Protein tincar

Overview
NameProtein tincar
Smed IDSMED30012686
Length (bp)2241
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein tincar (SMED30012686) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein tincar (SMED30012686) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein tincar (SMED30012686) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein tincar (SMED30012686) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012686

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30012686SMESG000005995.1 dd_Smed_v4_6103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012686SMESG000005995.1 dd_Smed_v4_6103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012686SMESG000005995.1 dd_Smed_v4_6103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012686SMESG000005995.1 dd_Smed_v4_6103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012686SMESG000005995.1 dd_Smed_v4_6103_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30012686SMESG000005995.1 dd_Smed_v4_6103_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein tincar vs. TrEMBL
Match: A0A267GLJ3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030458g2 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 3.785e-17
Identity = 90/401 (22.44%), Postives = 162/401 (40.40%), Query Frame = 3
Query:  198 KIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLG-ETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYXXXXXXXXXXXXXXXXXQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLE-EVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCXXXXXXXXXXXXXXILITWFFVWMTLSVKHNWIFKINL 1394
            +IWY   +LA   ++ Y     Y  F+ ++       +W+ +P+ F L M + +  LLP FLY  L KT N   D V +G + + L++      I E        +    C +  + +  P   LLH ++AF LL+P   L A +  ++    + +W ++L  I++ +   T ++  +            N  +A   L +   S FW + ++F+ + ++   V     ++     S++ +  +S +  +  +   P         L   G +  L+     FEFG  + L+N R +   L+ E         +   + E    L     N+  +  G  L+V+   C  P+   +V  Y    +   L    +    L  W  VW  L  K NW F I L
Sbjct:   46 RIWYAILVLALNAFLLYSAFQRYASFRAKA----LREQWDMSPMNFYLAMMILTVFLLPFFLYAALAKTANYAEDGVQIGRDRDCLRVA-----IAETSSGAGAQATVGTCMSRLRRHFMPYTCLLHVLTAFCLLIPMPVLEAAEIHHAKRPSDEIWRTNLDFIYHPKASATNSVCPE----------VFNLMLALAILLVRYPSTFWFSNRAFAFMFSVILCVCGLHIVLSYEATSVLFKASMSNDVVTQVNLLPPAII-----ALHSIGDLLLLVANIAFFEFGYAQMLSNLRKYRNYLQLEASSSVSDRSISSCNDETPCWL-----NYAPHLAGILLMVVAVLCKAPVLWDWVGLYRVHQQPAMLAAVVSGGIYLSLWVSVWFLLGFKANWKFNIRL 417          
BLAST of Protein tincar vs. TrEMBL
Match: A0A267E669 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030458g3 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 5.322e-17
Identity = 90/401 (22.44%), Postives = 161/401 (40.15%), Query Frame = 3
