MULE domain-containing protein

Overview
NameMULE domain-containing protein
Smed IDSMED30012691
Length (bp)657
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MULE domain-containing protein (SMED30012691) t-SNE clustered cells

Violin plots show distribution of expression levels for MULE domain-containing protein (SMED30012691) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MULE domain-containing protein (SMED30012691) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MULE domain-containing protein (SMED30012691) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012691

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 27

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30012691h1SMcG0017400 SmedASXL_016681SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30012691h1SMcG0017400 SmedASXL_016683SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30012691h1SMcG0017400 SmedASXL_016682SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30012691h1SMcG0017400 SmedASXL_018400SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30012691h1SMcG0017400 SmedASXL_018401SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30012691h1SMcG0017400 SmedASXL_016684SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig18437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig18437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig18438uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig18438newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig29257uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig29257newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig33231newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig33231uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig42751newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig42751uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig45946uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012691h1SMcG0017400 Contig45946newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30012691h1SMcG0017400 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012691h1SMcG0017400 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012691h1SMcG0017400 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012691h1SMcG0017400 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012691h1SMcG0017400 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012691h1SMcG0017400 dd_Smed_v4_652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30012691h1SMcG0017400 dd_Smed_v6_652_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012691h1SMcG0017400 dd_Smed_v6_652_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30012691h1SMcG0017400 dd_Smed_v6_652_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A443RWF0 (Uncharacterized protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_04466 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 4.444e-12
Identity = 30/63 (47.62%), Postives = 41/63 (65.08%), Query Frame = 3
Query:  204 IQRTNPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDYHNRPILI 392
            I   +PTI   ID  K   ++ ++KIEQ  A    +P++ IYK+TAERI+NIV DY NR IL+
Sbjct:  130 ISAHHPTIWTCIDGFKKDYSIGEIKIEQFAAGIPGSPTKKIYKDTAERIRNIVADYDNRDILV 192          

HSP 2 Score: 40.0466 bits (92), Expect = 4.444e-12
Identity = 17/36 (47.22%), Postives = 22/36 (61.11%), Query Frame = 1
Query:  112 PLFVHELWNWFDAAEHDLFRTNNSVEGWQQGFSELI 219
            P+F   +WN +  A   L RTNNS+EGW + F  LI
Sbjct:   95 PIFPISVWNCYYVALEGLPRTNNSIEGWPRAFQSLI 130          
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A443RV60 (Uncharacterized protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_01510 PE=4 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.343e-11
Identity = 27/63 (42.86%), Postives = 40/63 (63.49%), Query Frame = 3
Query:  204 IQRTNPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDYHNRPILI 392
            I   +P+I   I+  K    +N+MK+EQ I     +P++ +YK+TAERI+NIV DY NR  L+
Sbjct:   77 ISADHPSIWTCIEGFKKDYAINEMKLEQFIGGTSRSPTKKVYKDTAERIRNIVSDYDNRDTLV 139          

HSP 2 Score: 40.0466 bits (92), Expect = 1.343e-11
Identity = 18/36 (50.00%), Postives = 22/36 (61.11%), Query Frame = 1
Query:  112 PLFVHELWNWFDAAEHDLFRTNNSVEGWQQGFSELI 219
            P F   +WN + AA   L RTNNS+EGW + F  LI
Sbjct:   42 PRFPISVWNCYYAALEGLPRTNNSIEGWHRAFQSLI 77          
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A1D2M0R0 (MULE domain-containing protein (Fragment) OS=Orchesella cincta OX=48709 GN=Ocin01_20181 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 4.482e-11
Identity = 24/63 (38.10%), Postives = 43/63 (68.25%), Query Frame = 3
Query:  198 TRIQRTNPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDYHNRPI 386
            +++   +PTI KFI+ +K  Q++N++++EQ +A + P P R  Y++   R+K +V D+ NRPI
Sbjct:  245 SQLGAAHPTIWKFIEAIKKQQSLNELQMEQQLAGESPQPQRGRYQDLTIRLKAVVEDFENRPI 307          

HSP 2 Score: 36.1946 bits (82), Expect = 4.482e-11
Identity = 17/32 (53.12%), Postives = 18/32 (56.25%), Query Frame = 1
Query:  112 PLFVHELWNWFDAAEHDLFRTNNSVEGWQQGF 207
            P F  E WN       DL RTNN VEGW +GF
Sbjct:  212 PRFAIEEWNCHSRVIEDLSRTNNIVEGWHRGF 243          

HSP 3 Score: 20.4014 bits (41), Expect = 4.482e-11
Identity = 9/14 (64.29%), Postives = 10/14 (71.43%), Query Frame = 2
Query:  389 DYLHRIRHNLSLQV 430
            DYL  I HNL+L V
Sbjct:  309 DYLTGIAHNLNLSV 322          
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A5N4B0M6 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_00073 PE=4 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.685e-10
Identity = 21/52 (40.38%), Postives = 39/52 (75.00%), Query Frame = 3
Query:  216 NPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDY 371
            +P I KF++ LK  Q++N+++IEQ+ + Q+P  SR  Y++ AERI+ +++D+
Sbjct:  397 HPNIWKFVNALKKEQSLNELRIEQYHSGQQPPASRKKYRDCAERIRRLILDF 448          

