT 2866
            ++ L +++++RF C +   I+L +G+AE++GT L     + L++     IL+F GC++    N           D   PN+ LN H  LE  R  A  ND+RGPR++I G   E+   +TL R L+NY+ R  R V L++ +   ND  LP SI   ++   +++  GWD   DPL+++FG  SPV N +L+  QL+ LA  VNIR END  +  GGCIIN      S           E I  AI  FEVN+L++I D    N L   +P+YV +I IPK     +  P++ +  RT  I +YF+ +  HKL  H+L   A+ V      KIY       T +L  ++D+        + +PF   + N V A+S+AL  DEI  +    ++++  V+   S++TV++
Sbjct:    9 EVKLKAQQMMRFECTSVTIIKLVEGSAELFGTELSTKGALNLQQGFLGTILTFNGCTLKYTSNTIIQFTVGFNEDQELPNVYLNFHAALEKIRNNA-NNDIRGPRLMICGN--ESVGKTTLCRILSNYAARKYRKVILIDANVGMNDICLPGSIGALIVTKPYEVVEGWDIFEDPLIYSFGHLSPVENLKLFSLQLNNLAELVNIRSENDPEVFAGGCIINMSGVSKSDDSGESQKKGIEAIRAAISAFEVNLLIIIEDGFLENLLRKDLPDYVSVIRIPKSSGAHSRTPEQWQKERTSNIASYFHGRGLHKLQPHKLTLLAENVVAFFQYKIYKIDLKKSTLALLPNDDTMEDEWCKLVEVPFSRSLSNRVLAVSEALDVDEIPGAACYGFVVVLSVAPDNSSITVLS 414          
BLAST of Protein CLP1 homolog vs. Planmine SMEST
Match: SMESG000059830.1 (SMESG000059830.1)

HSP 1 Score: 162.54 bits (410), Expect = 7.810e-42
Identity = 85/190 (44.74%), Postives = 123/190 (64.74%), Query Frame = 2
Query:  653 KENVEIDFPSTNELLWKVDIPDYPLFPDIGTDPRLLRQWYTNEINQKIVINNTTHELLLNRIQPCIFLNETLHAVRFQCKNIQLFINGKLFDXXXXXXXXXXXXNQTFYVCLGGPWHEIVILGLPFHVPLDGQRHRIRFNNDNVFLQWLISSPIQIDLMPAIPSHIGEWGWRGMFGSPKYLNQRPLNPMK 1222
            K +++   P   E  WKV I   P  P IGTDPRLL +    + ++ I I+   H L L+RIQPCIF+N  LHAVRF C NI++ I+   F+IS +G + I+I+ + +  CLGGP HE++I G P++V +DG  H+I  +   V +Q+L+   IQ+++M AIP +I EW  +G FGSP+YLN  PLNP++
Sbjct:  295 KVSIQASLPQPREPTWKVKIDGLPQMPPIGTDPRLLARCPFYDPSRTITIDGIKHTLHLDRIQPCIFVNNELHAVRFYCPNIEVNIDNMPFEISPNGLAHIKINRRFYIACLGGPGHELIINGWPYNVRIDGNMHQISVSGYPVSVQFLVQRSIQVNVMNAIPPYICEWAVKGYFGSPQYLNIPPLNPLR 484          

HSP 2 Score: 62.3882 bits (150), Expect = 1.144e-9
Identity = 39/129 (30.23%), Postives = 72/129 (55.81%), Query Frame = 2
Query:  107 EFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLITTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVIDIREKSKYYFIRKSWENHFPXXXXXXXXXXXXXXXPLW 493
            +F   L  L +N+  +I  LS+ A   ++N  ++     L  ++I +   +LK+   YV+D IIKNVG  Y ++F+  + + FI +  S  D + + K Y +R +W+++F  +++N +D  + K DP W
Sbjct:    9 DFSRTLKTLTTNDKYIINTLSVMAMNARDNPSLSKEIAKLAMSQIFKVVPQLKLTNFYVVDSIIKNVGSPYKEMFADKVLDAFIHTFQSNKDHKIRIKLYNLRLTWKDYFSSELMNRLDEEVKKYDPAW 137          
The following BLAST results are available for this feature:
BLAST of Protein CLP1 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLP11.126e-2826.73cleavage and polyadenylation factor I subunit 1 [S... [more]
CLP11.126e-2826.73cleavage and polyadenylation factor I subunit 1 [S... [more]
