Ectonucleoside triphosphate diphosphohydrolase 1

Overview
NameEctonucleoside triphosphate diphosphohydrolase 1
Smed IDSMED30012672
Length (bp)2043
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ectonucleoside triphosphate diphosphohydrolase 1 (SMED30012672) t-SNE clustered cells

Violin plots show distribution of expression levels for Ectonucleoside triphosphate diphosphohydrolase 1 (SMED30012672) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ectonucleoside triphosphate diphosphohydrolase 1 (SMED30012672) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ectonucleoside triphosphate diphosphohydrolase 1 (SMED30012672) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012672

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30012672SMESG000051033.1 dd_Smed_v4_4184_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Human
Match: ENTPD1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3363])

HSP 1 Score: 265.774 bits (678), Expect = 2.882e-80
Identity = 158/523 (30.21%), Postives = 265/523 (50.67%), Query Frame = 3
Query:  390 MENNSEYHTEYRTKNYQTLMWKPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKI---------VKKPNVIGALDMGGASTQITFIDN-----SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNS--TFVLNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHF-LPIENYLFGILLAVLLVIMCFAVA 1892
            M+   +  ++ +  N +T   K +  +  F S+  +IAL+ + +     L     Y +++DAGS+ + +Y+Y W + K  +   V QV  C+   PGIS F    N+    + +C++ +   +IP    ++T VYLGATAGMR+L + +   + +++  +  SL+  P     +     IITG +EG YGW T+N+LL    +K                 GALD+GGASTQ+TF+       SP+N    ++ +LYG  Y++Y+HS+LCYGK QA ++ LA+ I++ +    + +PC            D++  PC   +F +       +P        Q    +G  NY  C+ ++  LFN S C +  C FNG++ PP+ G FGAFSA+  +   LN  +E +  EK    MK  C   +    T     ++K+    CF   +++ +L+    F   +W +I FI KI  ++ GW LG++ + T+++P EQ    P+ +  + + L VL  ++ F VA
Sbjct:    1 MKGTKDLTSQQKESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCME-RAREVIPRSQHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPFDFQGA----RIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDN---ALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVAS-NEILRDPCFHPGYKKVVNVSDLYKTPCTK-RFEM------TLP-------FQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTY-VFLMVLFSLVLFTVA 499          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Human
Match: ENTPD1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3363])

HSP 1 Score: 264.618 bits (675), Expect = 1.006e-79
Identity = 157/517 (30.37%), Postives = 263/517 (50.87%), Query Frame = 3
Query:  408 YHTEYRTKNYQTLMWKPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKI---------VKKPNVIGALDMGGASTQITFIDN-----SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNS--TFVLNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHF-LPIENYLFGILLAVLLVIMCFAVA 1892
            + + ++  N +T   K +  +  F S+  +IAL+ + +     L     Y +++DAGS+ + +Y+Y W + K  +   V QV  C+   PGIS F    N+    + +C++ +   +IP    ++T VYLGATAGMR+L + +   + +++  +  SL+  P     +     IITG +EG YGW T+N+LL    +K                 GALD+GGASTQ+TF+       SP+N    ++ +LYG  Y++Y+HS+LCYGK QA ++ LA+ I++ +    + +PC            D++  PC   +F +       +P        Q    +G  NY  C+ ++  LFN S C +  C FNG++ PP+ G FGAFSA+  +   LN  +E +  EK    MK  C   +    T     ++K+    CF   +++ +L+    F   +W +I FI KI  ++ GW LG++ + T+++P EQ    P+ +  + + L VL  ++ F VA
Sbjct:   12 FSSGFQESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCME-RAREVIPRSQHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPFDFQGA----RIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDN---ALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVAS-NEILRDPCFHPGYKKVVNVSDLYKTPCTK-RFEM------TLP-------FQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTY-VFLMVLFSLVLFTVA 504          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Human
Match: ENTPD1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3363])

HSP 1 Score: 263.462 bits (672), Expect = 1.740e-79
Identity = 157/512 (30.66%), Postives = 260/512 (50.78%), Query Frame = 3
Query:  423 RTKNYQTLMWKPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKI---------VKKPNVIGALDMGGASTQITFIDN-----SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNS--TFVLNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHF-LPIENYLFGILLAVLLVIMCFAVA 1892
            +  N +T   K +  +  F S+  +IAL+ + +     L     Y +++DAGS+ + +Y+Y W + K  +   V QV  C+   PGIS F    N+    + +C++ +   +IP    ++T VYLGATAGMR+L + +   + +++  +  SL+  P     +     IITG +EG YGW T+N+LL    +K                 GALD+GGASTQ+TF+       SP+N    ++ +LYG  Y++Y+HS+LCYGK QA ++ LA+ I++ +    + +PC            D++  PC   +F +       +P        Q    +G  NY  C+ ++  LFN S C +  C FNG++ PP+ G FGAFSA+  +   LN  +E +  EK    MK  C   +    T     ++K+    CF   +++ +L+    F   +W +I FI KI  ++ GW LG++ + T+++P EQ    P+ +  + + L VL  ++ F VA
Sbjct:    5 KESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCME-RAREVIPRSQHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPFDFQGA----RIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDN---ALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVAS-NEILRDPCFHPGYKKVVNVSDLYKTPCTK-RFEM------TLP-------FQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTY-VFLMVLFSLVLFTVA 492          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Human
Match: ENTPD8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:HGNC Symbol;Acc:HGNC:24860])

HSP 1 Score: 248.054 bits (632), Expect = 9.065e-74
Identity = 154/488 (31.56%), Postives = 248/488 (50.82%), Query Frame = 3
Query:  492 GIIALITIYV----INLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPK-----KIVKKPN--VIGALDMGGASTQITFIDNSP-NNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRC-AFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNE------NLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLI-NLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHF-LPIENYLFGILLAVLLVIMCFAV 1889
            G+ ALI + V    + L +   + ++ DAGS+ + ++LY W +NK      V Q   C+ + PGISS+ +N  ++   ++ CL+  ++ LIP    +KT  +LGATAGMR+LS  N + ++ I   +   L +SP+    +     ++ G  EG +GW TVN+ L  L K     + ++ P   ++GALDMGGASTQITF+   P  + +     +LYG+ YS+Y+HSYLC+G+ Q   R L  L++       + +PC       T     ++  PCV              PP   L + QN+T +GT N   C S ++ LFN S C     C F+GVYQPP+ G+F AFS +      LN  +       N    ++  R   L  + Y       G+D+W +  C   ++++ +L    GF+E  W ++EF  + G  ++GW LG++ + T ++P +       E+Y   +   V +V+   AV
Sbjct:   21 GLTALILLLVEATSVLLPTDIKFGIVFDAGSSHTSLFLYQWLANKENGTGVVSQALACQVEGPGISSYTSNAAQAGESLQGCLEEALV-LIPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWGA----ELLAGQAEGAFGWITVNYGLGTLVKYSFTGEWIQPPEEMLVGALDMGGASTQITFVPGGPILDKSTQADFRLYGSDYSVYTHSYLCFGRDQMLSRLLVGLVQ-SRPAALLRHPCYLSGYQTTLALGPLYESPCV-----------HATPP---LSLPQNLTVEGTGNPGACVSAIRELFNFSSCQGQEDCAFDGVYQPPLRGQFYAFSNFYYTFHFLNLTSRQPLSTVNATIWEFCQRPWKLVEASY------PGQDRWLRDYCASGLYILTLLHEGYGFSEETWPSLEFRKQAGGVDIGWTLGYMLNLTGMIPADAPAQWRAESYGVWVAKVVFMVLALVAV 482          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Human
Match: ENTPD8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:HGNC Symbol;Acc:HGNC:24860])

HSP 1 Score: 248.054 bits (632), Expect = 9.065e-74
Identity = 154/488 (31.56%), Postives = 248/488 (50.82%), Query Frame = 3
Query:  492 GIIALITIYV----INLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPK-----KIVKKPN--VIGALDMGGASTQITFIDNSP-NNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRC-AFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNE------NLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLI-NLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHF-LPIENYLFGILLAVLLVIMCFAV 1889
            G+ ALI + V    + L +   + ++ DAGS+ + ++LY W +NK      V Q   C+ + PGISS+ +N  ++   ++ CL+  ++ LIP    +KT  +LGATAGMR+LS  N + ++ I   +   L +SP+    +     ++ G  EG +GW TVN+ L  L K     + ++ P   ++GALDMGGASTQITF+   P  + +     +LYG+ YS+Y+HSYLC+G+ Q   R L  L++       + +PC       T     ++  PCV              PP   L + QN+T +GT N   C S ++ LFN S C     C F+GVYQPP+ G+F AFS +      LN  +       N    ++  R   L  + Y       G+D+W +  C   ++++ +L    GF+E  W ++EF  + G  ++GW LG++ + T ++P +       E+Y   +   V +V+   AV
Sbjct:   21 GLTALILLLVEATSVLLPTDIKFGIVFDAGSSHTSLFLYQWLANKENGTGVVSQALACQVEGPGISSYTSNAAQAGESLQGCLEEALV-LIPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWGA----ELLAGQAEGAFGWITVNYGLGTLVKYSFTGEWIQPPEEMLVGALDMGGASTQITFVPGGPILDKSTQADFRLYGSDYSVYTHSYLCFGRDQMLSRLLVGLVQ-SRPAALLRHPCYLSGYQTTLALGPLYESPCV-----------HATPP---LSLPQNLTVEGTGNPGACVSAIRELFNFSSCQGQEDCAFDGVYQPPLRGQFYAFSNFYYTFHFLNLTSRQPLSTVNATIWEFCQRPWKLVEASY------PGQDRWLRDYCASGLYILTLLHEGYGFSEETWPSLEFRKQAGGVDIGWTLGYMLNLTGMIPADAPAQWRAESYGVWVAKVVFMVLALVAV 482          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Celegans
Match: mig-23 (Nucleoside-diphosphatase mig-23 [Source:UniProtKB/Swiss-Prot;Acc:Q21815])

HSP 1 Score: 94.3597 bits (233), Expect = 6.508e-20
Identity = 109/473 (23.04%), Postives = 197/473 (41.65%), Query Frame = 3
Query:  543 TYSVIIDAGSTSSKIYLYYWESNKYINNADVLQV---------AMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTK-SPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIV----------KKPNVIGALDMGGASTQITF----IDNSPNNWTETIKLKLYGNS----YSIYSHSYLCYGKSQA----EYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFN-----------KSRCAFGSCPFNGVYQPPISG-KFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNS-------TFVLNGEDKWTKWRCFDIVFMIQMLINLGFNESNWSN-IEFIDKIGDANVGWGLGFIFDKTSILP 1805
            +Y VI DAGST +++++Y W S    ++++++Q+          M K  PG+S+F T P ++   ++  ++      IP E R  T V++ ATAGMR++      A   ++  +R+ L K + ++V      I II G  EG+Y W  VN+ L    K              +   +G +DMGGAS QI F     D+  +   E I L    +     Y ++  ++L YG ++     E+  L++L +     T I + CM              N+             H+ +     L+  +N   +GT N+  C++ V+ L N            ++C FG+ P   +   P+S  +   FS Y      +       D E    + +  C+ ++++             +++  + +CF   ++  +L + GF+     N  + +  I    V W LG +       P
Sbjct:   43 SYGVICDAGSTGTRLFVYNWIST---SDSELIQIEPVIYDNKPVMKKISPGLSTFGTKPAQAAEYLRPLMELA-ERHIPEEKRPYTPVFIFATAGMRLIPDEQKEA---VLKNLRNKLPKITSMQVLK--EHIRIIEGKWEGIYSWIAVNYALGKFNKTATLDFPGTSPAHARQKTVGMIDMGGASAQIAFELPDTDSFSSINVENINLGCREDDSLFKYKLFVTTFLGYGVNEGIRKYEHMLLSKLKDQNG--TVIQDDCMP------------LNL-------------HKTVT----LENGENFVRRGTGNWNTCSNEVKKLLNPESSSEVCKAEAAKCYFGAVPAPSI---PLSNIEMYGFSEYWYSTHDVLGLGGQYDAENIAKKTQQYCSKRWSTIQAESKKQLYPRADEERLRTQCFKSAWITSVLHD-GFSVDKTHNKFQSVSTIAGQEVQWALGAMIYHMRFFP 471          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Celegans
Match: uda-1 (Nucleoside-diphosphatase uda-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XU84])