Query:  198 KIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLG-ETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYXXXXXXXXXXXXXXXXXQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLE-EVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCXXXXXXXXXXXXXXILITWFFVWMTLSVKHNWIFKINL 1394
            +IWY   +LA   ++ Y     Y  F+ ++       +W+ +P+ F L M + +  LLP FLY  L KT N   D V +G + + L++      I E        +    C +  + +  P   LLH ++AF LL+P   L A +  ++    + +W ++L  I++ +   T ++  +            N  +A   L +   S FW + ++F+ + ++   V     ++     S++ +  +S    +  +   P         L   G +  L+     FEFG  + L+N R +   L+ E         +   + E    L     N+  +  G  L+V+   C  P+   +V  Y    +   L    +    L  W  VW  L  K NW F I L
Sbjct:   46 RIWYAILVLALNAFLLYSAFQRYASFRAKA----LREQWDMSPMNFYLAMMILTVFLLPFFLYAALAKTANYAEDGVQIGRDRDCLRVA-----IAETSSGAGAQATVGTCMSRLRRHFMPYTCLLHVLTAFCLLIPMPVLEAAEIHHAKRPSDEIWRTNLDFIYHPKASATNSVCPE----------VFNLMLALAILLVRYPSTFWFSNRAFAFMFSVILCVCGLHIVLSYEATSVLFKASMSNGVVTQVNLLPPAII-----ALHSIGDLLLLVANIAFFEFGYAQMLSNLRKYRNYLQLEASSSVSDRSISSCNDETPCWL-----NYAPHLAGILLMVVAVLCKAPVLWDWVGLYRVHQQPAMLAAVVSGGIYLSLWVSVWFLLGFKANWKFNIRL 417          
BLAST of Protein tincar vs. TrEMBL
Match: A0A267H7U1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030458g1 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 6.606e-17
Identity = 89/401 (22.19%), Postives = 160/401 (39.90%), Query Frame = 3
Query:  198 KIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLG-ETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYXXXXXXXXXXXXXXXXXQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLE-EVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCXXXXXXXXXXXXXXILITWFFVWMTLSVKHNWIFKINL 1394
            +IWY   +LA   ++ Y     Y  F+ ++       +W+ +P+ F L M + +  LLP FLY  L KT N   D V +G + + L++      I E        +    C +  + +  P   LLH ++AF LL+P   L A +  ++    + +W ++L  I++ +   T ++  +            N  +A   L +   S FW + ++F+ + ++   V     ++     S++ +      + S    ++          L   G +  L+     FEFG  + L+N R +   L+ E         +   + E    L     N+  +  G  L+V+   C  P+   +V  Y    +   L    +    L  W  VW  L  K NW F I L
Sbjct:   13 RIWYAILVLALNAFLLYSAFQRYASFRAKA----LREQWDMSPMNFYLAMMIITVFLLPFFLYAALAKTANYAEDGVQIGRDRDCLRVA-----IAETSSGAGAQATVGTCMSRLRRHFMPYTCLLHVLTAFCLLIPMPVLEAAEIHHAKRPSDEIWRTNLDFIYHPKASATNSVCPE----------VFNLMLALAILLVRYPSTFWFSNRAFAFMFSVILCVCGLHIVLSYEATSVLFK-----ASMSNGVVTQVNLLPPAIIALHSIGDLLLLVANIAFFEFGYAQMLSNLRKYRNYLQLEASSSVSDRSISSCNDETPCWL-----NYAPHLAGILLMVVAVLCKAPVLWDWVGLYRVHQQPAMLAAVVSGGIYLSLWVSVWFLLGFKANWKFNIRL 384          
BLAST of Protein tincar vs. TrEMBL
Match: A0A1I8IPE7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 7.595e-15
Identity = 89/401 (22.19%), Postives = 156/401 (38.90%), Query Frame = 3