CLP11.172e-2827.41cleavage and polyadenylation factor I subunit 1 [S... [more]
CLP19.643e-1032.37cleavage and polyadenylation factor I subunit 1 [S... [more]
CLP12.158e-832.50cleavage and polyadenylation factor I subunit 1 [S... [more]
back to top
BLAST of Protein CLP1 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
clpf-13.414e-3028.15pep chromosome:WBcel235:III:3397743:3400644:1 gene... [more]
back to top
BLAST of Protein CLP1 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbc2.128e-1723.50gene:FBgn0033842 transcript:FBtr0087701[more]
Pcf116.568e-728.21gene:FBgn0264962 transcript:FBtr0302560[more]
Pcf116.568e-728.21gene:FBgn0264962 transcript:FBtr0345528[more]
Pcf116.784e-728.21gene:FBgn0264962 transcript:FBtr0339986[more]
Pcf116.915e-728.21gene:FBgn0264962 transcript:FBtr0339985[more]
back to top
BLAST of Protein CLP1 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
clp12.781e-2626.93cleavage and polyadenylation factor I subunit 1 [S... [more]
pcf111.232e-832.47PCF11 cleavage and polyadenylation factor subunit ... [more]
pcf111.306e-832.47PCF11 cleavage and polyadenylation factor subunit ... [more]
back to top
BLAST of Protein CLP1 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
clp16.020e-3027.68cleavage and polyadenylation factor I subunit 1 [S... [more]
pcf111.160e-725.96PCF11, cleavage and polyadenylation factor subunit... [more]
pcf114.608e-731.78PCF11, cleavage and polyadenylation factor subunit... [more]
back to top
BLAST of Protein CLP1 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Clp13.358e-2926.73CLP1, cleavage and polyadenylation factor I subuni... [more]
Clp13.358e-2926.73CLP1, cleavage and polyadenylation factor I subuni... [more]
Pcf111.027e-828.65PCF11 cleavage and polyadenylation factor subunit ... [more]
back to top
BLAST of Protein CLP1 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NS21|CLP1_XENLA2.217e-3027.42Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Xeno... [more]
sp|Q66JK4|CLP1_XENTR3.189e-2927.68Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Xeno... [more]
sp|P52874|CLP1_CAEEL4.343e-2928.15Protein clpf-1 OS=Caenorhabditis elegans OX=6239 G... [more]
sp|Q5PQL4|CLP1_RAT2.349e-2826.73Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Ratt... [more]
sp|Q99LI9|CLP1_MOUSE2.349e-2826.73Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Mus ... [more]
back to top
BLAST of Protein CLP1 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UH121.049e-4130.71Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3NU728.956e-4031.58Protein CLP1 homolog OS=Schistocephalus solidus OX... [more]