HSP 1 Score: 91.2781 bits (225), Expect = 3.420e-19
Identity = 103/475 (21.68%), Postives = 196/475 (41.26%), Query Frame = 3
Query:  477 FLSLCGIIALITIYVINLSSIFT-------YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMC---------KADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKS------PLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNL---PKKIVKKPNV---IGALDMGGASTQITFIDNSPNNWTETI----KLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELI--EIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTI---LNEKNEN--LDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIF 1784
            F SL  ++   T Y  +   +         ++++IDAGST ++++LY     K+I++  +    M          +  PG+SSF  +P+ + + ++  L  +    +P  M +KT + L ATAG+R+L     + +  I+  + + +  S      P  VN       ++ G+ EG+Y W T+N LL+ L      +  KP     + A D+GG STQ+T+  N+   ++E +     +  +G+   +++HS+L  G   A    L      EIE+ T  +   CM E   +T              ++AL  +               NI    + ++  C  T ++    S           ++   + G      +Y   + +   L + NE   ++  ++K   +  C  +      ++    W  W+C D+ ++  +L + G+   +   +    KI    V WG G  F
Sbjct:   13 FFSLLSVVTTKTQYWCHGDGVLNNQHTCRFFTIVIDAGSTGTRLHLY-----KFIHDPAIASHGMPFKVEKEIFQEVKPGLSSFAKSPSSAADSLEPLLQ-RARKEVPHFMWEKTPITLKATAGLRLLP---GDMADDILESVEERIFNSGFFAAFPDAVN-------VMPGSDEGVYSWFTLNILLETLFTDEPTVGHKPAAHRSVAAFDLGGGSTQLTYWPNNEAVFSEHVGYERDIDFFGHHIRLFTHSFLGNGLIAARLNILQLETDNEIES-THQLITSCMPEGYQLT------------EWEYALKFW---------------NINGSSSHSFESCYGTTKNFVESSEI---------MHLRELKGSPVYLFSYFFDRALNSGLVKGNEGGKIELRQFKEAAEIACRREKTE---IDDGSHWMPWQCLDLTYIYSLLRD-GYQFEDNQPLVLAKKIKGMEVSWGQGLAF 430          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Celegans
Match: ntp-1 (Nucleoside-triphosphatase ntp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18411])

HSP 1 Score: 82.4185 bits (202), Expect = 3.147e-16
Identity = 73/242 (30.17%), Postives = 116/242 (47.93%), Query Frame = 3
Query:  519 VINLSSIFTYSVIIDAGSTSSKIYLYYWES-NKYINNADVL----QVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITF-IDNSPNNWTETIKLKLYGNS--------YSIYSHSYLCYGKSQAEYRFLAELIEIEN 1202
            V+   +   Y VI DAGS+ +++++Y  +  +  + N D L    +  + K  PG+SSF   P +    +   L       IP E   +T + + ATAGMR+L    P A +  +     +  KS   +  S S+I II GA EG+Y W  VN++L    K+   K   +G +DMGGAS QI F I N   ++      ++   S        Y IYS ++L YG ++   ++   L++  N
Sbjct:   40 VVETKNNIKYGVICDAGSSGTRLFVYTLKPLSGGLTNIDTLIHESEPVVKKVTPGLSSFGDKPEQVVEYLTPLLRFAE-EHIPYEQLGETDLLIFATAGMRLL----PEAQKDAIIKNLQNGLKSVTALRVSDSNIRIIDGAWEGIYSWIAVNYILGRFDKENDSK---VGMIDMGGASVQIAFEIANEKESYNGGNVYEINLGSIETNEDYKYKIYSTTFLGYGANEGLKKYENSLVKSGN 273          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Celegans
Match: ntp-1 (Nucleoside-triphosphatase ntp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18411])

HSP 1 Score: 82.4185 bits (202), Expect = 3.147e-16
Identity = 73/242 (30.17%), Postives = 116/242 (47.93%), Query Frame = 3
Query:  519 VINLSSIFTYSVIIDAGSTSSKIYLYYWES-NKYINNADVL----QVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITF-IDNSPNNWTETIKLKLYGNS--------YSIYSHSYLCYGKSQAEYRFLAELIEIEN 1202
            V+   +   Y VI DAGS+ +++++Y  +  +  + N D L    +  + K  PG+SSF   P +    +   L       IP E   +T + + ATAGMR+L    P A +  +     +  KS   +  S S+I II GA EG+Y W  VN++L    K+   K   +G +DMGGAS QI F I N   ++      ++   S        Y IYS ++L YG ++   ++   L++  N
Sbjct:   40 VVETKNNIKYGVICDAGSSGTRLFVYTLKPLSGGLTNIDTLIHESEPVVKKVTPGLSSFGDKPEQVVEYLTPLLRFAE-EHIPYEQLGETDLLIFATAGMRLL----PEAQKDAIIKNLQNGLKSVTALRVSDSNIRIIDGAWEGIYSWIAVNYILGRFDKENDSK---VGMIDMGGASVQIAFEIANEKESYNGGNVYEINLGSIETNEDYKYKIYSTTFLGYGANEGLKKYENSLVKSGN 273          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Celegans
Match: ntp-1 (Nucleoside-triphosphatase ntp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18411])

HSP 1 Score: 82.4185 bits (202), Expect = 3.700e-16
Identity = 73/242 (30.17%), Postives = 116/242 (47.93%), Query Frame = 3
Query:  519 VINLSSIFTYSVIIDAGSTSSKIYLYYWES-NKYINNADVL----QVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITF-IDNSPNNWTETIKLKLYGNS--------YSIYSHSYLCYGKSQAEYRFLAELIEIEN 1202
            V+   +   Y VI DAGS+ +++++Y  +  +  + N D L    +  + K  PG+SSF   P +    +   L       IP E   +T + + ATAGMR+L    P A +  +     +  KS   +  S S+I II GA EG+Y W  VN++L    K+   K   +G +DMGGAS QI F I N   ++      ++   S        Y IYS ++L YG ++   ++   L++  N
Sbjct:   74 VVETKNNIKYGVICDAGSSGTRLFVYTLKPLSGGLTNIDTLIHESEPVVKKVTPGLSSFGDKPEQVVEYLTPLLRFAE-EHIPYEQLGETDLLIFATAGMRLL----PEAQKDAIIKNLQNGLKSVTALRVSDSNIRIIDGAWEGIYSWIAVNYILGRFDKENDSK---VGMIDMGGASVQIAFEIANEKESYNGGNVYEINLGSIETNEDYKYKIYSTTFLGYGANEGLKKYENSLVKSGN 307          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Fly
Match: NTPase (gene:FBgn0024947 transcript:FBtr0332459)

HSP 1 Score: 108.997 bits (271), Expect = 7.078e-25
Identity = 85/251 (33.86%), Postives = 124/251 (49.40%), Query Frame = 3
Query:  486 LCGIIALITI-------------YVINLSSIFTYS-----VIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKA-DPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTETIK----LKLYGNSYSIYSHSYLCYGKSQAEY 1169
            LC II++I +             Y+  L+S F YS      IIDAGST S++  Y + +  +I+N  VL   + K   PG+SSF  NP +  + IK  LD +    IP E    T + L ATAG+R+L  +    ++ I+  +RD   KS   V+  +  + I+ G  EG++ W TVNFLL  L      K N   ALD+GG STQ+TF    P+      K    +       ++++HSYL  G   A +
Sbjct:   44 LCLIISVILLLFVFGFVSENASPYLARLASKFGYSKVQYAAIIDAGSTGSRVLAYKF-NRSFIDNKLVLYEELFKERKPGLSSFADNPAEGAHSIKLLLD-EARAFIPKEHWSSTPLVLKATAGLRLLPASK---AENILNAVRDLFAKSEFSVD--MDAVEIMDGTDEGIFSWFTVNFLLGRL-----SKTNQAAALDLGGGSTQVTFSPTDPDQVPVYDKYMHEVVTSSKKINVFTHSYLGLGLMAARH 282          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Fly
Match: NTPase (gene:FBgn0024947 transcript:FBtr0077683)

HSP 1 Score: 108.997 bits (271), Expect = 7.132e-25
Identity = 85/251 (33.86%), Postives = 124/251 (49.40%), Query Frame = 3
Query:  486 LCGIIALITI-------------YVINLSSIFTYS-----VIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKA-DPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTETIK----LKLYGNSYSIYSHSYLCYGKSQAEY 1169
            LC II++I +             Y+  L+S F YS      IIDAGST S++  Y + +  +I+N  VL   + K   PG+SSF  NP +  + IK  LD +    IP E    T + L ATAG+R+L  +    ++ I+  +RD   KS   V+  +  + I+ G  EG++ W TVNFLL  L      K N   ALD+GG STQ+TF    P+      K    +       ++++HSYL  G   A +
Sbjct:   41 LCLIISVILLLFVFGFVSENASPYLARLASKFGYSKVQYAAIIDAGSTGSRVLAYKF-NRSFIDNKLVLYEELFKERKPGLSSFADNPAEGAHSIKLLLD-EARAFIPKEHWSSTPLVLKATAGLRLLPASK---AENILNAVRDLFAKSEFSVD--MDAVEIMDGTDEGIFSWFTVNFLLGRL-----SKTNQAAALDLGGGSTQVTFSPTDPDQVPVYDKYMHEVVTSSKKINVFTHSYLGLGLMAARH 279          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Fly
Match: NTPase (gene:FBgn0024947 transcript:FBtr0332460)

HSP 1 Score: 108.612 bits (270), Expect = 1.774e-24
Identity = 80/228 (35.09%), Postives = 116/228 (50.88%), Query Frame = 3
Query:  516 YVINLSSIFTYS-----VIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKA-DPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTETIK----LKLYGNSYSIYSHSYLCYGKSQAEY 1169
            Y+  L+S F YS      IIDAGST S++  Y + +  +I+N  VL   + K   PG+SSF  NP +  + IK  LD +    IP E    T + L ATAG+R+L  +    ++ I+  +RD   KS   V+  +  + I+ G  EG++ W TVNFLL  L      K N   ALD+GG STQ+TF    P+      K    +       ++++HSYL  G   A +
Sbjct:  127 YLARLASKFGYSKVQYAAIIDAGSTGSRVLAYKF-NRSFIDNKLVLYEELFKERKPGLSSFADNPAEGAHSIKLLLD-EARAFIPKEHWSSTPLVLKATAGLRLLPASK---AENILNAVRDLFAKSEFSVD--MDAVEIMDGTDEGIFSWFTVNFLLGRL-----SKTNQAAALDLGGGSTQVTFSPTDPDQVPVYDKYMHEVVTSSKKINVFTHSYLGLGLMAARH 342          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Fly
Match: NTPase (gene:FBgn0024947 transcript:FBtr0077680)

HSP 1 Score: 53.5286 bits (127), Expect = 2.206e-7
Identity = 32/91 (35.16%), Postives = 45/91 (49.45%), Query Frame = 3
Query:  909 IAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTETIK----LKLYGNSYSIYSHSYLCYGKSQAEY 1169
            + I+ G  EG++ W TVNFLL  L      K N   ALD+GG STQ+TF    P+      K    +       ++++HSYL  G   A +
Sbjct:    4 VEIMDGTDEGIFSWFTVNFLLGRL-----SKTNQAAALDLGGGSTQVTFSPTDPDQVPVYDKYMHEVVTSSKKINVFTHSYLGLGLMAARH 89          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Fly
Match: NTPase (gene:FBgn0024947 transcript:FBtr0077682)

HSP 1 Score: 53.5286 bits (127), Expect = 2.206e-7
Identity = 32/91 (35.16%), Postives = 45/91 (49.45%), Query Frame = 3
Query:  909 IAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTETIK----LKLYGNSYSIYSHSYLCYGKSQAEY 1169
            + I+ G  EG++ W TVNFLL  L      K N   ALD+GG STQ+TF    P+      K    +       ++++HSYL  G   A +
Sbjct:    4 VEIMDGTDEGIFSWFTVNFLLGRL-----SKTNQAAALDLGGGSTQVTFSPTDPDQVPVYDKYMHEVVTSSKKINVFTHSYLGLGLMAARH 89          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Zebrafish
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-040801-58])

HSP 1 Score: 262.307 bits (669), Expect = 2.304e-79
Identity = 163/503 (32.41%), Postives = 270/503 (53.68%), Query Frame = 3
Query:  453 KPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKP-NVIGALDMGGASTQITFIDNSPNNWTET----IKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTN---ISNPCMSETESITYGAKDIFNVPCVMG-KFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNG--EDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKE---QHFLPIENYLFGILLAVLLVIMCFAVAFTYF 1904
            +P+ I    +   GI+ +++I V+    L   + Y +++DAGS+ + +++Y W + K  N   V Q   C     GISS++  P+ +   ++ C+  +    IPA    +T VYLGATAGMR+L + +  AS++++  +  SL   P     S     I++G +EG +GW TVN+L +NL     +KP   +GALD+GGASTQITF+   P    E+    I  +LYGN Y +Y+HS+LCYGK QA    +AE +      T+   + +PC     + T   + + N PC+   K   + + H                  G  N++ C  +++ +FN S C +  C FNGV+QP + GKFGAFSA+  +   LN  N++LD  K K R+   C++ +      +   ++K+    CF   +++ +L +   F   NW++I+FI KIGD++ GW LG++ + T+++P E   +  +P   Y+  +LL  LL+++   +A+ YF
Sbjct:   15 RPVVIFLMAVVAVGIVIMVSISVVQHKPLPQKYKYGIVLDAGSSHTSVFIYKWPAEKENNTGMVQQHHTCNVKGKGISSYFDKPHGAGASLEECMK-EAKEKIPAHRHSETPVYLGATAGMRLLKMEDEMASEKVLTSVAHSLKTYPF----SYQGARILSGQEEGAFGWITVNYLSENL-----RKPAGTLGALDLGGASTQITFV---PQQIIESSDNSIDFRLYGNDYHLYTHSFLCYGKDQALKLAMAEKLRSTPDKTDAILLRDPCFHPGYNTTKTLESV-NTPCMKPLKMPKEQFSH-----------------VGLGNWSQCQESIRKVFNTSHCPYSGCSFNGVFQPTVEGKFGAFSAFFFVMDFLNLTNDSLD--KTKQRLAMYCSTPWQKIVQDHPKVKEKYLSEYCFSATYILTLLEHGYNFTSDNWNDIKFIKKIGDSDAGWTLGYMLNLTNMIPAEDPDKPLMPHGGYVTFMLLFSLLILVLIIMAYIYF 484          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Zebrafish
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-040801-58])