Query:  198 KIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLG-ETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYXXXXXXXXXXXXXXXXXQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLE-EVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCXXXXXXXXXXXXXXILITWFFVWMTLSVKHNWIFKINL 1394
            +IWY   +LA   ++ Y     Y  F+ ++       +W+ +P+ F L M + +  LLP FLY  L KT N   D V +G + + L++      I E        +    C +  + +  P   LLH ++AF LL+P   L A +  ++    + +W ++L  I++ +   T ++  +            N  +A   L +   S FW + ++F+ + ++   V       L   +S  +              ++          L   G +  L+     FEFG  + L+N R +   L+ E         +   + E    L     N+  +  G  L+V+   C  P+   +V  Y    +   L    +    L  W  VW  L  K NW F I L
Sbjct:   13 RIWYAILVLALNAFLLYSAFQRYASFRAKA----LREQWDMSPMNFYLAMMILTVFLLPFFLYAALAKTANYAEDGVQIGRDRDCLRV-----AIAETSSGAGAQATVGTCMSRLRRHFMPYTCLLHVLTAFCLLIPMPVLEAAEIHHAKRPSDEIWRTNLDFIYHPKASATNSVCPE----------VFNLMLALAILLVRYPSTFWFSNRAFAFMFSVILCVCGLHICCLKPSMSNGV-------------VTQVNLLPPAIIALHSIGDLLLLVANIAFFEFGYAQMLSNLRKYRNYLQLEASSSVSDRSISSCNDETPCWL-----NYAPHLAGILLMVVAVLCKAPVLWDWVGLYRVHQQPAMLAAVVSGGIYLSLWVSVWFLLGFKANWKFNIRL 376          
BLAST of Protein tincar vs. TrEMBL
Match: A0A1I8HYR5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.888e-14
Identity = 90/400 (22.50%), Postives = 156/400 (39.00%), Query Frame = 3
Query:  198 KIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYXXXXXXXXXXXXXXXXXQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLE-EVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCXXXXXXXXXXXXXXILITWFFVWMTLSVKHNWIFKINL 1394
            +IWY   +LA   ++ Y     Y  F+ ++       +W+ +P+ F L M + +  LLP FLY  L KT N   D V +G          D L   R+      S         + +  P   LLH ++AF LL+P   L A +  ++    + +W ++L  I++ +   T ++  +            N  +A   L +   S FW + ++F+ + ++   V     ++     S++ +  +S    +  +   P         L   G +  L+     FEFG  + L+N R +   L+ E         +   + E    L     N+  +  G  L+V+   C  P+   +V  Y    +   L    +    L  W  VW  L  K NW F I L
Sbjct:   20 RIWYAILVLALNAFLLYSAFQRYASFRAKA----LREQWDMSPMNFYLAMMILTVFLLPFFLYAALAKTANYAEDGVQIGRDR-------DCL---RVAIAETSSGAAA----LRRHFMPYTCLLHVLTAFCLLIPMPVLEAAEIHHAKRPSDEIWRTNLDFIYHPKASATNSVCPE----------VFNLMLALAILLVRYPSTFWFSNRAFAFMFSVILCVCGLHIVLSYEATSVLFKASMSNGVVTQVNLLPPAII-----ALHSIGDLLLLVANIAFFEFGYAQMLSNLRKYRNYLQLEASSSVSDRSISSCNDETPCWL-----NYAPHLAGILLMVVAVLCKAPVLWDWVGLYRVHQQPAMLAAVVSGGIYLSLWVSVWFLLGFKANWKFNIRL 381          
BLAST of Protein tincar vs. Planmine SMEST
Match: SMESG000005995.1 (SMESG000005995.1)

HSP 1 Score: 1253.04 bits (3241), Expect = 0.000e+0
Identity = 642/643 (99.84%), Postives = 643/643 (100.00%), Query Frame = 3