A0A087VYM01.602e-3931.22Polyribonucleotide 5' hydroxyl kinase Clp1 OS=Echi... [more]
A0A0R3W8559.757e-3731.41Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A430QGI23.974e-3629.53Polyribonucleotide 5'-hydroxyl-kinase OS=Schistoso... [more]
back to top
BLAST of Protein CLP1 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
clp11.085e-2426.22cleavage and polyadenylation factor I subunit 1 [S... [more]
clp11.316e-2425.50cleavage and polyadenylation factor I subunit 1 [S... [more]
pcf111.867e-832.26PCF11 cleavage and polyadenylation factor subunit ... [more]
back to top
BLAST of Protein CLP1 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
clp11.681e-2325.80cleavage and polyadenylation factor I subunit 1 [S... [more]
back to top
BLAST of Protein CLP1 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein CLP1 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO493772.502e-2727.78Protein CLP1 homolog [Source:UniProtKB/Swiss-Prot... [more]
EDO497206.896e-639.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein CLP1 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CLP15.409e-2629.08cleavage and polyadenylation factor I subunit 1 [S... [more]
CLP11.566e-2429.58cleavage and polyadenylation factor I subunit 1 [S... [more]
pcf111.809e-831.76PCF11 cleavage and polyadenylation factor subunit ... [more]
pcf111.818e-831.76PCF11 cleavage and polyadenylation factor subunit ... [more]
back to top
BLAST of Protein CLP1 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020165.10.000e+098.74SMESG000020165.1[more]
SMESG000047440.11.834e-4933.99SMESG000047440.1[more]
SMESG000028257.11.834e-4933.99SMESG000028257.1[more]
SMESG000047440.17.455e-4933.99SMESG000047440.1[more]
SMESG000059830.17.810e-4244.74SMESG000059830.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012699 ID=SMED30012699|Name=Protein CLP1 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=3052bp
CGTCCGTGTTTTAATATTATGATAATTTATAGAATAAAATCATTTGTATA
ATAAGTGTTTACAAAATGTTATATTAACTATGAAATATTACTTAGAAACT
ATTAATGAATTTGAGACAATTCTAAATTGCTTAGATTCAAATAATAATAA
TTTAATCCGTGCTTTGTCGTTGTTTGCGGAAGAACACAAAGAAAACGATA
TAATCGCACCAGCATTTGTAAACCTTATAACAACAAAAATTATTGAAGCT
CCACAAAAATTAAAGATATATTTTCTATATGTTCTAGATTGTATAATAAA
GAATGTTGGATATTTATACATAAAATTATTTTCTAAATCTTTAAAAGAAG
TTTTTATTTTCTCAGTCTCGTCGGTCATTGACATTCGAGAAAAATCAAAA
TATTATTTCATTCGCAAATCATGGGAAAATCATTTTCCAGATGATATTTT
AAATGACATTGACAATGCTTTGGATAAAATTGACCCACTTTGGCGAAACG
ATTCATTAGCATTTAATACAGCTATTGTAAATAAATCGATTAATAAAAAT