HSP 1 Score: 261.922 bits (668), Expect = 2.583e-79
Identity = 163/503 (32.41%), Postives = 270/503 (53.68%), Query Frame = 3
Query:  453 KPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKP-NVIGALDMGGASTQITFIDNSPNNWTET----IKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTN---ISNPCMSETESITYGAKDIFNVPCVMG-KFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNG--EDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKE---QHFLPIENYLFGILLAVLLVIMCFAVAFTYF 1904
            +P+ I    +   GI+ +++I V+    L   + Y +++DAGS+ + +++Y W + K  N   V Q   C     GISS++  P+ +   ++ C+  +    IPA    +T VYLGATAGMR+L + +  AS++++  +  SL   P     S     I++G +EG +GW TVN+L +NL     +KP   +GALD+GGASTQITF+   P    E+    I  +LYGN Y +Y+HS+LCYGK QA    +AE +      T+   + +PC     + T   + + N PC+   K   + + H                  G  N++ C  +++ +FN S C +  C FNGV+QP + GKFGAFSA+  +   LN  N++LD  K K R+   C++ +      +   ++K+    CF   +++ +L +   F   NW++I+FI KIGD++ GW LG++ + T+++P E   +  +P   Y+  +LL  LL+++   +A+ YF
Sbjct:   11 RPVVIFLMAVVAVGIVIMVSISVVQHKPLPQKYKYGIVLDAGSSHTSVFIYKWPAEKENNTGMVQQHHTCNVKGKGISSYFDKPHGAGASLEECMK-EAKEKIPAHRHSETPVYLGATAGMRLLKMEDEMASEKVLTSVAHSLKTYPF----SYQGARILSGQEEGAFGWITVNYLSENL-----RKPAGTLGALDLGGASTQITFV---PQQIIESSDNSIDFRLYGNDYHLYTHSFLCYGKDQALKLAMAEKLRSTPDKTDAILLRDPCFHPGYNTTKTLESV-NTPCMKPLKMPKEQFSH-----------------VGLGNWSQCQESIRKVFNTSHCPYSGCSFNGVFQPTVEGKFGAFSAFFFVMDFLNLTNDSLD--KTKQRLAMYCSTPWQKIVQDHPKVKEKYLSEYCFSATYILTLLEHGYNFTSDNWNDIKFIKKIGDSDAGWTLGYMLNLTNMIPAEDPDKPLMPHGGYVTFMLLFSLLILVLIIMAYIYF 480          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Zebrafish
Match: entpd2a.2 (ectonucleoside triphosphate diphosphohydrolase 2a, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-040724-67])

HSP 1 Score: 258.07 bits (658), Expect = 2.419e-78
Identity = 159/464 (34.27%), Postives = 241/464 (51.94%), Query Frame = 3
Query:  465 IVAFFLSLCGIIALIT-IYVINLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPG-ISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKK------IVKKPNVIGALDMGGASTQITFI-DNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEK-----NENLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKE 1811
            I   F+S  GI+ L+         +   Y +++DAGS+ + +++Y W ++K      V Q + C+   G ISS+      +   ++ C+D K    IP   ++ T VYLGATAGMR+L+++ P  S +++  + + L   P     S    +I+TG  EG YGW TVN+LL+N  K       I    + +GALD GGASTQITF+   +  N  + +KL+LYG  Y IY+HS+LCYG+ QA  R LA LI+ +   T+I +PC     S +     +F+ PCV  +            P D LQI      KGT NY  C   V  LF+ S C++  C F+GV+QP I+G F AFSA+  I   L +          D E     + N+   +  + F   G+    +  C D V M  +LIN  GF++ ++ +I F +K+ D +VGW LG++   +++L  E
Sbjct:    9 IAGLFVSFVGILLLVVNTEDFKEPAQLMYGIVLDAGSSHTSMFIYKWPADKQNGTGIVSQHSECRVKGGGISSYAGIKGAAARSLEECMD-KATKSIPKSRQRITPVYLGATAGMRLLNISKPKESAEVLKEVGEKLKSYPF----SFKGASILTGQDEGAYGWITVNYLLENFIKYGFVGQWITPGRDTVGALDFGGASTQITFVTKQTVENKDDLMKLRLYGRDYQIYTHSFLCYGQDQALLRLLAHLIKTQGSDTSIVHPCYPADYSSSIKLSSVFDTPCVKRQTPYK--------PDDELQI------KGTGNYNQCLGNVSQLFSFSSCSYSKCSFDGVFQPNITGNFMAFSAFYYIHQFLQKAAGITITSPADLEHAAQFVCNMSFQQMQNKFPTEGDH--LRDYCADSVLMRVLLINGYGFSDLSFPHISFQEKVEDTSVGWSLGYMLSLSNLLDAE 451          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Zebrafish
Match: entpd2a.1 (ectonucleoside triphosphate diphosphohydrolase 2a, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040724-187])

HSP 1 Score: 259.225 bits (661), Expect = 3.293e-78
Identity = 171/499 (34.27%), Postives = 255/499 (51.10%), Query Frame = 3
Query:  462 AIVAFFLSLCGIIALITIYV-INLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPG-ISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKK------IVKKPNVIGALDMGGASTQITFI-DNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKN--ENLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWR--CFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIE---------NYLFGILLAVLLVIMCFAV 1889
            A  A FL++ GI+ L+     I  S  F Y +++DAGS+ + +++Y W ++K      V Q + C A  G ISS+      +   +K C+D K +  IP    K T VYLGATAGMR+L+++ P  S +++  + + L   P     S    +I+TG +EG YGW TVN+LL+N  K       I    + +GALD GGASTQITF+   +  N  + +KL+LYG  Y IY+HS+LCYG+ Q   R LA LI I+   T+I +PC     S +     +F+ PCV  + + +        P   LQI      KGT NY  C   V  LF+ S C++  C F+GV+QP I+G F AFSA+    + L E    +       +   + +CN           +D  ++ +  C   VF+  +L+N   FN+  +  I F  K GD +VGW LG++   +++LP E   L             +LF ILL   L+ +  A+
Sbjct:   15 ATGALFLAVGGILLLVLPSEDIKGSPGFMYGIVLDAGSSHTSMFIYKWPADKQNGTGIVSQHSECHAKGGGISSYAGVKGGAARSLKECMD-KAMREIPTVRYKHTPVYLGATAGMRLLNISKPKESAEVLKEVEEKLKSYPF----SFKGASILTGQEEGAYGWITVNYLLENYIKYGFVGQWITPGRDTVGALDFGGASTQITFVTKQTVENKDDLMKLRLYGRDYQIYTHSFLCYGRDQVLLRLLAHLITIQGSDTSIIHPCYPADYSSSIKLSSVFDTPCVEKQTSYN--------PDGELQI------KGTGNYNQCLGNVSQLFSFSSCSYSKCSFDGVFQPNITGNFMAFSAFFYTHSFLQEATGIKIWTPAHLEDAARVICNMSLQE-MGKKSQDNESRLKDYCAVSVFVRALLVNGYSFNDRTFPQISFQKKAGDTSVGWSLGYMLSLSNLLPAENVALKKSLRSGAWSFLIFLFSILLTSALIFLFRAI 493          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Zebrafish
Match: entpd3 (ectonucleoside triphosphate diphosphohydrolase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-6186])

HSP 1 Score: 245.743 bits (626), Expect = 3.418e-73
Identity = 158/492 (32.11%), Postives = 253/492 (51.42%), Query Frame = 3
Query:  486 LCGIIALITIYVIN------LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPN---KSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIV-------KKPNVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRC-AFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKY-NSTFVLNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHF--LPIENYLFGILLAVLLVIMCFAVAF 1895
            L  I  +I+I V+       +S    Y +++DAGS+ + +YLY W + K  N   V Q   C    PGIS    + +   K++N +K C+   +   IP+     T V+LGATAGMR+L + N   S  ++  +++ L+  P K  N+    +II+G +EGLYGW TVN+L  N  +K +            +G+LD+GGASTQI F  +      + IK+ LYG  Y+IY+HS+LCYGK++AE R LA+L +      N+ +PC     + +  A++IF   C                PS +    ++ITF G SN   C + V+ +F+ + C    +C F+GVYQPP++G F A++ +      L     N   EK+ T MK  C++ + N       +D   K  C+   ++  +L +   FN  NW N+EF  ++ + ++ W LG++   ++++P E     LPI N LF  LL +  V+    + +
Sbjct:   14 LASIAVIISIAVVQTQKKTYVSRGLKYGIVLDAGSSRTTVYLYEWPAEKENNTGVVSQTTKCLVKGPGISDLGLDGDQDQKTWNSLKECMKN-MTEAIPSHQHNSTPVFLGATAGMRLLHMTNEGRSNDVLTQMKNYLSSLPFKFQNA----SIISGQEEGLYGWITVNYLKGNFLEKNLWNAWVHPHGAKTVGSLDLGGASTQIAFATSDDAKGEDIIKVSLYGYEYNIYTHSFLCYGKNEAEKRVLAKLAKEPINWANVKHPCFPTGYNTSIPAEEIFGSECTKNNV-----------PSRY-DPKRSITFFGQSNPEQCKALVRSIFDLTSCQGTENCSFDGVYQPPLNGDFTAYAGFYWTALALKVNGSN-SMEKFNTNMKLFCSNDWKNLKQNYENKDSHLKSFCYSANYVHTILADGYKFNTDNWENLEFSKEVNNTSIAWSLGYMLALSNMIPAEGKIIKLPINNVLFTGLLLLFSVLTIITLTY 487          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Xenopus
Match: n4bp2l1 (NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc:XB-GENE-1001194])

HSP 1 Score: 269.24 bits (687), Expect = 2.109e-81
Identity = 169/533 (31.71%), Postives = 275/533 (51.59%), Query Frame = 3
Query:  384 PDMEN-------NSEYHTEYRTKNYQTLMW-KPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADP-GISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKI--------VKKPNVIGALDMGGASTQITFIDNSPNNWTE-TIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNIS-NPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTF--VLNGEDKWTKWRCFDIVFMIQML-INLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENY--------LFGILLAVLLVIMCF 1883
            PD+E          E+  ++ +   Q   W K + I    L + G+I+L+ I V+    L     Y +++DAGS+ + +Y+Y W + K  +   V Q+  CK +  GISS+   P K+   ++ C++ K   +IP + +++T VYLGATAGMR+L L N   +++++  + ++L   P     +     IITG +EG YGW T+N+LL N  +           K     GALD+GGASTQITF         E ++  +LYG SY IY+HS+LCYGK QA    +A    I++ T +I  +PC +          D+++ PC+             IP +        +  +GT NY  C   VQ +FN++ C +  C FNGV+QP + G FGAFSAY  +   LN  NE +  +K K  ++  C+  ++         ++K+    CF   +++ +L    GF+  NW++I F+ KI D++ GW LG++ + T+++P E  + P  ++         F ILL V +++ C+
Sbjct:   12 PDLETLLLWGRLKLEFFCDFESAAKQKKTWHKKVIIFLGALFVLGVISLVAIAVVQNKPLPKNIKYGIVLDAGSSHTSVYIYEWPAEKENDTGVVQQINECKVEGNGISSYGHEPLKAGLSLQKCMN-KARQVIPEKQQRETPVYLGATAGMRLLRLTNATMAEEVLSSVENTLRSFPFDFQGA----RIITGQEEGAYGWITINYLLGNFIQDSGWFKYIPNFKPTETSGALDLGGASTQITFESKREIESQENSLHFRLYGKSYDIYTHSFLCYGKDQALRLQIAN--SIKDATDSILLDPCFNSGYRRNASTNDLYSSPCI---------SKLRIPTAP-----STLDIRGTGNYQLCKRNVQAIFNRTHCTYSHCSFNGVFQPSLDGTFGAFSAYYFVMNFLNLTNEQMSLDKVKETVERHCSRPWDEVKKDFPKIKEKYLSEYCFSGTYILNLLEYGYGFSSENWNDIRFLGKIKDSDAGWTLGYMLNLTNMIPAELPYSPPLSHAGYTGLMVFFSILL-VCIILTCW 522          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Xenopus
Match: n4bp2l1 (NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc:XB-GENE-1001194])