Query:  150 MEKQERNTIVNCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYXXXXXXXXXXXXXXXXXQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLEEVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCXXXXXXXXXXXXXXILITWFFVWMTLSVKHNWIFKINLSTKNQKMFNVEPIYTCFNGNKQLSNYSKNTDNFPTLKKSDAISLVPNGDYLYAEHNKKSDLYQLFKVPSEYMGGRIQSVTSIPSNNSNEMNFQGIETIRRQQNSANIINEIDENRLMSEFAEKMPNSYIHSDTPFSPLIKLHNSRGMMSQRNLMMSGNSQTDSGFQDNRMKNYLHDSFRSVTFSPRRNNFSEMDEISRADNLSPYRQNTIGKHDTISPIRTPTQVESM 2078
            MEKQERNTIVNCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYLSLENPSLKSSSKPLYSQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLEEVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCTKTFFLFGFFAVTFI+ITWFFVWMTLSVKHNWIFKINLSTKNQKMFNVEPIYTCFNGNKQLSNYSKNTDNFPTLKKSDAISLVPNGDYLYAEHNKKSDLYQLFKVPSEYMGGRIQSVTSIPSNNSNEMNFQGIETIRRQQNSANIINEIDENRLMSEFAEKMPNSYIHSDTPFSPLIKLHNSRGMMSQRNLMMSGNSQTDSGFQDNRMKNYLHDSFRSVTFSPRRNNFSEMDEISRADNLSPYRQNTIGKHDTISPIRTPTQVESM
Sbjct:    1 MEKQERNTIVNCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYLSLENPSLKSSSKPLYSQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLEEVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCTKTFFLFGFFAVTFIIITWFFVWMTLSVKHNWIFKINLSTKNQKMFNVEPIYTCFNGNKQLSNYSKNTDNFPTLKKSDAISLVPNGDYLYAEHNKKSDLYQLFKVPSEYMGGRIQSVTSIPSNNSNEMNFQGIETIRRQQNSANIINEIDENRLMSEFAEKMPNSYIHSDTPFSPLIKLHNSRGMMSQRNLMMSGNSQTDSGFQDNRMKNYLHDSFRSVTFSPRRNNFSEMDEISRADNLSPYRQNTIGKHDTISPIRTPTQVESM 643          
BLAST of Protein tincar vs. Planmine SMEST
Match: SMESG000005995.1 (SMESG000005995.1)

HSP 1 Score: 1228.39 bits (3177), Expect = 0.000e+0
Identity = 629/631 (99.68%), Postives = 631/631 (100.00%), Query Frame = 3
Query:  150 MEKQERNTIVNCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYXXXXXXXXXXXXXXXXXQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLEEVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCXXXXXXXXXXXXXXILITWFFVWMTLSVKHNWIFKINLSTKNQKMFNVEPIYTCFNGNKQLSNYSKNTDNFPTLKKSDAISLVPNGDYLYAEHNKKSDLYQLFKVPSEYMGGRIQSVTSIPSNNSNEMNFQGIETIRRQQNSANIINEIDENRLMSEFAEKMPNSYIHSDTPFSPLIKLHNSRGMMSQRNLMMSGNSQTDSGFQDNRMKNYLHDSFRSVTFSPRRNNFSEMDEISRADNLSPYRQNTIGKHDTI 2042
            MEKQERNTIVNCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYLSLENPSLKSSSKPLYSQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLEEVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCTKTFFLFGFFAVTFI+ITWFFVWMTLSVKHNWIFKINLSTKNQKMFNVEPIYTCFNGNKQLSNYSKNTDNFPTLKKSDAISLVPNGDYLYAEHNKKSDLYQLFKVPSEYMGGRIQSVTSIPSNNSNEMNFQGIETIRRQQNSANIINEIDENRLMSEFAEKMPNSYIHSDTPFSPLIKLHNSRGMMSQRNLMMSGNSQTDSGFQDNRMKNYLHDSFRSVTFSPRRNNFSEMDEISRADNLSPYRQNTIGKHDT+