AATGAGACTCTTCAATCTTTGCCTATTGTTAGTTCTAAATTGAAATCTGA
AAGTTATGTGTATTGGAAAGATAATATGTGCACCCCAAATATTGATTGCA
ATAAAGAAAATGTAGAAATAGATTTTCCATCTACGAATGAATTACTATGG
AAAGTTGATATTCCTGATTATCCTCTATTTCCAGACATAGGCACTGATCC
AAGATTATTGCGTCAATGGTATACAAACGAAATCAATCAAAAAATCGTAA
TTAACAATACAACACATGAATTGTTACTTAATCGAATTCAACCATGCATT
TTTCTCAATGAAACACTACATGCAGTCAGATTTCAGTGCAAGAACATACA
ACTGTTTATCAACGGGAAATTATTTGACATCTCAATTTCTGGTGCGTCAA
TAATTCAAATATCAAATCAAACATTTTATGTTTGCCTCGGTGGACCATGG
CACGAAATAGTCATTTTAGGATTGCCGTTTCACGTTCCACTCGATGGACA
GAGGCATAGGATTCGATTTAATAATGATAACGTGTTTTTGCAATGGTTAA
TAAGCAGCCCGATTCAAATTGATTTAATGCCGGCAATTCCGTCGCACATT
GGTGAATGGGGATGGCGAGGAATGTTCGGTTCACCGAAATATCTAAATCA
GCGGCCACTTAATCCGATGAAGCCCCCCGAAACATTTACGCGGTCAAGAA
ATTCGAAAATAAATCTAAAGTCGAATAAATTTGACAATGTGAAGTCCTGT
AGGACACCATTGGAAATGAAAAGGATAAATTCTCCCCAAACCAACACGAA
AGACAGCAATAATAATAGCTGTGAATACTCTGATAACATAAAAGACAATA
TCTCATTAAAACTTCGACAAAAATTAAATCAAGAAGCCATTTGCCAACTT
TATTCATCTAGATTATGTCTAATTTGCAGTCAAACATTAAACTATGCTGA
CGATATGAATTTCAACTTGCACATGTTGCAGCATAGCTCCTGTGAAAGGC
ACTATCAATTACTCAATGACTGGATTATATCTGATTTCGTCACAGATAGC
ACTCTGAATGTACACAATTGCAACACGGTTGTTGATTATTCCGATCAGAT
TCCAAAAGATCGGCAACTTTTGAAAACGATTTCCTTTGATGAATTGATTA
ATGTAGAAGTTACACATGCATTAGATTCGAAAAGTGGAAATAAAATAATT
CTTAATAGCGAGGAAATAGTCCGATTTTTTTGTCTAAATAATGTAAGAAT
TCGACTTTATAAAGGAACTGCAGAAATCTATGGAACTGCGTTACCTTTTA
ATCATGAAATAGAACTAAGAAAAAATAACCACTATGAAATTCTTTCGTTT
ACTGGCTGCAGCATTATGGTAATAGGAAATATTAATGAAGTTAAAGTAAA
ATCCATTTGCTTTGATCTTTATAAACCGAATATTATACTAAATATTCATT
ACGATTTGGAATTAAAACGAATTGAAGCTTTGAAGAATGATGTAAGAGGA
CCAAGAATACTTATATATGGTCCAGGAGTTGAAGCTTTTTCGATGTCGAC
TTTAACAAGGACGTTGGCTAATTATTCTGTCAGGTGTGGTCGAACAGTAG
CCCTTGTTAATCTTGATTCAATTTACAATGACACTGGCCTACCAAATTCA
ATTTCTGTAAATGTTATTCAAGTAGAATTCGACTTACGGCGTGGTTGGGA
TTTCTGCAATGATCCCTTAGTGTTCAATTTTGGTCAGTGCTCACCTGTTG
CTAATCAGCGTTTGTATTTTGAACAGCTCGATGCATTAGCAAATTATGTA
AACATTCGATGCGAAAACGATAACAATTTGCTTATTGGTGGTTGCATTAT
TAACGGAGGAAGTTTTCATAGTTCTGAAATTATTCTCAAAGCAATTCAAT
TATTTGAAGTTAACGTTTTGCTATTAATATCTGACTCGAGTACAATTAAT
TTAAGTTCTCAAGTTCCTGAATATGTACAAATAATAAATATCCCCAAAGA
TCTTTTTGATACAAATTTCTGTCCGAAAAAGATCGAGTCAATAAGAACAG
AACGAATTCACGCGTATTTTTATGAACAACATAAACTATTTAAACATGAA
TTGAAAGCTGATGAAGTAAAAATCTATTACACAAAATCCCTTAATGACTC
AAATGATTCCAATTTTATCAATATTCCATTTCAAGAAATTATTCTCAATT
CTGTTTGTGCTCTTTCTCAAGCCTTATCATTTGATGAAATCTCTACATCG
CCAATTTTATGTTATCTTTTGATTACTGATGTATCAGAATGCTACTCGAC
TTTGACCGTAATGACTGAAAGAGAATTTTGGCCTGAGTTGTACTCGATAC
TCGTATTGAACGGAATAGTTTTAGAGAAAAAATAATTTTTATTTGTAAAC
AGTTTGATAAATTTCATGTTATTTGTATGAATTTTTATGGGGGTTTTTTT
ATTATAGATATGTTGTTATTTTTTAAATAATAAATCTTTGTTTGAAAAAA
AA
