MULE domain-containing protein
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30012691 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 27Note: Hover over icons to view figure legend
Homology
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A443RWF0 (Uncharacterized protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_04466 PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 4.444e-12 Identity = 30/63 (47.62%), Postives = 41/63 (65.08%), Query Frame = 3 Query: 204 IQRTNPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDYHNRPILI 392 I +PTI ID K ++ ++KIEQ A +P++ IYK+TAERI+NIV DY NR IL+ Sbjct: 130 ISAHHPTIWTCIDGFKKDYSIGEIKIEQFAAGIPGSPTKKIYKDTAERIRNIVADYDNRDILV 192 HSP 2 Score: 40.0466 bits (92), Expect = 4.444e-12 Identity = 17/36 (47.22%), Postives = 22/36 (61.11%), Query Frame = 1 Query: 112 PLFVHELWNWFDAAEHDLFRTNNSVEGWQQGFSELI 219 P+F +WN + A L RTNNS+EGW + F LI Sbjct: 95 PIFPISVWNCYYVALEGLPRTNNSIEGWPRAFQSLI 130
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A443RV60 (Uncharacterized protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_01510 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 1.343e-11 Identity = 27/63 (42.86%), Postives = 40/63 (63.49%), Query Frame = 3 Query: 204 IQRTNPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDYHNRPILI 392 I +P+I I+ K +N+MK+EQ I +P++ +YK+TAERI+NIV DY NR L+ Sbjct: 77 ISADHPSIWTCIEGFKKDYAINEMKLEQFIGGTSRSPTKKVYKDTAERIRNIVSDYDNRDTLV 139 HSP 2 Score: 40.0466 bits (92), Expect = 1.343e-11 Identity = 18/36 (50.00%), Postives = 22/36 (61.11%), Query Frame = 1 Query: 112 PLFVHELWNWFDAAEHDLFRTNNSVEGWQQGFSELI 219 P F +WN + AA L RTNNS+EGW + F LI Sbjct: 42 PRFPISVWNCYYAALEGLPRTNNSIEGWHRAFQSLI 77
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A1D2M0R0 (MULE domain-containing protein (Fragment) OS=Orchesella cincta OX=48709 GN=Ocin01_20181 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 4.482e-11 Identity = 24/63 (38.10%), Postives = 43/63 (68.25%), Query Frame = 3 Query: 198 TRIQRTNPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDYHNRPI 386 +++ +PTI KFI+ +K Q++N++++EQ +A + P P R Y++ R+K +V D+ NRPI Sbjct: 245 SQLGAAHPTIWKFIEAIKKQQSLNELQMEQQLAGESPQPQRGRYQDLTIRLKAVVEDFENRPI 307 HSP 2 Score: 36.1946 bits (82), Expect = 4.482e-11 Identity = 17/32 (53.12%), Postives = 18/32 (56.25%), Query Frame = 1 Query: 112 PLFVHELWNWFDAAEHDLFRTNNSVEGWQQGF 207 P F E WN DL RTNN VEGW +GF Sbjct: 212 PRFAIEEWNCHSRVIEDLSRTNNIVEGWHRGF 243 HSP 3 Score: 20.4014 bits (41), Expect = 4.482e-11 Identity = 9/14 (64.29%), Postives = 10/14 (71.43%), Query Frame = 2 Query: 389 DYLHRIRHNLSLQV 430 DYL I HNL+L V Sbjct: 309 DYLTGIAHNLNLSV 322
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A5N4B0M6 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_00073 PE=4 SV=1) HSP 1 Score: 53.1434 bits (126), Expect = 1.685e-10 Identity = 21/52 (40.38%), Postives = 39/52 (75.00%), Query Frame = 3 Query: 216 NPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDY 371 +P I KF++ LK Q++N+++IEQ+ + Q+P SR Y++ AERI+ +++D+ Sbjct: 397 HPNIWKFVNALKKEQSLNELRIEQYHSGQQPPASRKKYRDCAERIRRLILDF 448 HSP 2 Score: 40.817 bits (94), Expect = 1.685e-10 Identity = 14/34 (41.18%), Postives = 25/34 (73.53%), Query Frame = 1 Query: 118 FVHELWNWFDAAEHDLFRTNNSVEGWQQGFSELI 219 F H +WN +++ +L +TNN++EGW +GF E++ Sbjct: 360 FAHVMWNCYNSVLENLPKTNNALEGWHRGFQEML 393
BLAST of MULE domain-containing protein vs. TrEMBL
Match: A0A5N4B5D8 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_01792 PE=4 SV=1) HSP 1 Score: 51.6026 bits (122), Expect = 4.307e-10 Identity = 23/52 (44.23%), Postives = 36/52 (69.23%), Query Frame = 3 Query: 216 NPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDY 371 +P I KFI LK Q++N+++IEQHI+ Q P SR +Y++ A+R+ +V Y Sbjct: 397 HPNIWKFISALKREQSINELRIEQHISGQPPTISRKVYRDCAQRLLTLVNSY 448 HSP 2 Score: 40.817 bits (94), Expect = 4.307e-10 Identity = 16/30 (53.33%), Postives = 21/30 (70.00%), Query Frame = 1 Query: 118 FVHELWNWFDAAEHDLFRTNNSVEGWQQGF 207 F +WN FDA +H L +TNN+VEGW + F Sbjct: 360 FAINMWNCFDAVQHGLPKTNNAVEGWHRAF 389
BLAST of MULE domain-containing protein vs. Planmine SMEST
Match: SMESG000032187.1 (SMESG000032187.1) HSP 1 Score: 36.965 bits (84), Expect = 1.312e-7 Identity = 16/55 (29.09%), Postives = 33/55 (60.00%), Query Frame = 3 Query: 213 TNPTICKFIDTLKTVQNMNQMKIEQHIANQRPNPSRIIYKETAERIKNIVIDYHN 377 +PT+ + + L+ QN+NQM +E+ A + P + Y++ +++ +V+DY N Sbjct: 87 AHPTLSRLVVKLQKEQNINQMNVERMSAGEVPPLRKKKYRDLDCQLRTVVLDYEN 141 HSP 2 Score: 36.1946 bits (82), Expect = 1.312e-7 Identity = 13/35 (37.14%), Postives = 24/35 (68.57%), Query Frame = 1 Query: 115 LFVHELWNWFDAAEHDLFRTNNSVEGWQQGFSELI 219 LF ++W+++ A +D+ RTNN+VEG F+ ++ Sbjct: 50 LFSSDIWDYYQAVCYDIPRTNNAVEGSHSVFARIV 84 The following BLAST results are available for this feature:
BLAST of MULE domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of MULE domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of MULE domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of MULE domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of MULE domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 1
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30012691 ID=SMED30012691|Name=MULE domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=657bpback to top |