Sbjct:    1 MEKQERNTIVNCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYLSLENPSLKSSSKPLYSQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLEEVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCTKTFFLFGFFAVTFIIITWFFVWMTLSVKHNWIFKINLSTKNQKMFNVEPIYTCFNGNKQLSNYSKNTDNFPTLKKSDAISLVPNGDYLYAEHNKKSDLYQLFKVPSEYMGGRIQSVTSIPSNNSNEMNFQGIETIRRQQNSANIINEIDENRLMSEFAEKMPNSYIHSDTPFSPLIKLHNSRGMMSQRNLMMSGNSQTDSGFQDNRMKNYLHDSFRSVTFSPRRNNFSEMDEISRADNLSPYRQNTIGKHDTV 631          

HSP 2 Score: 103.219 bits (256), Expect = 1.523e-22
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 2
Query: 2039 DFSDQNTNSSGVDVKVNNKHRFFQPSTYSDHHDEVMDNQLIYLHQTGV 2182
            DFSDQNTNSSGVDVKVNNKHRFFQPSTYSDHHDEVMDNQLIYLHQTGV
Sbjct:  633 DFSDQNTNSSGVDVKVNNKHRFFQPSTYSDHHDEVMDNQLIYLHQTGV 680          
BLAST of Protein tincar vs. Planmine SMEST
Match: SMESG000005995.1 (SMESG000005995.1)

HSP 1 Score: 1227.23 bits (3174), Expect = 0.000e+0
Identity = 629/631 (99.68%), Postives = 631/631 (100.00%), Query Frame = 3
Query:  150 MEKQERNTIVNCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYXXXXXXXXXXXXXXXXXQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLEEVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCXXXXXXXXXXXXXXILITWFFVWMTLSVKHNWIFKINLSTKNQKMFNVEPIYTCFNGNKQLSNYSKNTDNFPTLKKSDAISLVPNGDYLYAEHNKKSDLYQLFKVPSEYMGGRIQSVTSIPSNNSNEMNFQGIETIRRQQNSANIINEIDENRLMSEFAEKMPNSYIHSDTPFSPLIKLHNSRGMMSQRNLMMSGNSQTDSGFQDNRMKNYLHDSFRSVTFSPRRNNFSEMDEISRADNLSPYRQNTIGKHDTI 2042
            MEKQERNTIVNCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYLSLENPSLKSSSKPLYSQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLEEVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCTKTFFLFGFFAVTFI+ITWFFVWMTLSVKHNWIFKINLSTKNQKMFNVEPIYTCFNGNKQLSNYSKNTDNFPTLKKSDAISLVPNGDYLYAEHNKKSDLYQLFKVPSEYMGGRIQSVTSIPSNNSNEMNFQGIETIRRQQNSANIINEIDENRLMSEFAEKMPNSYIHSDTPFSPLIKLHNSRGMMSQRNLMMSGNSQTDSGFQDNRMKNYLHDSFRSVTFSPRRNNFSEMDEISRADNLSPYRQNTIGKHDT+
Sbjct:    1 MEKQERNTIVNCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYLSLENPSLKSSSKPLYSQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLEEVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCTKTFFLFGFFAVTFIIITWFFVWMTLSVKHNWIFKINLSTKNQKMFNVEPIYTCFNGNKQLSNYSKNTDNFPTLKKSDAISLVPNGDYLYAEHNKKSDLYQLFKVPSEYMGGRIQSVTSIPSNNSNEMNFQGIETIRRQQNSANIINEIDENRLMSEFAEKMPNSYIHSDTPFSPLIKLHNSRGMMSQRNLMMSGNSQTDSGFQDNRMKNYLHDSFRSVTFSPRRNNFSEMDEISRADNLSPYRQNTIGKHDTV 631          

HSP 2 Score: 103.219 bits (256), Expect = 1.794e-22
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 2
Query: 2039 DFSDQNTNSSGVDVKVNNKHRFFQPSTYSDHHDEVMDNQLIYLHQTGV 2182
            DFSDQNTNSSGVDVKVNNKHRFFQPSTYSDHHDEVMDNQLIYLHQTGV
Sbjct:  647 DFSDQNTNSSGVDVKVNNKHRFFQPSTYSDHHDEVMDNQLIYLHQTGV 694          
BLAST of Protein tincar vs. Planmine SMEST
Match: SMESG000077784.1 (SMESG000077784.1)

HSP 1 Score: 114.005 bits (284), Expect = 6.118e-26