back to top

protein sequence of SMED30012699-orf-1

>SMED30012699-orf-1 ID=SMED30012699-orf-1|Name=SMED30012699-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=952bp
MKYYLETINEFETILNCLDSNNNNLIRALSLFAEEHKENDIIAPAFVNLI
TTKIIEAPQKLKIYFLYVLDCIIKNVGYLYIKLFSKSLKEVFIFSVSSVI
DIREKSKYYFIRKSWENHFPDDILNDIDNALDKIDPLWRNDSLAFNTAIV
NKSINKNNETLQSLPIVSSKLKSESYVYWKDNMCTPNIDCNKENVEIDFP
STNELLWKVDIPDYPLFPDIGTDPRLLRQWYTNEINQKIVINNTTHELLL
NRIQPCIFLNETLHAVRFQCKNIQLFINGKLFDISISGASIIQISNQTFY
VCLGGPWHEIVILGLPFHVPLDGQRHRIRFNNDNVFLQWLISSPIQIDLM
PAIPSHIGEWGWRGMFGSPKYLNQRPLNPMKPPETFTRSRNSKINLKSNK
FDNVKSCRTPLEMKRINSPQTNTKDSNNNSCEYSDNIKDNISLKLRQKLN
QEAICQLYSSRLCLICSQTLNYADDMNFNLHMLQHSSCERHYQLLNDWII
SDFVTDSTLNVHNCNTVVDYSDQIPKDRQLLKTISFDELINVEVTHALDS
KSGNKIILNSEEIVRFFCLNNVRIRLYKGTAEIYGTALPFNHEIELRKNN
HYEILSFTGCSIMVIGNINEVKVKSICFDLYKPNIILNIHYDLELKRIEA
LKNDVRGPRILIYGPGVEAFSMSTLTRTLANYSVRCGRTVALVNLDSIYN
DTGLPNSISVNVIQVEFDLRRGWDFCNDPLVFNFGQCSPVANQRLYFEQL
DALANYVNIRCENDNNLLIGGCIINGGSFHSSEIILKAIQLFEVNVLLLI
SDSSTINLSSQVPEYVQIINIPKDLFDTNFCPKKIESIRTERIHAYFYEQ
HKLFKHELKADEVKIYYTKSLNDSNDSNFINIPFQEIILNSVCALSQALS
FDEISTSPILCYLLITDVSECYSTLTVMTEREFWPELYSILVLNGIVLEK
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR038239Clp1_N_sf
IPR006569CID_dom
IPR008942ENTH_VHS
IPR032319CLP1_P
IPR032324Clp1_N
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005849mRNA cleavage factor complex
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0016310phosphorylation
GO:0031124mRNA 3'-end processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006569CID domainSMARTSM00582558neu5coord: 10..132
e-value: 3.4E-5
score: 29.7
IPR006569CID domainPROSITEPS51391CIDcoord: 1..135
score: 20.833
IPR032324Clp1, N-terminal beta-sandwich domainPFAMPF16573CLP1_Ncoord: 571..650
e-value: 3.4E-9
score: 36.8
IPR032319Polyribonucleotide 5'-hydroxyl-kinase Clp1, P-loop domainPFAMPF16575CLP1_Pcoord: 673..849
e-value: 4.5E-24
score: 85.3
IPR008942ENTH/VHSGENE3DG3DSA:1.25.40.90coord: 4..136
e-value: 1.8E-20
score: 75.2
IPR008942ENTH/VHSSUPERFAMILYSSF48464ENTH/VHS domaincoord: 7..139
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 634..854
e-value: 6.4E-37
score: 129.1
NoneNo IPR availablePANTHERPTHR12755:SF6POLYRIBONUCLEOTIDE 5'-HYDROXYL-KINASE CLP1coord: 555..929
NoneNo IPR availablePANTHERPTHR12755CLEAVAGE/POLYADENYLATION FACTOR IA SUBUNIT CLP1Pcoord: 555..929
NoneNo IPR availableCDDcd16982CID_Pcf11coord: 8..138
e-value: 4.55696E-25
score: 99.1771
IPR038239Clp1, N-terminal beta-sandwich domain superfamilyGENE3DG3DSA:2.60.120.1030coord: 546..624
e-value: 1.5E-7
score: 33.0