HSP 1 Score: 266.159 bits (679), Expect = 1.556e-80
Identity = 163/502 (32.47%), Postives = 264/502 (52.59%), Query Frame = 3
Query:  453 KPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADP-GISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKI--------VKKPNVIGALDMGGASTQITFIDNSPNNWTE-TIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNIS-NPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTF--VLNGEDKWTKWRCFDIVFMIQML-INLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENY--------LFGILLAVLLVIMCF 1883
            K + I    L + G+I+L+ I V+    L     Y +++DAGS+ + +Y+Y W + K  +   V Q+  CK +  GISS+   P K+   ++ C++ K   +IP + +++T VYLGATAGMR+L L N   +++++  + ++L   P     +     IITG +EG YGW T+N+LL N  +           K     GALD+GGASTQITF         E ++  +LYG SY IY+HS+LCYGK QA    +A    I++ T +I  +PC +          D+++ PC+             IP +        +  +GT NY  C   VQ +FN++ C +  C FNGV+QP + G FGAFSAY  +   LN  NE +  +K K  ++  C+  ++         ++K+    CF   +++ +L    GF+  NW++I F+ KI D++ GW LG++ + T+++P E  + P  ++         F ILL V +++ C+
Sbjct:   13 KKVIIFLGALFVLGVISLVAIAVVQNKPLPKNIKYGIVLDAGSSHTSVYIYEWPAEKENDTGVVQQINECKVEGNGISSYGHEPLKAGLSLQKCMN-KARQVIPEKQQRETPVYLGATAGMRLLRLTNATMAEEVLSSVENTLRSFPFDFQGA----RIITGQEEGAYGWITINYLLGNFIQDSGWFKYIPNFKPTETSGALDLGGASTQITFESKREIESQENSLHFRLYGKSYDIYTHSFLCYGKDQALRLQIAN--SIKDATDSILLDPCFNSGYRRNASTNDLYSSPCI---------SKLRIPTAP-----STLDIRGTGNYQLCKRNVQAIFNRTHCTYSHCSFNGVFQPSLDGTFGAFSAYYFVMNFLNLTNEQMSLDKVKETVERHCSRPWDEVKKDFPKIKEKYLSEYCFSGTYILNLLEYGYGFSSENWNDIRFLGKIKDSDAGWTLGYMLNLTNMIPAELPYSPPLSHAGYTGLMVFFSILL-VCIILTCW 492          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Xenopus
Match: n4bp2l1 (NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc:XB-GENE-1001194])

HSP 1 Score: 266.159 bits (679), Expect = 1.747e-80
Identity = 165/508 (32.48%), Postives = 266/508 (52.36%), Query Frame = 3
Query:  438 QTLMW-KPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADP-GISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKI--------VKKPNVIGALDMGGASTQITFIDNSPNNWTE-TIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNIS-NPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTF--VLNGEDKWTKWRCFDIVFMIQML-INLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENY--------LFGILLAVLLVIMCF 1883
            Q   W K + I    L + G+I+L+ I V+    L     Y +++DAGS+ + +Y+Y W + K  +   V Q+  CK +  GISS+   P K+   ++ C++ K   +IP + +++T VYLGATAGMR+L L N   +++++  + ++L   P     +     IITG +EG YGW T+N+LL N  +           K     GALD+GGASTQITF         E ++  +LYG SY IY+HS+LCYGK QA    +A    I++ T +I  +PC +          D+++ PC+             IP +        +  +GT NY  C   VQ +FN++ C +  C FNGV+QP + G FGAFSAY  +   LN  NE +  +K K  ++  C+  ++         ++K+    CF   +++ +L    GF+  NW++I F+ KI D++ GW LG++ + T+++P E  + P  ++         F ILL V +++ C+
Sbjct:    9 QKKTWHKKVIIFLGALFVLGVISLVAIAVVQNKPLPKNIKYGIVLDAGSSHTSVYIYEWPAEKENDTGVVQQINECKVEGNGISSYGHEPLKAGLSLQKCMN-KARQVIPEKQQRETPVYLGATAGMRLLRLTNATMAEEVLSSVENTLRSFPFDFQGA----RIITGQEEGAYGWITINYLLGNFIQDSGWFKYIPNFKPTETSGALDLGGASTQITFESKREIESQENSLHFRLYGKSYDIYTHSFLCYGKDQALRLQIAN--SIKDATDSILLDPCFNSGYRRNASTNDLYSSPCI---------SKLRIPTAP-----STLDIRGTGNYQLCKRNVQAIFNRTHCTYSHCSFNGVFQPSLDGTFGAFSAYYFVMNFLNLTNEQMSLDKVKETVERHCSRPWDEVKKDFPKIKEKYLSEYCFSGTYILNLLEYGYGFSSENWNDIRFLGKIKDSDAGWTLGYMLNLTNMIPAELPYSPPLSHAGYTGLMVFFSILL-VCIILTCW 494          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Xenopus
Match: pgrmc1 (progesterone receptor membrane component 1 [Source:Xenbase;Acc:XB-GENE-6082492])

HSP 1 Score: 239.195 bits (609), Expect = 1.671e-70
Identity = 154/483 (31.88%), Postives = 240/483 (49.69%), Query Frame = 3
Query:  525 NLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKN-LPKKIVK---KPN---VIGALDMGGASTQITFI-DNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRC-AFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNS--TFVLNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHF--LPIENYLFGILLAVLLVI--MCFAVAFTYFFCVTNR 1922
            +LS    Y +++DAGS+ + IY+Y W + K  N   V Q   C     GISS+   P K+   I +C+  K+  +IPA     T  YLGATAGMR+L L N +A+Q ++  I D     P     +     IITG +EG+YGW TVN+L+ N L K I +   +P+     GALD+GGASTQI+F+ + S  N   T+++ LYG  Y++Y+ S+ CYG+ +AE R LA L +         NPC      +    +  F   C   +F   +Y    +           ITFKGT +   C+  V  LFN + C     C F+G+YQP + G F AF+ +    + LN         ++   M + C  ++      +   ++ + +  CF   F+  +L++   F+   W  I F  ++G++++GW LG++   T+++P E+    LP+   LF  LL +   I  +C  V    F C   +
Sbjct:   36 SLSPGLKYGIVLDAGSSRTTIYVYQWPAEKENNTGVVDQTLKCNVKGRGISSYANEPKKAPTYIDDCIK-KVKEVIPASQHNSTPAYLGATAGMRLLRLKNESAAQGVLASIHDYFQTQPFAFRGA----NIITGQEEGMYGWITVNYLMGNFLEKNIWRAWVRPDGAETTGALDLGGASTQISFLPEKSEQNPNSTVEVTLYGYLYNVYTQSFQCYGRDEAEKRLLASLAQDPKLKF-YENPCYPRNYMVNLTMEHTFGSLCT-AQFRPANYDPSRV-----------ITFKGTGDPVLCSQKVSTLFNFAACQGKEDCSFDGIYQPKVKGNFSAFAGFYYTTSALNLTGY-FQLNQFNLSMTSFCAKEWTQLPQILHRFDETYARSYCFSANFIYYLLVHGYKFDSETWLQINFQKEVGNSSIGWSLGYMLTLTNMIPAERRLIILPMSLSLFAGLLCLFTAISALCLIVLVILFVCARKK 499          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Xenopus
Match: pgrmc1 (progesterone receptor membrane component 1 [Source:Xenbase;Acc:XB-GENE-6082492])

HSP 1 Score: 237.654 bits (605), Expect = 2.822e-70
Identity = 152/476 (31.93%), Postives = 237/476 (49.79%), Query Frame = 3
Query:  546 YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKN-LPKKIVK---KPN---VIGALDMGGASTQITFI-DNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRC-AFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNS--TFVLNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHF--LPIENYLFGILLAVLLVI--MCFAVAFTYFFCVTNR 1922
            Y +++DAGS+ + IY+Y W + K  N   V Q   C     GISS+   P K+   I +C+  K+  +IPA     T  YLGATAGMR+L L N +A+Q ++  I D     P     +     IITG +EG+YGW TVN+L+ N L K I +   +P+     GALD+GGASTQI+F+ + S  N   T+++ LYG  Y++Y+ S+ CYG+ +AE R LA L +         NPC      +    +  F   C   +F   +Y    +           ITFKGT +   C+  V  LFN + C     C F+G+YQP + G F AF+ +    + LN         ++   M + C  ++      +   ++ + +  CF   F+  +L++   F+   W  I F  ++G++++GW LG++   T+++P E+    LP+   LF  LL +   I  +C  V    F C   +
Sbjct:    5 YGIVLDAGSSRTTIYVYQWPAEKENNTGVVDQTLKCNVKGRGISSYANEPKKAPTYIDDCIK-KVKEVIPASQHNSTPAYLGATAGMRLLRLKNESAAQGVLASIHDYFQTQPFAFRGA----NIITGQEEGMYGWITVNYLMGNFLEKNIWRAWVRPDGAETTGALDLGGASTQISFLPEKSEQNPNSTVEVTLYGYLYNVYTQSFQCYGRDEAEKRLLASLAQDPKLKF-YENPCYPRNYMVNLTMEHTFGSLCT-AQFRPANYDPSRV-----------ITFKGTGDPVLCSQKVSTLFNFAACQGKEDCSFDGIYQPKVKGNFSAFAGFYYTTSALNLTGY-FQLNQFNLSMTSFCAKEWTQLPQILHRFDETYARSYCFSANFIYYLLVHGYKFDSETWLQINFQKEVGNSSIGWSLGYMLTLTNMIPAERRLIILPMSLSLFAGLLCLFTAISALCLIVLVILFVCARKK 461          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Mouse
Match: Entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:MGI Symbol;Acc:MGI:102805])

HSP 1 Score: 274.248 bits (700), Expect = 1.921e-83
Identity = 169/538 (31.41%), Postives = 273/538 (50.74%), Query Frame = 3
Query:  387 DMENNSEYHTEYRTKNYQTLMW----------KPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIV--------KKPNVIGALDMGGASTQITFIDN-----SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNE--KNENLDFEKYKTRMKNLCNSKYNSTFVL--NGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAVAFTYFF 1907
            D+E   E  TE +TK ++   +          K + I+  F S+  +IALI + +     L     Y +++DAGS+ + +Y+Y W + K  +   V Q+  C+   PGIS +    ++    +  C++     LIP     +T VYLGATAGMR+L + +  ++ +++  +  SL   P     +     IITG +EG YGW T+N+LL    ++          +K    GALD+GGASTQITF+       SP N   +++ +LYG  Y++Y+HS+LCYGK QA ++ LA+ I++ +    + +PC +          +++  PC   +F       E   P D  +I      +GT +Y  C+ ++  LFN S C +  C FNGV+ PP+ G FGAFSA+  +     +  KN  +  EK     KN C+  +  T     + ++K+    CF   +++ +L    F +S+W  I F+ KI D+N GW LG++ + T+++P EQ   P   +   I L VL  ++  AVA T  F
Sbjct:   12 DLEELDEVITERKTKRHKLRSYQDSKVKRFCSKNILIILGFTSILAVIALIAVGLTQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELST-ELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGA----KIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPEN---SLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGV-LKDPCFNPGYEKVVNVSELYGTPCTK-RF-------EKKLPFDQFRI------QGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYIGLMVLFSLLLVAVAITGLF 526          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Mouse
Match: Entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:MGI Symbol;Acc:MGI:102805])

HSP 1 Score: 269.24 bits (687), Expect = 7.316e-82
Identity = 162/506 (32.02%), Postives = 261/506 (51.58%), Query Frame = 3
Query:  453 KPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIV--------KKPNVIGALDMGGASTQITFIDN-----SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNE--KNENLDFEKYKTRMKNLCNSKYNSTFVL--NGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAVAFTYFF 1907
            K + I+  F S+  +IALI + +     L     Y +++DAGS+ + +Y+Y W + K  +   V Q+  C+   PGIS +    ++    +  C++     LIP     +T VYLGATAGMR+L + +  ++ +++  +  SL   P     +     IITG +EG YGW T+N+LL    ++          +K    GALD+GGASTQITF+       SP N   +++ +LYG  Y++Y+HS+LCYGK QA ++ LA+ I++ +    + +PC +          +++  PC   +F       E   P D  +I      +GT +Y  C+ ++  LFN S C +  C FNGV+ PP+ G FGAFSA+  +     +  KN  +  EK     KN C+  +  T     + ++K+    CF   +++ +L    F +S+W  I F+ KI D+N GW LG++ + T+++P EQ   P   +   I L VL  ++  AVA T  F
Sbjct:   15 KNILIILGFTSILAVIALIAVGLTQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELST-ELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGA----KIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPEN---SLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGV-LKDPCFNPGYEKVVNVSELYGTPCTK-RF-------EKKLPFDQFRI------QGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYIGLMVLFSLLLVAVAITGLF 497          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Mouse
Match: Entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:MGI Symbol;Acc:MGI:1919340])

HSP 1 Score: 247.284 bits (630), Expect = 1.186e-73
Identity = 150/504 (29.76%), Postives = 262/504 (51.98%), Query Frame = 3
Query:  477 FLSLCGIIA--------LITIYVIN--LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKK------IVKKPNVIGALDMGGASTQITFIDNSP-NNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIE--IENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRC-AFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFV-LNGEDKWTKWRCFDIVFMIQMLI-NLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQ--HFLPIENYLF--GILLAVLLVIMCFAVAFTYFF 1907
            F++L G+ A        LI +  IN  L +   + ++ DAGS+ + +++Y W +NK  +   V Q   C+ + PGISS+ ++P ++   +K+CL+ + + LIP     +T  +LG+TAGMR+LS  N + ++ I+  +  +L+KSP+    +     I+ G  EG +GW T+N++L  L K       + ++  ++GALD+GGASTQI+F+   P  + +  +  +LYG +YS+Y+HSYLC+G+ Q   R LA+L +  + +    + +PC             +++ PC+    +L+H               QN+T +GT +   C   ++ LFN S C     C FNG+YQPP+ G+F AFS +      LN  +           +   C   +    V   G+++W +  C   ++++ +L+    F+E  W NI+F  + GD ++GW LGF+ + T ++P E   H+      ++  G++ AVL ++     A    F
Sbjct:   10 FMALLGVAAASGLTMLVLILVKAINVLLPADTKFGIVFDAGSSHTSLFVYQWPANKEKDTGVVSQALTCQIEGPGISSYTSDPTQAGESLKSCLE-EALALIPQAQHPETPTFLGSTAGMRLLSQKNSSQARDILAAVSQTLSKSPVDFWGA----KILAGQDEGAFGWITINYVLGMLLKYSSGQWILPEEGMLVGALDLGGASTQISFVPQGPILDQSTQVTFRLYGANYSVYTHSYLCFGRDQILNRLLAKLAQDRLSSQVAPVRHPCYHSGYQAILPLSSLYDSPCIHTTDSLNH--------------TQNLTVEGTGDPGNCVVALRSLFNFSSCKGQKDCAFNGIYQPPVHGQFYAFSNFYYTFHFLNLTSRQ-SLNTVNDTVWKFCQKPWKLVEVSYPGQERWLRDYCASGLYILVLLLEGYKFSEETWPNIQFQKQAGDTDIGWTLGFMLNLTGMIPAEAPTHWRAQSYSIWTAGVVFAVLTLVAILGAAAIQIF 493          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Mouse
Match: Entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:MGI Symbol;Acc:MGI:1919340])