Identity = 144/618 (23.30%), Postives = 255/618 (41.26%), Query Frame = 3
Query:  180 NCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTLQILQPDSLIFERIQNCHDDSAKPKCWNIFK----YYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLI-----FNVRDPGTLTIVKQESESLSFPISTINFF----IASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIRYYXXXXXXXXXXXXXXXXXQWQCACLLIAGFISSLICRCIIFEFGLQRYLTNQRSFDQLLEEVKVPSISTGLFHNSRELKNRLRGQFQNFWLNALGFFLLVIEGGCLIPLACYFVTSYWDCXXXXXXXXXXXXXXIL-----ITWFFVWMTLSVKHNWIFKINLSTKNQKMFNV-------EPIYTCFNGNKQLSNYSKNTDNFPTLKKSDAISLVPNGDYLYAEHNKKSDLYQLFKVPSEYMGGRIQSVTSIPSNNSNEMNFQGIETIRRQQNSANIINEIDENRLMSEFAEKMPNSYIHSDTPFSPLIKLHNSRGMMSQRNLMMSGNSQTDSGFQDNRMKNYLHDSFRSVTFSPRRN 1958
            NC  L K+WY   I+  Q+ +    I+NYL +K QS DPR+G+ W+  PL F L   + S +LL   +Y+C+ K G++ ND + LG            L  + I+   ++ +  K   +F      +V P    +H   A LL +P   + AE+ KN A+S + +W +++  +     F +    T+   K   E  + P +    F    I+ + + +   S FW T K+FSIL +IF  +     L+    L ++I+   + +  +   S   +   W    + +   +  +    IIFE+G  ++++N R + Q        S+       S++  N  + ++ N      G  +LVI     IP+  Y   SY        +     ++  +     ++  F+W  L VK+ W F IN+ T       V       EPIY CF      S  S+ + + P L+ S       +G  + +    +S  Y L         G   ++  +P N + E N  G   +  + NS +  +  ++ + +    + + NS   + T   P               ++++  S +D+   +N  KN        VTF    N
Sbjct:   10 NCDRLWKLWYSILIIVMQVLLISLAISNYLTYKSQSFDPRFGNHWSALPLNFQLASIVLSLSLLVWLIYSCMFKVGHIANDGIVLG------------LDLDSIKKALEEISSYKGIKLFLTRLITHVLPYNCFIHLSIALLLCLPVALMQAEQIKNEAISPDYIWTTNIDFLISPHSFRIFKANTVICYKLPCEYPTKPSAIAPEFINLIISLLIIVIRLPSPFWYTNKAFSILFSIFAFITVSCILMEYESLILIIKIIHNYDLDTKIESHLSV---WLILIIFLIKSLLMIFMLIIIFEYGYTQFISNMRKYRQYFSSDISDSV-------SQQSLNDNQYKWYNVSPRIFGILILVIVKILKIPI-LYVQISYLKINGKISIHPLILISICISLFYFLSCLFLWFGLCVKNKWQFHINIQTNPLPQIGVGKLKSSPEPIYGCFYNAA--SGSSQTSISKPMLRSSI------DGSDVSSHKMNQSANYVLMH------SGMNPAMRVLPINENLEFN-AGESDVSFESNSKSYDSGDNKYKRIPYAIQNIENSQYATLTSLQP--------------GVLLTAKSMSDTSSNENYSKNPSRRGSNRVTFKEENN 575          
BLAST of Protein tincar vs. Planmine SMEST
Match: SMESG000051307.1 (SMESG000051307.1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.215e-19
Identity = 66/258 (25.58%), Postives = 121/258 (46.90%), Query Frame = 3
Query:  174 IVNCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPRYGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNTL------QILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLLVPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPG----TLTIVKQESESLSFPISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSVLSIVIR 917
            +  C+ L  IW+   ++   +Y+ Y+ I NYL+FK  ++DP YG  W+ N     L   +    LLP+ +YT ++  GN  ND    G+          +  + D ++  + +NC     K K   +    + P   +L  ++A+  L+P  +++A +  +  L    +W +DL +IF   DP       T  +Q S      ++  NF  +   L++  S VFW   K+F+++++   L  S   L+    LS++I+