HSP 2 Score: 40.817 bits (94), Expect = 1.685e-10
Identity = 14/34 (41.18%), Postives = 25/34 (73.53%), Query Frame = 1
Query:  118 FVHELWNWFDAAEHDLFRTNNSVEGWQQGFSELI 219
            F H +WN +++   +L +TNN++EGW +GF E++
Sbjct:  360 FAHVMWNCYNSVLENLPKTNNALEGWHRGFQEML 393          
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A5N4B5D8 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_01792 PE=4 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.307e-10
Identity = 23/52 (44.23%), Postives = 36/52 (69.23%), Query Frame = 3
Query:  216 NPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDY 371
            +P I KFI  LK  Q++N+++IEQHI+ Q P  SR +Y++ A+R+  +V  Y
Sbjct:  397 HPNIWKFISALKREQSINELRIEQHISGQPPTISRKVYRDCAQRLLTLVNSY 448          

HSP 2 Score: 40.817 bits (94), Expect = 4.307e-10
Identity = 16/30 (53.33%), Postives = 21/30 (70.00%), Query Frame = 1
Query:  118 FVHELWNWFDAAEHDLFRTNNSVEGWQQGF 207
            F   +WN FDA +H L +TNN+VEGW + F
Sbjct:  360 FAINMWNCFDAVQHGLPKTNNAVEGWHRAF 389          
BLAST of MULE domain-containing protein vs. Planmine SMEST
Match: SMESG000032187.1 (SMESG000032187.1)

HSP 1 Score: 36.965 bits (84), Expect = 1.312e-7
Identity = 16/55 (29.09%), Postives = 33/55 (60.00%), Query Frame = 3
Query:  213 TNPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDYHN 377
             +PT+ + +  L+  QN+NQM +E+  A + P   +  Y++   +++ +V+DY N
Sbjct:   87 AHPTLSRLVVKLQKEQNINQMNVERMSAGEVPPLRKKKYRDLDCQLRTVVLDYEN 141          

HSP 2 Score: 36.1946 bits (82), Expect = 1.312e-7
Identity = 13/35 (37.14%), Postives = 24/35 (68.57%), Query Frame = 1
Query:  115 LFVHELWNWFDAAEHDLFRTNNSVEGWQQGFSELI 219
            LF  ++W+++ A  +D+ RTNN+VEG    F+ ++
Sbjct:   50 LFSSDIWDYYQAVCYDIPRTNNAVEGSHSVFARIV 84          
The following BLAST results are available for this feature:
BLAST of MULE domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443RWF04.444e-1247.62Uncharacterized protein (Fragment) OS=Leptotrombid... [more]
A0A443RV601.343e-1142.86Uncharacterized protein (Fragment) OS=Leptotrombid... [more]
A0A1D2M0R04.482e-1138.10MULE domain-containing protein (Fragment) OS=Orche... [more]
A0A5N4B0M61.685e-1040.38Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A5N4B5D84.307e-1044.23Uncharacterized protein OS=Photinus pyralis OX=705... [more]
back to top
BLAST of MULE domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MULE domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000032187.11.312e-729.09SMESG000032187.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012691 ID=SMED30012691|Name=MULE domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=657bp
AGCGATTCATTACACAAATTGAAAACAGATGCTCGGAAATGTTTAATATT
AAAATTCAAGTTATGCCCAATTAAATGCAGATAATCCAATATATGTCGAA
TAATGGTAGTTCCATTATTCGTTCATGAACTATGGAACTGGTTCGATGCT
GCTGAACACGATCTATTTAGAACCAATAACTCAGTTGAAGGATGGCAACA
AGGATTCAGCGAACTAATCCGACCATCTGTAAATTCATCGATACACTAAA
GACGGTACAGAATATGAACCAGATGAAAATCGAACAGCACATCGCAAACC
AACGACCAAATCCATCTCGAATAATCTACAAGGAAACTGCAGAAAGAATC
AAAAATATTGTCATCGATTACCATAATCGACCAATATTGATTATCTGCAT
AGAATTAGGCATAACTTGAGTCTTCAAGTTTAATATTAAACATTTCCTAG
CCTCTGTTTTCAATTTATATAATAAATCACTGTTTATATAACTCTCGCTA
TTTTGTGGTCGCGGTTTTGATTATCGCTATTATTAACGTACACAATAATT
TTTATTTTTGTTCTCANAAAAANTAGAATCCATCCATAATAAACCCGTAA
TGACTCTACCATATTCCGCTTGACCATCATCGACAATGCTCATACACATC
CAAATAG
back to top