HSP 1 Score: 247.284 bits (630), Expect = 1.186e-73
Identity = 150/504 (29.76%), Postives = 262/504 (51.98%), Query Frame = 3
Query:  477 FLSLCGIIA--------LITIYVIN--LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKK------IVKKPNVIGALDMGGASTQITFIDNSP-NNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIE--IENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRC-AFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFV-LNGEDKWTKWRCFDIVFMIQMLI-NLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQ--HFLPIENYLF--GILLAVLLVIMCFAVAFTYFF 1907
            F++L G+ A        LI +  IN  L +   + ++ DAGS+ + +++Y W +NK  +   V Q   C+ + PGISS+ ++P ++   +K+CL+ + + LIP     +T  +LG+TAGMR+LS  N + ++ I+  +  +L+KSP+    +     I+ G  EG +GW T+N++L  L K       + ++  ++GALD+GGASTQI+F+   P  + +  +  +LYG +YS+Y+HSYLC+G+ Q   R LA+L +  + +    + +PC             +++ PC+    +L+H               QN+T +GT +   C   ++ LFN S C     C FNG+YQPP+ G+F AFS +      LN  +           +   C   +    V   G+++W +  C   ++++ +L+    F+E  W NI+F  + GD ++GW LGF+ + T ++P E   H+      ++  G++ AVL ++     A    F
Sbjct:   10 FMALLGVAAASGLTMLVLILVKAINVLLPADTKFGIVFDAGSSHTSLFVYQWPANKEKDTGVVSQALTCQIEGPGISSYTSDPTQAGESLKSCLE-EALALIPQAQHPETPTFLGSTAGMRLLSQKNSSQARDILAAVSQTLSKSPVDFWGA----KILAGQDEGAFGWITINYVLGMLLKYSSGQWILPEEGMLVGALDLGGASTQISFVPQGPILDQSTQVTFRLYGANYSVYTHSYLCFGRDQILNRLLAKLAQDRLSSQVAPVRHPCYHSGYQAILPLSSLYDSPCIHTTDSLNH--------------TQNLTVEGTGDPGNCVVALRSLFNFSSCKGQKDCAFNGIYQPPVHGQFYAFSNFYYTFHFLNLTSRQ-SLNTVNDTVWKFCQKPWKLVEVSYPGQERWLRDYCASGLYILVLLLEGYKFSEETWPNIQFQKQAGDTDIGWTLGFMLNLTGMIPAEAPTHWRAQSYSIWTAGVVFAVLTLVAILGAAAIQIF 493          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Mouse
Match: Entpd2 (ectonucleoside triphosphate diphosphohydrolase 2 [Source:MGI Symbol;Acc:MGI:1096863])