Sbjct:    1 MTKCKKLWDIWFLTYLIVINLYLTYNAILNYLNFKVNASDPVYGRNWDTNLTYLILECIIIPLGLLPVIIYTNILPVGNFANDGKSFGKDEEFFHFILNENGKADIVMNNKERNC----CKQKFLKLIFMELPPISYVLQVVAAYCYLIPKPFMDARQIFHKVLRPNQIWHTDLDIIF---DPDHQHPEFTYYQQWSYIQPMTVAYFNFGFSLFLLSIQYSRVFWNVSKTFTLVLSFLMLTFSLHLLVEYCSLSMMIK 251          
The following BLAST results are available for this feature:
BLAST of Protein tincar vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GLJ33.785e-1722.44Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267E6695.322e-1722.44Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267H7U16.606e-1722.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IPE77.595e-1522.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HYR53.888e-1422.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Protein tincar vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein tincar vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005995.10.000e+099.84SMESG000005995.1[more]
SMESG000005995.11.523e-2299.68SMESG000005995.1[more]
SMESG000005995.11.794e-2299.68SMESG000005995.1[more]
SMESG000077784.16.118e-2623.30SMESG000077784.1[more]
SMESG000051307.12.215e-1925.58SMESG000051307.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012686 ID=SMED30012686|Name=Protein tincar|organism=Schmidtea mediterranea sexual|type=transcript|length=2241bp
TTTGATTTGTCGCAATTCAAAAAAATGTAAATAACAAGAACAAATATTAA
TGTGTGCTACAAAATATGAATATTACTAATCCTCAATTTTGATTGGCTAG
TTCAATCAATAATATATTAAACAGATTAACAGACATTTTTAGAAAAAAAA
TGGAAAAACAAGAAAGAAATACAATTGTAAATTGTCGAAGTTTAGGTAAA
ATATGGTATGGATTTACAATTTTAGCATTTCAAATCTATGTTCATTACGA
TGAAATTAACAATTATTTGGACTTCAAAAAGCAGTCGAATGACCCTCGAT
ATGGTTCAGAATGGAACGAAAACCCATTGACATTTTGTTTGATGATGACA
ATGTTCTCATTTGCATTGCTGCCAATATTTCTCTACACGTGTCTTATAAA
AACGGGCAATCTGATTAATGACAATGTGGATTTAGGTGAGACTAATACAC
TACAAATTCTTCAACCAGATTCTCTGATTTTCGAAAGAATTCAAAATTGT
CATGACGATTCTGCGAAACCGAAATGTTGGAATATATTTAAATATTATGT
TTTTCCAAGTTGCCAACTACTCCATTATATTTCAGCCTTTTTATTATTGG
TGCCTCATCTTTACTTAAATGCAGAAAAGTTTAAAAATTCAGCTCTCAGT
TATGAAAATTTATGGATCAGCGATCTTCATCTCATTTTTAATGTTCGTGA
TCCTGGAACTCTAACAATTGTCAAGCAAGAATCAGAATCATTAAGCTTTC
CTATTTCGACGATAAATTTTTTTATAGCATCTATGTTTCTAGCCTTGTTT
ACTTCATCTGTTTTTTGGAAAACTTGCAAATCTTTTTCCATTCTCATTGC
TATTTTCGATTTAGTATTGAGCTTTGGATATTTAATATTGAACTCAGTGT
TATCAATAGTTATTAGATACTATCTGAGCTTGGAAAACCCTTCTTTGAAA
AGTTCAAGTAAACCTTTATATTCTCAATGGCAGTGCGCTTGTTTGCTTAT
AGCCGGTTTTATTAGTTCTCTCATTTGTCGTTGTATAATTTTTGAATTCG
GTCTTCAGAGATATCTAACCAATCAGCGTTCGTTTGATCAGCTTCTAGAA
GAAGTTAAAGTGCCTTCAATATCTACTGGGTTGTTTCATAATTCAAGAGA
ACTAAAAAATCGCTTGCGGGGTCAATTCCAAAATTTTTGGCTCAATGCTT
TGGGGTTCTTTCTATTGGTAATTGAAGGGGGTTGTTTAATTCCGCTAGCT
TGTTATTTTGTCACCAGCTATTGGGACTGCACTAAAACATTTTTTCTTTT