HSP 1 Score: 241.506 bits (615), Expect = 1.594e-71
Identity = 136/439 (30.98%), Postives = 231/439 (52.62%), Query Frame = 3
Query:  546 YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKA-DPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKN------LPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTE-TIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAY----NLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFD---IVFMIQMLINLG--FNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKE 1811
            Y +++DAGS+ + +++Y W ++K  +   V Q + C     GISS+  +P+++   +  CL+ + +  +P +    T +YLGATAGMR+L+L +P A+ +++  +  +LT+ P     +     I++G  EG++GW T N+LL+N      + + I  +   +GA+D+GGASTQITF   SP+   +  + L+LYG  Y +Y+HS+LCYG+ Q   R LA  ++I  F     +PC  +  S     ++++  PC MG+                   +  ++  GTSN   C   V  LFN S C F  C FNGV+QPP++G F AFSA+    + +KT++      L  ++ +   +  CN  +     L       + R  D   +   I  L++ G  F+E ++  + F  K  D  VGW LG++ + T+++P +
Sbjct:   40 YGIVLDAGSSHTSMFVYKWPADKENDTGIVGQHSSCDVRGGGISSYANDPSRAGQSLVECLE-QALRDVPKDRYASTPLYLGATAGMRLLNLTSPEATAKVLEAVTQTLTRYPFDFRGA----RILSGQDEGVFGWVTANYLLENFIKYGWVGRWIRPRKGTLGAMDLGGASTQITFETTSPSEDPDNEVHLRLYGQHYRVYTHSFLCYGRDQVLQRLLASALQIHRF-----HPCWPKGYSTQVLLREVYQSPCTMGQRPQT------------FNSSATVSLSGTSNAALCRDLVSGLFNISSCPFSQCSFNGVFQPPVAGNFIAFSAFYYTVDFLKTVMGLPVGTL--KQLEDATETTCNQTWAE---LQARVPGQQTRLPDYCAVAMFIHQLLSRGYRFDERSFRGVVFEKKAADTAVGWALGYMLNLTNLIPAD 451          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. UniProt/SwissProt
Match: sp|P55772|ENTP1_MOUSE (Ectonucleoside triphosphate diphosphohydrolase 1 OS=Mus musculus OX=10090 GN=Entpd1 PE=1 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 5.117e-81
Identity = 162/506 (32.02%), Postives = 261/506 (51.58%), Query Frame = 3
Query:  453 KPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIV--------KKPNVIGALDMGGASTQITFIDN-----SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNE--KNENLDFEKYKTRMKNLCNSKYNSTFVL--NGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAVAFTYFF 1907
            K + I+  F S+  +IALI + +     L     Y +++DAGS+ + +Y+Y W + K  +   V Q+  C+   PGIS +    ++    +  C++     LIP     +T VYLGATAGMR+L + +  ++ +++  +  SL   P     +     IITG +EG YGW T+N+LL    ++          +K    GALD+GGASTQITF+       SP N   +++ +LYG  Y++Y+HS+LCYGK QA ++ LA+ I++ +    + +PC +          +++  PC   +F       E   P D  +I      +GT +Y  C+ ++  LFN S C +  C FNGV+ PP+ G FGAFSA+  +     +  KN  +  EK     KN C+  +  T     + ++K+    CF   +++ +L    F +S+W  I F+ KI D+N GW LG++ + T+++P EQ   P   +   I L VL  ++  AVA T  F
Sbjct:   15 KNILIILGFTSILAVIALIAVGLTQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELST-ELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGA----KIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPEN---SLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGV-LKDPCFNPGYEKVVNVSELYGTPCTK-RF-------EKKLPFDQFRI------QGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYIGLMVLFSLLLVAVAITGLF 497          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. UniProt/SwissProt
Match: sp|P49961|ENTP1_HUMAN (Ectonucleoside triphosphate diphosphohydrolase 1 OS=Homo sapiens OX=9606 GN=ENTPD1 PE=1 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 8.356e-79
Identity = 157/512 (30.66%), Postives = 260/512 (50.78%), Query Frame = 3
Query:  423 RTKNYQTLMWKPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKI---------VKKPNVIGALDMGGASTQITFIDN-----SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNS--TFVLNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHF-LPIENYLFGILLAVLLVIMCFAVA 1892
            +  N +T   K +  +  F S+  +IAL+ + +     L     Y +++DAGS+ + +Y+Y W + K  +   V QV  C+   PGIS F    N+    + +C++ +   +IP    ++T VYLGATAGMR+L + +   + +++  +  SL+  P     +     IITG +EG YGW T+N+LL    +K                 GALD+GGASTQ+TF+       SP+N    ++ +LYG  Y++Y+HS+LCYGK QA ++ LA+ I++ +    + +PC            D++  PC   +F +       +P        Q    +G  NY  C+ ++  LFN S C +  C FNG++ PP+ G FGAFSA+  +   LN  +E +  EK    MK  C   +    T     ++K+    CF   +++ +L+    F   +W +I FI KI  ++ GW LG++ + T+++P EQ    P+ +  + + L VL  ++ F VA
Sbjct:    5 KESNVKTFCSKNILAILGFSSIIAVIALLAVGLTQNKALPENVKYGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCME-RAREVIPRSQHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPFDFQGA----RIITGQEEGAYGWITINYLLGKFSQKTRWFSIVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDN---ALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKDIQVAS-NEILRDPCFHPGYKKVVNVSDLYKTPCTK-RFEM------TLP-------FQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGDFGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPLSTPLSHSTY-VFLMVLFSLVLFTVA 492          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. UniProt/SwissProt
Match: sp|A0JND9|ENTP8_BOVIN (Ectonucleoside triphosphate diphosphohydrolase 8 OS=Bos taurus OX=9913 GN=ENTPD8 PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 5.414e-76
Identity = 158/508 (31.10%), Postives = 261/508 (51.38%), Query Frame = 3
Query:  444 LMWKPLAIVAFF--LSLCGIIALITIYVINLSSIFT----YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVK----KP---NVIGALDMGGASTQITFIDNSP-NNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRC-AFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNE------NLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLI-NLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYL--FGILLA-VLLVIMCFAV 1889
            L WK     A     ++ G+ AL+ + V  ++ +      + ++ DAGS+ + +++Y W +NK  +   V Q   C+A+ PGISS+ +NP +    ++ CL+ + + LIP     +T ++LGATAGMR+LS  N + ++ +   +  +L +SP+    +     ++TG  EG +GW T+N++L  L K        +P    ++GALDMGGASTQITF+   P  + T     +LYG  +++Y+HSYLC+G+ QA  R LAEL++       I +PC       T     ++  PC               PP     ++QN+T +GT N   C   ++ LFN S C     C F GVYQPP+ G+F AFS +      LN  ++      N    ++  R   L  +         G+D+W +  C   ++++ +L+   GF+E  W  IEF  + G A++GW LG++ + T+++P E    P + +   FG+  A V+ V++  A 
Sbjct:    3 LTWKQRVFTALLGAAAVSGLTALLLVLVGTMNVLLPPDTKFGIVFDAGSSHTSLFVYQWPANKENDTGIVSQALACQAEGPGISSYASNPARVGESLQGCLE-EALALIPKAKHHETPMFLGATAGMRLLSRKNRSQAEDVFAAVSRALGQSPVDFRGA----ELLTGQDEGAFGWITINYILGLLVKYSFSGEWIRPLEETLVGALDMGGASTQITFVPGGPILDKTAQATFRLYGADHTVYTHSYLCFGRDQALSRVLAELVQASTGLL-IRHPCYHSGYRGTLALASLYESPCA-----------PAAPP----DLSQNLTVEGTGNPGACVEALRKLFNFSSCDGREDCAFAGVYQPPVQGQFYAFSNFYYTFNFLNLTSKPSLSGANATIWEFCLRPWKLVEASAPP-----GQDRWLRDYCASGLYILTLLVEGYGFSEETWGGIEFRQQAGGADIGWTLGYMLNLTNLIPAEA---PAQGWAQSFGVWAAGVVFVVLTLAA 481          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. UniProt/SwissProt
Match: sp|O93295|ENTP8_CHICK (Ectonucleoside triphosphate diphosphohydrolase 8 OS=Gallus gallus OX=9031 GN=ENTPD8 PE=1 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 1.366e-74
Identity = 165/506 (32.61%), Postives = 265/506 (52.37%), Query Frame = 3
Query:  444 LMWKPLAIVAFFLSLC--GIIALITIYVINLSSIF-----TYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPK-------KIVKKPNVIGALDMGGASTQITFIDN-SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYN---STFVLNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKE--QHFLPIENYLF-GILLAVLLVIMCFAVA 1892
            + +K   +     + C   IIALI +  +++  +F      Y ++ DAGST + +Y+Y W ++K      V QV  C  +  GISS+  +P  +   +K CLD K + +IP E + +T  YLGATAGMR+L   N   ++Q+   +  ++ + P+    +     I+TG +EG +GW TVN+LL+ L K       +  +   V+GALD+GGASTQITF    +  +   ++  +LYG +YS+Y+HSYLCYG+ QA  R +A L +  ++  NIS+PC  +         +I++ PCV              P    L   Q +T  GT N   C + +  LFN +  A  +C F+GVYQPP+ G+F AF+ +    + LN   +          + + CN  ++    TF  N E   T   C   ++++ +L++   F+E  WSNI F  K G+A++GW LGF+ + T+++P E  +H    E  L+ G +  ++L I+   VA
Sbjct:    1 MEYKGKVVAGLLTATCVFSIIALI-LSAVDVKDVFLPPGTKYGLVFDAGSTHTALYVYQWPADKENGTGIVSQVESCTVNGSGISSYADDPAGAGASLKPCLD-KAMAVIPVEQQWQTPTYLGATAGMRLLREQNSTKAEQVFAEVSKAIREFPVDFRGA----QILTGNEEGSFGWITVNYLLETLIKFSFAGKWEHPQNTEVLGALDLGGASTQITFQPGVTIEDKNTSVLFRLYGTNYSLYTHSYLCYGQIQASKRLMAALHQDGSYVQNISHPCYPKGYRRIITIAEIYDSPCV--------------PTPSMLSPAQILTVTGTGNPAACPTAILKLFNLTCGANRTCGFDGVYQPPVRGQFFAFAGFYYTFSFLNLTGQQ-SLSHVNATVWDFCNKNWSELVETFPQNKEHLHT--YCVVGLYILTLLVDGYKFDEHTWSNIHFSQKAGNADIGWTLGFMLNLTNMIPTEALEHVKGHEPSLWAGAISFIVLAIVAGLVA 483          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. UniProt/SwissProt
Match: sp|Q5DRK1|ENTP8_RAT (Ectonucleoside triphosphate diphosphohydrolase 8 OS=Rattus norvegicus OX=10116 GN=Entpd8 PE=1 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.406e-73
Identity = 151/496 (30.44%), Postives = 253/496 (51.01%), Query Frame = 3
Query:  492 GIIALITIYV----INLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKK------IVKKPNVIGALDMGGASTQITFIDNSP-NNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRC-AFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNE------NLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLI-NLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQ----HFLPIENYLFGILLAVLLVIMCFAVAFTYFF 1907
            G+  LI I V    + L +   + ++ DAGS+ + +++Y W +NK  +   V Q   C+ + PGISS+ ++P ++   +K+CL  + + LIP      T  +LGATAGMR+LS  N + +Q I+  +  +L+++P+    +     I+ G  EG +GW TVN++L  L K       + +   ++GALD+GGASTQI+F+   P  + +  +  +LYG +YS+Y+HSYLC+G+ Q   R LAEL++       + +PC       T     +++ PCV    +L++               QN+T +G  N   C + ++ LFN S C     C FNGVYQPP+ G+F AFS +      LN  +       N    K+  +   L    Y       G+++W +  C   ++++ +L+    F+E  W NI+F  + G  ++GW LGF+ + T ++P E            ++ G++ AVL ++     A    F
Sbjct:   21 GLTMLILILVKATNVLLPADTKFGILFDAGSSHTSLFVYQWPANKEKDTGVVSQALACQVEGPGISSYTSDPTQAGESLKSCLQ-EALALIPQTQHPVTPAFLGATAGMRLLSQKNSSQAQDILAAVSQTLSRAPVDFWGA----RILAGQDEGAFGWITVNYVLGMLLKYSSGQWILPEDGTLVGALDLGGASTQISFVPQGPILDQSTQVTFRLYGANYSVYTHSYLCFGRDQILRRLLAELVQSSQ-VARVRHPCYHSGYQATLSLASLYDSPCVHTPDSLNY--------------TQNLTVEGIGNPGNCVAALRGLFNFSSCKGQEDCAFNGVYQPPVHGQFYAFSNFYYTFQFLNLTSRQPLNIVNDTIWKFCQKPWRLVEDSY------PGQERWLRDYCASGLYILVLLLEGYKFSEETWPNIQFQKQAGGTDIGWTLGFMLNLTGMIPAEALTQWRAQSYSIWIAGVVFAVLTLVAILGAAAVQLF 490          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. TrEMBL
Match: A0A5K3EYZ3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 2.000e-87
Identity = 171/478 (35.77%), Postives = 257/478 (53.77%), Query Frame = 3
Query:  495 IIALITIYVINLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPN---VIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILN--EKNENLDFEKYKTRMKNLCNSKYNSTF--VLNGEDKWTKWRCFDIVFMIQMLINLGFNES-NWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPI-------ENYLFGILLAVLLVIMCF 1883
            II L+ +Y++  +  + Y+V+IDAGSTSSKI ++ W    + +N  V +V M K  PGISS+  +P +++N +K  L   +   +P E +K T ++L ATAGMR++ L+NP  +  IM  +R  L     KVNN  SDI I++G  EG+  W TVN+L K      V   +   +IGALD+GGAS QITF+  +P+    T    L+G+ Y +YS+S+LCYGKS ++ R  AE+I  ++ T  I+NPC  +   +     +IF  PCV  K+A++  G E+IP +    + + IT  GT +   C   VQ +F    CA   C F GVY+PP+ GKF AFS Y  +   LN   K +NL  +  K ++   C   +            ++    C D V++  +L N GF +S +W NI F  KI    V W  G++ D T ++  E   + +          +  I+   LLVI+ F
Sbjct:   29 IITLVALYIVACNVGYLYAVLIDAGSTSSKISVFKWRDWPFQHNGRVEEVYMKKVAPGISSYKDHPEEAFNTLKPTLLDLLQEYVPQESKKSTRLFLAATAGMRLVELDNPLKADAIMENLRSQLPHVGAKVNNPYSDIRIMSGRDEGINAWITVNYLEKKFGVHGVAPSSGQEMIGALDLGGASAQITFVPKNPSLAPHTSTRYLFGSEYYVYSYSHLCYGKSASQKRVWAEIIGNQS-TATINNPCFLQNYELKVKKSEIFTEPCVKSKYAVELIGSELIPNT---ALPEEITLVGTGDPDQCRQFVQKMFPSKACAQSPCMFQGVYRPPLHGKFSAFSGYAFVIDHLNFPTKGQNLTRDAVKAKVDEFCRRDWTQVAQEYPASSLEFIAGYCQDGVYIDALLSNYGFVDSESWKNIVFASKIAGTTVSWAPGYLIDATGMIDSESPKIDLGLTAFVTSVVILSIVFVALLVILVF 502          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. TrEMBL
Match: A0A0X3P931 (Ectonucleoside triphosphate diphosphohydrolase 1 (Fragment) OS=Schistocephalus solidus OX=70667 GN=ENTP1 PE=3 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 3.358e-87
Identity = 178/483 (36.85%), Postives = 267/483 (55.28%), Query Frame = 3
Query:  480 LSLCGIIALITIYVINLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPN----VIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIP-PSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSA-YNLIKTILNEKNENLDFEKYKTRMKNLCNSKYN--STFVLNGEDKWTKWRCFDIVFMIQMLINLGFNE-SNWSNIEFIDKIGDANVGWGLGFIFDKT----SILPK----EQHFLPIENYLFGILLAVLLVIM 1877
            L L  II L+ +YVI + + + Y+++IDAGSTSSK+ +  W    + +N    ++A+ K  PGIS+   NP +++  +K  L   +   +P + +K   +YLGATAGMR+L+L +P  +  I+  +R +L    L V+N  SDI II+G  EG+Y W TVN+L K L  +  K P+    ++GALD+GGASTQI+F+    N    T    L+GN+Y++YS+S+LCYGKS  + R  AE+I  ++    I+NPC+ +   +T     IF  PCV+ KFA   +G E+IP P+    + + ITF GT   T C   VQ LF    C    C FNGVYQPP  G F AF+  Y +I  +     + L  ++ KT++   C S +N  ST     E       CFD  ++  +L   GF    +W  IEF+ K+   +V W LG++ D +    S+ PK    +  F+     L  + LA+L +I+
Sbjct:   44 LILAIIIVLVVLYVIAIHTGYAYAIMIDAGSTSSKVSVMRWRDWPFRSNGYTEELAITKFAPGISAAKDNPQEAFYTLKPYLTKILDEHVPKDKQKSAVLYLGATAGMRLLNLESPLNADAIIDDLRRTLRNFGLTVSNPYSDIRIISGNDEGIYAWITVNYLSKKLGDENGKNPDPPDQMMGALDLGGASTQISFVPERDNAELYTGSHYLFGNTYNVYSYSFLCYGKSTGQNRIWAEIIGQQS-DKRINNPCLLKNYELTVKKSQIFTEPCVISKFAKAIFGSELIPNPA----LAETITFIGTGEPTQCRKIVQRLFPSKHCTTEPCSFNGVYQPPPKGNFFAFAGFYFVINFLFPSIGKGLTRDQVKTKVDEFCASDWNTESTKYPAAEHANIAGYCFDGAYIDVLLDGYGFKTNQDWQKIEFVSKVAGTSVSWALGYVIDASGMIQSLAPKIDLGQAAFIGSVTVLSIVFLALLGIII 521          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. TrEMBL
Match: A0A5N5MKI6 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00036200 PE=4 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 2.870e-85
Identity = 166/486 (34.16%), Postives = 259/486 (53.29%), Query Frame = 3
Query:  492 GIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTE-TIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTN---ISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGE--DKWTKWRCFDIVFMIQML-INLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENY--LFGILLAVLLVIMCFAVAFTYFFC 1910
            GII ++ I V+    L   + Y +++DAGS+ + +Y+Y W + K  N   V Q   C     GISS+   P+K+   +K C+D +    IP +   +T VYLGATAGMR+L ++N NAS++++ F+  SL   P     S     IITG +EG +GW TVN+L  N      K    +GALD+GGASTQITF+       ++ +I  +LYG  Y +Y+HS+LCYGK Q     L + I+ +   T+   + +PC     ++T   + +F+ PCV    + +                QN+   G  N+  C   ++++FN + C +  C FN V+QPP+ GKFGAFSAY  +   LN     L  E+ K ++   C + +N+    + E  +K+    CF   ++I +L     F   NW+NIEFI KIG++ VGW LG++ + T+++P E    P+  Y     ++  + L+I+ F +    FFC
Sbjct:   28 GIIIMVAIAVVQHKPLHQKYKYGIVLDAGSSHTSVYIYEWPAEKENNTGMVQQKHACNVKGKGISSYSETPHKAGESLKECMD-EAKETIPKQRHHETPVYLGATAGMRLLKMDNNNASEKVLEFVEKSLQTYPF----SYQGARIITGQEEGAFGWVTVNYLSDNF----RKASGTVGALDLGGASTQITFVSGQQLESSDNSIDFRLYGKDYHLYTHSFLCYGKDQVLKLSLEKQIQPKRTMTDNIILEDPCFHPGYNVTKSFQRVFDSPCVKTVRSFER--------------QQNLIHIGIGNWNKCQEAIRNVFNTTYCPYSRCSFNKVFQPPLEGKFGAFSAYFFVMNFLNLTTNRL--EEAKEKLATYCTTPWNTLKKKHPEVKEKYLAEYCFSGTYIITLLEEGYNFTSDNWANIEFIKKIGESEVGWTLGYMLNLTNMIPAEAPDTPLLPYGGYVTLMFFLSLLIIVFVILGCIFFC 488          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. TrEMBL
Match: A0A3B4DBU0 (Ectonucleoside triphosphate diphosphohydrolase 1 OS=Pygocentrus nattereri OX=42514 PE=3 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.693e-83
Identity = 182/513 (35.48%), Postives = 269/513 (52.44%), Query Frame = 3
Query:  405 EYHTEYRTKNYQTLMWKPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDN----SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIEN--FTTNIS--NPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQN-ITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFV--LNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAVAF 1895
            +   E +TKN     W  + I  FF++  GIIA++ + V+    L   + Y +++DAGS+ + +Y+Y W + K  N   V Q   C     GISS+   P K+   +K C+D K    IP     +T VYLGATAGMR+L + N  AS++++  +   L   P     S     IITG +EG +GW TVN+L   L     K    +GALD+GGASTQITF+      SP+N   +I  +LYGN Y +Y+HS+LCYGK Q     LA  I+  N   T NI+  +PC  +    T   +D+FN PCV G                 L++ QN     G  +   C++ V+ +FN SRC   +C FNGV+QPP+ GKFGAFSA+  +   LN  +  LD    K ++   C + +N+      N ++K+    CF   +++ +L +   F   NW +IEFI +IGD++ GW LG++ + T+++P E    P   Y   + L VLL +M   +  
Sbjct:    2 DVQPEMKTKNPWHRPWI-ICISVFFVA--GIIAMVVVAVVQNKPLHQKYKYGIVLDAGSSHTSLYIYQWPAEKENNTGMVQQKLACNVKGKGISSYSPEPKKAGESLKECMD-KARDTIPNHRHHETPVYLGATAGMRLLKMENDTASEKVLESVEQFLQTYPF----SYQGARIITGQEEGAFGWITVNYLNDYL----RKASGTLGALDLGGASTQITFVSGQNLESPDN---SIDFRLYGNDYQLYTHSFLCYGKDQVLKLSLANEIQSTNQQLTDNITLQDPCFHKGYKATKTFEDVFNSPCVRG-----------------LRLTQNKFVHVGLGDGEACHAAVRKVFNDSRCTHSTCSFNGVFQPPVEGKFGAFSAFYFVMNFLNLTSYPLDVA--KEQLARYCATPWNTIIQNHPNVKEKYLSEYCFSGTYILTLLEDGYNFTSKNWKDIEFIKQIGDSDAGWTLGYMLNLTNMIPAEVPDTPPLPYGGYVTLMVLLSLMILVLGL 480          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. TrEMBL
Match: A0A553Q691 (Uncharacterized protein OS=Danionella translucida OX=623744 GN=DNTS_016100 PE=3 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 5.842e-83
Identity = 164/500 (32.80%), Postives = 271/500 (54.20%), Query Frame = 3
Query:  453 KPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKP-NVIGALDMGGASTQITFIDNSP-NNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTN---ISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNG---EDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQ---HFLPIENYLFGILLAVLLVIMCFAVAFTYF 1904
            +P+ IV       GII +++I V+    L   + Y +++DAGS+ + +++Y W + K  N   V Q+  C     GISS+  NPN +   ++ C+D +    IPA    +T VYLGATAGMR+L + +  AS++++  +  SL   P     S     I++G +EG +GW TVN+L +NL     +KP   +GALD+GGASTQITF+      ++  +I  +LYGN Y +Y+HS+LCYGK Q     + E +      T+   + +PC     +++   + +F+ PC M    +                N+  T  GT N+  C  +++ +FN S C + SC FNGV+ P + G FGAFSA+  +   LN  N++  F+K K ++   C++ +    V N    ++K+    CF   +++ +L +   F   NW++I+FI KIGD++ GW LG++ + T+++P E      +P   Y+  +LL  LL+++   +A+ YF
Sbjct:   49 RPVVIVLVAFIAVGIITMVSISVVQHKPLPQKYKYGIVLDAGSSHTSVFIYQWPAEKENNTGMVQQLHTCNVKGKGISSYSANPNGAGTSLQECMD-EAKQKIPAHRHSETPVYLGATAGMRLLKMEDDPASEKVLVSVERSLKTYPF----SYQGARILSGQEEGAFGWITVNYLNENL-----RKPTGTLGALDLGGASTQITFVPQQEIESYDNSIDFRLYGNDYQLYTHSFLCYGKDQVLKLSMGEKLRSTPDKTHHIELKDPCFHPGYNLSKTVQSVFDTPC-MQTVNMQ---------------NETFTHVGTGNWVQCQESIRKVFNTSHCPYSSCSFNGVFLPSVDGNFGAFSAFYFVMDFLNLTNDS--FDKTKQKLMTYCSTPWKK-IVENHPRIKEKYLSEYCFAGTYILTLLEDGYKFTPENWNDIKFIKKIGDSDAGWTLGYMLNLTNMIPAEDPDTPLMPHGGYVTFMLLFSLLIVVLLLMAYMYF 519          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Cavefish
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:103029336])