CGGATTTTTTGCGGTAACATTCATCCTCATTACTTGGTTTTTTGTATGGA
TGACTTTGTCAGTAAAACATAATTGGATATTTAAAATTAACCTATCCACA
AAGAATCAGAAAATGTTTAATGTTGAACCGATATATACATGCTTCAATGG
AAACAAACAACTGAGTAACTATTCCAAAAACACAGATAATTTTCCGACTT
TGAAAAAAAGCGATGCAATTAGTTTAGTTCCAAATGGTGATTATCTCTAT
GCTGAACATAACAAAAAGTCTGATCTCTATCAATTATTTAAAGTTCCATC
GGAATACATGGGTGGTCGTATACAAAGTGTCACATCGATTCCTTCCAATA
ACAGCAATGAAATGAATTTTCAAGGAATTGAAACTATTCGACGTCAACAG
AATTCGGCAAATATTATCAATGAAATTGATGAAAATAGGCTTATGAGTGA
ATTTGCAGAAAAAATGCCCAACTCATATATTCACAGTGATACACCATTTT
CACCACTGATAAAACTCCACAATTCTCGTGGAATGATGTCTCAAAGAAAT
CTAATGATGTCTGGCAATAGTCAGACCGATAGTGGGTTTCAAGATAATCG
GATGAAAAATTATTTGCACGACAGTTTTCGTTCTGTGACTTTCTCACCGC
GACGAAACAATTTTTCGGAAATGGATGAAATCAGCCGTGCCGACAACTTA
TCACCGTATCGACAGAATACGATTGGAAAACATGACACGATTTCTCCGAT
CAGAACACCAACTCAAGTGGAGTCGATGTGAAGGTGAATAACAAACATCG
TTTTTTTCAGCCATCAACATATTCAGACCATCACGACGAAGTAATGGACA
ACCAGTTAATTTATTTACACCAGACAGGTGTATAAAGATCTATTTTAAAT
ATTTTTTTTCTATTATATTAGTTTATTTATTTAAAATAAAT
back to top

protein sequence of SMED30012686-orf-1

>SMED30012686-orf-1 ID=SMED30012686-orf-1|Name=SMED30012686-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=644bp
MEKQERNTIVNCRSLGKIWYGFTILAFQIYVHYDEINNYLDFKKQSNDPR
YGSEWNENPLTFCLMMTMFSFALLPIFLYTCLIKTGNLINDNVDLGETNT
LQILQPDSLIFERIQNCHDDSAKPKCWNIFKYYVFPSCQLLHYISAFLLL
VPHLYLNAEKFKNSALSYENLWISDLHLIFNVRDPGTLTIVKQESESLSF
PISTINFFIASMFLALFTSSVFWKTCKSFSILIAIFDLVLSFGYLILNSV
LSIVIRYYLSLENPSLKSSSKPLYSQWQCACLLIAGFISSLICRCIIFEF
GLQRYLTNQRSFDQLLEEVKVPSISTGLFHNSRELKNRLRGQFQNFWLNA
LGFFLLVIEGGCLIPLACYFVTSYWDCTKTFFLFGFFAVTFILITWFFVW
MTLSVKHNWIFKINLSTKNQKMFNVEPIYTCFNGNKQLSNYSKNTDNFPT
LKKSDAISLVPNGDYLYAEHNKKSDLYQLFKVPSEYMGGRIQSVTSIPSN
NSNEMNFQGIETIRRQQNSANIINEIDENRLMSEFAEKMPNSYIHSDTPF
SPLIKLHNSRGMMSQRNLMMSGNSQTDSGFQDNRMKNYLHDSFRSVTFSP
RRNNFSEMDEISRADNLSPYRQNTIGKHDTISPIRTPTQVESM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000478pharynx musculature
PLANA:0002056medial muscle cell
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0046872metal ion binding
GO:0071558histone demethylase activity (H3-K27 specific)
Vocabulary: biological process
TermDefinition
GO:0010468regulation of gene expression
GO:0032259methylation
GO:0071557histone H3-K27 demethylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR21579FAMILY NOT NAMEDcoord: 11..425
NoneNo IPR availablePANTHERPTHR21579:SF13PROTEIN TINCARcoord: 11..425
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 200..222
NoneNo IPR availableTMHMMTMhelixcoord: 9..31
NoneNo IPR availableTMHMMTMhelixcoord: 345..367
NoneNo IPR availableTMHMMTMhelixcoord: 229..251
NoneNo IPR availableTMHMMTMhelixcoord: 382..404
NoneNo IPR availableTMHMMTMhelixcoord: 133..155
NoneNo IPR availableTMHMMTMhelixcoord: 276..298