HSP 1 Score: 268.47 bits (685), Expect = 9.928e-82
Identity = 161/489 (32.92%), Postives = 258/489 (52.76%), Query Frame = 3
Query:  453 KPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADP-GISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFI----DNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTN---ISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYN--STFVLNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIM 1877
            +P  I    L + GI++++ I V+    L   + Y +++DAGS+ + +Y+Y W + K  N   V Q+  C     GIS + T PN++ + +K+C+D K   +IP     +T VYLGATAGMR+L + N  AS++++  +   L   P     S     II+G +EG +GW TVN+L ++L     +    +GALD+GGASTQITF+      SP+N   +I  +LYG+ Y +Y+HS+LCYGK Q     LA  I   +  T    + +PC      +    + +FN PCV G    +                +N    G+ N T C++ V+ +FN S C++  C FNG++QP + G+FGAFSA+  +   LN    +LD  + K  +   C + +        N ++K+    CF   +++ +L +   F   NW +I+FI KIG+++ GW LG++ + T+++P E    P   Y   + L VL  +M
Sbjct:   15 RPRIIFITVLFVIGIVSMVAIGVVQNKPLHQKYKYGIVLDAGSSHTSVYIYQWPAEKENNTGMVQQMDACNVPGVGISGYSTEPNRAGDSLKSCMD-KARSIIPNHRHPETPVYLGATAGMRLLEMKNAAASEKVLESVERVLQTYPF----SYQGARIISGQEEGAFGWITVNYLNESL----RQASGTLGALDLGGASTQITFVSGQKQESPDN---SIDFRLYGHDYHVYTHSFLCYGKDQVLKLSLANEIRPVHTKTETIVVEDPCFHPGYRMNKNFQSVFNSPCVTGLSYPE----------------KNFVHMGSGNGTKCHAAVRKVFNDSGCSYSICSFNGIFQPRVEGQFGAFSAFFFVMDFLNLTTLSLD--EAKEELGKYCATPWEIIKQNHPNVKEKYLAEYCFSGTYILTLLEDGYNFTSHNWQDIKFIKKIGNSDAGWTLGYMLNLTNMIPAESPDTPPLPYGGYVTLMVLFAVM 473          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Cavefish
Match: entpd3 (ectonucleoside triphosphate diphosphohydrolase 3 [Source:NCBI gene;Acc:103030351])

HSP 1 Score: 248.825 bits (634), Expect = 3.097e-74
Identity = 159/479 (33.19%), Postives = 248/479 (51.77%), Query Frame = 3
Query:  528 LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIV-------KKPNVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRC-AFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGE--DKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHF--LPIENYLFGILL----AVLLVIMCFAVAFTYFFC 1910
            LS    Y +++DAGS+ + +YLY W + K  N   V Q   C    PGIS      + S+  +K C+D  I   +P      T ++LGATAGMR+L + N  AS  I+  I+  L   P    N+    +II+G +EGLYGW TVN+L+ N  +K +            +G+LD+GGASTQI F         + I++ LYG  Y++Y+HS+LCYGK++AE + LAEL++     + +++PC     SIT  A +IF+  C            +  P S      +NITF G S+   C   V+ +F+   C    +C F GVYQPP+SG+F A++ +      L+ K  N   +++ T M + C SK  +T   N E  +K  K  C+   ++  +L +   FN+ NW N+ F  ++   ++ W LG++  +++++P E     LPI N  F  LL    A+ ++ + F +     FC
Sbjct:   55 LSPGLKYGIVLDAGSSRTTVYLYQWPAEKENNTGVVSQTTKCLVKGPGISEM---NDDSWKYLKTCMD-DITKHVPPSQHSSTPIFLGATAGMRLLHIKNEEASNTILQDIQKYLRSLPFNFQNA----SIISGQEEGLYGWITVNYLMGNFLEKNMWNAWVHPHGAKTVGSLDLGGASTQIAFTAPDDATGEDLIRVSLYGYEYNVYTHSFLCYGKNEAEKKVLAELVKSSTDWSRVNHPCYPADYSITMAASEIFDSECT----------KKSTPAS--YSPAKNITFFGGSDPVRCKDLVKRIFDFKSCQGKENCSFEGVYQPPVSGEFMAYAGFYYTAWALDVKGSN-TLKQFNTAMLSFC-SKPWATLKKNYEITEKHLKSYCYSANYVHTILADGYKFNDDNWENLNFQKEVNQTSIAWSLGYMLAQSNMIPAEAKLLKLPIPNSAFAGLLFVFSALTIITLMFLIITLVRFC 511          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Cavefish
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:103029336])

HSP 1 Score: 240.736 bits (613), Expect = 8.808e-72
Identity = 146/445 (32.81%), Postives = 233/445 (52.36%), Query Frame = 3
Query:  453 KPLAIVAFFLSLCGIIALITIYVIN---LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADP-GISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFI----DNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTN---ISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYN--STFVLNGEDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDKI 1745
            +P  I    L + GI++++ I V+    L   + Y +++DAGS+ + +Y+Y W + K  N   V Q+  C     GIS + T PN++ + +K+C+D K   +IP     +T VYLGATAGMR+L + N  AS++++  +   L   P     S     II+G +EG +GW TVN+L ++L     +    +GALD+GGASTQITF+      SP+N   +I  +LYG+ Y +Y+HS+LCYGK Q     LA  I   +  T    + +PC      +    + +FN PCV G    +                +N    G+ N T C++ V+ +FN S C++  C FNG++QP + G+FGAFSA+  +   LN    +LD  + K  +   C + +        N ++K+    CF   +++ +L +   F   NW +I+FI K+
Sbjct:   15 RPRIIFITVLFVIGIVSMVAIGVVQNKPLHQKYKYGIVLDAGSSHTSVYIYQWPAEKENNTGMVQQMDACNVPGVGISGYSTEPNRAGDSLKSCMD-KARSIIPNHRHPETPVYLGATAGMRLLEMKNAAASEKVLESVERVLQTYPF----SYQGARIISGQEEGAFGWITVNYLNESL----RQASGTLGALDLGGASTQITFVSGQKQESPDN---SIDFRLYGHDYHVYTHSFLCYGKDQVLKLSLANEIRPVHTKTETIVVEDPCFHPGYRMNKNFQSVFNSPCVTGLSYPE----------------KNFVHMGSGNGTKCHAAVRKVFNDSGCSYSICSFNGIFQPRVEGQFGAFSAFFFVMDFLNLTTLSLD--EAKEELGKYCATPWEIIKQNHPNVKEKYLAEYCFSGTYILTLLEDGYNFTSHNWQDIKFIKKV 429          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Cavefish
Match: entpd2a.1 (ectonucleoside triphosphate diphosphohydrolase 2 [Source:NCBI gene;Acc:103024136])

HSP 1 Score: 239.195 bits (609), Expect = 1.287e-70
Identity = 149/474 (31.43%), Postives = 235/474 (49.58%), Query Frame = 3
Query:  540 FTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPG-ISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKK------IVKKPNVIGALDMGGASTQITF-IDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNE------KNENLDFEKYKTRMKNLCNSKYNSTF--VLNGEDKWTKWRCFDIVFM-IQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIE---------NYLFGILLAVLLVIMCF 1883
            + Y +++DAGS+ + +++Y W +NK      V Q + C  D G ISS+      +   ++ C+D   I  IP     +T +YLGATAGMR+L+++ P  S +I+  + + L   P  V  +     I+TG +EG YGW TVN+LL+N  K       +      +GALD GGASTQITF       N    +KL+LYG  Y IY+ S+LCYG+ Q   + LA L+E +     I +PC     +++    ++F+ PC                PS +    + +  +G+ NY +C   + H+F+   C +  C FNGV+QP +SG F AF+A+  I + L         + +L  E   T    +CN  ++     V   + +   + C   VFM + +L   GF+  ++  I F  K G+ +VGW LG++   +S+LP E   L             +LF + L + LV +C 
Sbjct:   40 YMYGIVLDAGSSHTAMFIYKWPANKQNGTGIVSQHSECDVDGGGISSYAGQKGGAARSLEKCMD-HAIQKIPKVRHHQTPIYLGATAGMRLLNISQPKVSDEILKEVGEKLKTYPFSVKGA----TILTGQEEGAYGWVTVNYLLENFIKYGFVGHWLSPGKKTVGALDFGGASTQITFETKEKVENVENLMKLRLYGRDYHIYTQSFLCYGRDQMLRKLLAHLVETQGSNDAIIHPCYPADYNVSITLDNVFDTPCTADS-----------KPSPY-NAGKKLQIQGSGNYQHCLGNMSHIFSFQTCTYSKCSFNGVFQPNVSGNFMAFAAFFYIHSFLKSTTGITVTSPSLLEEAAIT----VCNMSFHEMLQKVPEQQSRLQDY-CAATVFMKVLLLKGYGFDRLSFPQISFQKKAGETSVGWALGYMLSLSSLLPAESVSLRKALSPGAWNTLIFLFSVALFIALVSVCL 491          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Cavefish
Match: entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:ZFIN;Acc:ZDB-GENE-040724-142])

HSP 1 Score: 219.935 bits (559), Expect = 1.355e-63
Identity = 154/512 (30.08%), Postives = 251/512 (49.02%), Query Frame = 3
Query:  444 LMWKPLAI-VAFFLSLCGIIALITIYVINLSSI-----FTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMC--KADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIV-------KKPNVIGALDMGGASTQITFI-DNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFG-SCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFV----LNGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFL--PIEN---------YLFGILLA-VLLVIMC 1880
            L  KP+ + VA     C  I  + + + N   +       Y ++ DAGST + ++LY W  NK  N   V Q  MC  K D GISS+ TNP  +   ++ CLD  +   +P + +K T VYLGATAGMR+LSL N   +  I+  +   +   P     +     II+G +EG YGW T+N+LL++  K          K   ++GA+D+GG+STQI+F   ++  + T    L+LYG  Y +Y+HSYLC+GK QA  +  A L +  N +T +++PC     ++T    ++++ PCV           + +P       +  +TF GT +   C S+ +++ N S CA    C FNGVYQPP++G F AFSAY      L          +  + + N CN+ + +       +  +DK         +   + L              ++  + D ++GW LG++ + T+++P E+      +EN          +FG+ L+ ++L+ +C
Sbjct:    4 LQMKPMLLGVALLAVACMSIVALILSLANYQRVEVPYSTQYGIVFDAGSTHTALFLYQWPGNKENNTGVVSQNLMCDVKGD-GISSYVTNPAGAGESLRECLDVALAA-VPKKKQKTTPVYLGATAGMRLLSLQNQTQANIIIAEVSKFIQSYPFDFRGA----TIISGTEEGAYGWITINYLLEDFIKYTFDGKWSHPKAGRILGAMDLGGSSTQISFTPKDAVKDPTSAFNLQLYGQKYQLYTHSYLCFGKDQALRKLQAYLQKTANLST-VNHPCYHTGYNLTITLGNLYDSPCV----------EKPVP----FNPSAKVTFVGTGDSALCLSSFRNVVNLSDCALSPDCGFNGVYQPPVNGDFYAFSAYFYTFDFLGLAPRT-PLPQVLSTIDNFCNTNWTTLLSTYPNVKEKDKQHTHTHTHSLTHCRCL--------------YLYNVSDTDIGWTLGYMLNLTNLIPAERPLAVTGVENKQWAAEVFFIVFGLFLSLIILIALC 479          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008355.1 (pep scaffold:Pmarinus_7.0:GL477173:2090:22790:1 gene:ENSPMAG00000007537.1 transcript:ENSPMAT00000008355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.55 bits (558), Expect = 2.112e-64
Identity = 146/453 (32.23%), Postives = 233/453 (51.43%), Query Frame = 3
Query:  546 YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPG-ISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKK------IVKKPNVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFT-TNISNPCMSETESITYGAKDIFNVPCVMG-KFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCA-FGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNE-NLDFEKYKTRMKNLCNSKYNSTFVLNG-EDKWTKWRCFDIVFMIQMLIN-LGFNESNWSNIEFIDK------IGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFG 1847
            Y V++DAGS+ + +++Y W ++K  +   V QVA    + G ISS+  +P  +   +   L      L+P E   +T + +GATAGMR+L   NP A++++M  ++ +L  +P    ++     I+TG +EG +GW T+N+L  N  ++        +    +GALD+GGASTQI F+  +    + T + +LYG  +++++HSYLCYGK +A  R  A L    + +   ++ PC             +F  PC    K A+   G      S  LQ    +  +G+     C   V  +FN S CA    C F+GVYQPP+SG F AFSA+  +   L  + E N+D+   +  +K  CN  +N     +  E K  K  CF   +++Q+L +   FN S W NI+F+ K      IG+A  GW LG++ ++T+++P E     I    FG
Sbjct:    1 YGVVLDAGSSHTSLFVYQWPADKENDTGVVTQVAHIDVEGGGISSYKDHPEMAGQSLVPSL-FNATKLVPPERHHETPISVGATAGMRLLRKQNPEAAERVMESVKTALRATPFLFCSA----RILTGQEEGAFGWVTINYLQGNFLQRDWLSWVRPRGAKTVGALDLGGASTQIAFVP-AGGALSGTQRFRLYGYDHAVFTHSYLCYGKDEALMRVAATLSRGNSSSDVEVTFPCYHSGFEERLEVGYMFGKPCTAALKPAVGPRGGGGGAGSGPLQ--GRVLLRGSGQADQCAEAVAQIFNYSSCAGRKDCTFDGVYQPPVSGSFMAFSAFYYVMDFLKLRGEGNVDY--IRNVVKRFCNKPWNEVRASSQTEQKHLKSYCFSANYLLQLLFHGYKFNLSTWMNIKFVKKVEGIQAIGEA--GWALGYMLNETNLIPVELAPRAIPEAAFG 441          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003192.1 (pep scaffold:Pmarinus_7.0:GL484058:1986:12022:-1 gene:ENSPMAG00000002913.1 transcript:ENSPMAT00000003192.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.815 bits (486), Expect = 2.859e-55
Identity = 114/361 (31.58%), Postives = 188/361 (52.08%), Query Frame = 3
Query:  459 LAIVAFFLSLCGIIALITIYVINLSSI--FTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSY-----NGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPK-------KIVKKPNVIGALDMGGASTQITFIDNSP-NNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKF 1496
            L + A  L +  I   +T   +  +SI    Y +++DAGS+ + +++Y W + K  +   + Q  +C  D  ++    +   S        ++ C+D K   ++P +    T + LGATAGMR+L +++  A++ ++  +R+ L   P     S  +  II+G +EG YGW T N+ L N  +       +       IGALD+GGASTQITF+   P     +++ ++LYG  Y +YSHSYLCYG+ QA  RFL+ L +       + NPC     S+ Y    I++ PC       ++              NQ++TF+GT+N   C++T+  +FN S C+  +C F+GV+QPP+ G+F
Sbjct:   11 LGVTAIALMVAIIGTGLTGDRLRRASINPMKYGIVLDAGSSHTALFVYEWPAEKQNDTGVIAQRHLCDVDDELAGGGISSYSSSPSGAGESLRACMD-KAKAIVPKDRWADTPLALGATAGMRLLEMSDSVAAKAVLSSVREVLGSYPF----SYREGRIISGQEEGTYGWITANYFLYNFIQFTWLGKWQWTTSTKPIGALDLGGASTQITFMTEEPLQGSPDSLTIQLYGRKYHVYSHSYLCYGRDQAIKRFLSTLYKASPGAL-VDNPCYPTLYSVAYNLSFIYDSPCTSDARPANY------------DPNQSVTFRGTANPAECSNTISSIFNFSACSSPNCTFDGVWQPPVRGQF 353          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007714.1 (pep scaffold:Pmarinus_7.0:GL476707:293032:299205:-1 gene:ENSPMAG00000006963.1 transcript:ENSPMAT00000007714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.221 bits (391), Expect = 1.299e-42
Identity = 85/269 (31.60%), Postives = 140/269 (52.04%), Query Frame = 3
Query: 1014 GALDMGGASTQITFIDNSP-NNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLIN----LGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILP 1805
            GALD+GGASTQITF+   P     +++ ++LYG  Y +YSHSYLCYG+ QA  RFL+ L +  +   +++NPC     S+ Y    I++ PC                P+++   NQ++TF+GT+N   C++T+  +FN S C+  +C F+GV+QPP+ G F AFS++       N  N               C   +N   +++         C+      ++L +      +++ +W NI F  + G   +GW LGF+ + T+++P
Sbjct:    1 GALDLGGASTQITFMTEEPLQGSPDSLTIQLYGRKYHVYSHSYLCYGRDQAIKRFLSTLYKKASSGAHVNNPCYPTLYSVAYNLSFIYDSPCTSDA-----------RPANY-DPNQSVTFRGTANPAECSNTISSIFNFSACSSPNCTFDGVWQPPVRGHFLAFSSFYHAMAAFNLTNPKPPLNDATNAFDYYCRKTWNE--LVSRSHPLDSNHCYCYRSTCKLLFSKVSIYNYDKESWENINFQKEAGGGELGWALGFMLNVTNMVP 255          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Sea Lamprey
Match: entpd6 (ectonucleoside triphosphate diphosphohydrolase 6 [Source:ZFIN;Acc:ZDB-GENE-050417-412])

HSP 1 Score: 105.531 bits (262), Expect = 2.017e-24
Identity = 102/424 (24.06%), Postives = 182/424 (42.92%), Query Frame = 3
Query:  546 YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQE-GLYGWTTVNFLLKNLPKKIVKKPN--VIGALDMGGASTQITFIDNSPN-----NWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGT--SNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAY---NLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLI-NLGFNESNWSNIEFIDKIGDANVGWGLG 1775
            Y ++ DAGST ++I+++ ++     N  ++         PG+S++  +P +S   I+  L  K    IP    ++T V L ATAG+R+L     +    ++  +R+   +SP KV    + + I+ GA E G+  W T+NFLL       ++ P   + G LD+GG STQ+TF+          +  +    K++  ++ IYSHSYL  G   A    L           +   P          G + + + PC+      D+ G       +W Q +      G   ++++ C   V+ + +      G     G++Q      F AFS Y    +   ++  +   L    Y+ + K++C+ K      + G D +    C D+ ++   L   LGF+    + ++   KI +    W LG
Sbjct:   63 YGIMFDAGSTGTRIHVFIFKQLNKANLPELTSEVFLSVKPGLSAYADHPEQSVQSIEELL-AKAKKAIPETQWQETPVVLRATAGLRLLPGRKADV---LLEQVRNVFDRSPFKVPK--NSVEIMDGANEGGISSWITINFLL-----GFLRGPEDKLFGILDLGGGSTQVTFLPQKQGLLQSASDADVTSFKMFNKTFKIYSHSYLGLGLMSARLAILG---------GDTGEP----------GGRRLLS-PCL----PSDYKG-------EWKQSSVTYLIGGQKGASFSLCAMKVEKMLSGKVEQPG-----GIHQQ----HFYAFSYYFDRAVESGLIAPEGGTLKVGDYEDKAKSVCDGKQ----AIKGADPFL---CMDLAYIAGFLQKGLGFSRD--TPLQLAKKINNVETAWALG 426          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Yeast
Match: YND1 (Apyrase with wide substrate specificity; helps prevent inhibition of glycosylation by hydrolyzing nucleoside tri- and diphosphates that inhibit glycotransferases; partially redundant with Gda1p; mediates adenovirus E4orf4-induced toxicity [Source:SGD;Acc:S000000807])

HSP 1 Score: 119.398 bits (298), Expect = 1.387e-28
Identity = 132/500 (26.40%), Postives = 216/500 (43.20%), Query Frame = 3
Query:  546 YSVIIDAGSTSSKIYLYYWESNK---YINNADVLQVAMC------------KADPGISSFYTNPNKSYNG-IKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLT---KSPLK--VNNSISDIAIITGAQEGLYGWTTVNFLLKNL----PKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTETIKLK----------LYGN--SYSIYSHSYLCYGKSQAEYRFLAELI----------EIENFTT-NISNPCMSETESITYGAKD-IFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSR-CAFGSCPFNGVYQPPIS---GKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGEDK---------WTKWRCFDIVFMIQMLINLGFN----ESNWSNI------EFIDKIGDANVGWGLGFI--FDKTSILPKEQHFL 1823
            + ++IDAGS+ S+I+++ W+  +   +  N D   +               K +PG+SSF   P  +Y   IK  LD     +IP        V++ ATAGMR+L        Q I   I D L    K P +  V +  + I +I G  EGLYGW  +N+L  +     P+  V      G +DMGGASTQI F   +P++  E  + +          + G+   + ++  ++L +G +QA  R+LA+LI          E ++F+T N+++PCM    S  +  KD IF++                                G+ NY  C  ++  L  K+  C    C FNGV+ P I     KF   S Y      + +     +F+K+   ++  CNS  N T +L   DK         + K  CF   +++ +L + GF+    + +  N+      + ++K+ +  + W LG I  +   SIL     F+
Sbjct:   10 FGIVIDAGSSGSRIHVFKWQDTESLLHATNQDSQSILQSVPHIHQEKDWTFKLNPGLSSFEKKPQDAYKSHIKPLLDF-AKNIIPESHWSSCPVFIQATAGMRLLP-------QDIQSSILDGLCQGLKHPAEFLVEDCSAQIQVIDGETEGLYGWLGLNYLYGHFNDYNPE--VSDHFTFGFMDMGGASTQIAF---APHDSGEIARHRDDIATIFLRSVNGDLQKWDVFVSTWLGFGANQARRRYLAQLINTLPENTNDYENDDFSTRNLNDPCMPRGSSTDFEFKDTIFHI-------------------------------AGSGNYEQCTKSIYPLLLKNMPCDDEPCLFNGVHAPRIDFANDKFIGTSEYWYTANDVFKLGGEYNFDKFSKSLREFCNS--NWTQILANSDKGVYNSIPENFLKDACFKGNWVLNIL-HEGFDMPRIDVDAENVNDRPLFQSVEKVEERELSWTLGRILLYASGSILAGNDDFM 462          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Yeast
Match: GDA1 (Guanosine diphosphatase located in the Golgi; involved in the transport of GDP-mannose into the Golgi lumen, converting GDP to GMP after mannose is transferred to substrates; null mutants are defective in sporulation and pre-meiotic S phase entry; orthologous to human ENTPD6, a meiosis-associated non-obstructive azoospermia (NOA) related gene identified in GWAS studies [Source:SGD;Acc:S000000768])

HSP 1 Score: 106.301 bits (264), Expect = 1.241e-24
Identity = 111/447 (24.83%), Postives = 187/447 (41.83%), Query Frame = 3
Query:  546 YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKS-PLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDNSPNN-----WTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIE-----------IENFTTNISNPCM-----SETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNK-SRCAFGSCPFNGVYQPPISGKFGA------FSA-YNLIKTI-------LNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLG 1775
            Y ++IDAGST S++++Y ++     +   +L       +PG+SSF T+   + N +   L   +   +P + R  T V + ATAG+R+L       S +I+  +RD L K  P  V      ++I+ G +EG++ W T N+LL N+     K P      D+GG STQI F    P N           LK    +Y++Y  S+L YG  +   +  + L+E               T  +S+PC+     +  E +T  +K+ + +              + I P +              +   C      + NK ++C    C FNGV+QP +   F        FS  Y+  + +       LNE N   D  +   + +   NS ++       E +     C D+ F + +L + G++      +    KI +  +GW LG
Sbjct:   93 YVIMIDAGSTGSRVHIYKFDV--CTSPPTLLDEKFDMLEPGLSSFDTDSVGAANSLDPLLKVAMN-YVPIKARSCTPVAVKATAGLRLL---GDAKSSKILSAVRDHLEKDYPFPVVEG-DGVSIMGGDEEGVFAWITTNYLLGNIGANGPKLPTA-AVFDLGGGSTQIVFEPTFPINEKMVDGEHKFDLKFGDENYTLYQFSHLGYGLKEGRNKVNSVLVENALKDGKILKGDNTKTHQLSSPCLPPKVNATNEKVTLESKETYTI--------------DFIGPDE-------------PSGAQCRFLTDEILNKDAQCQSPPCSFNGVHQPSLVRTFKESNDIYIFSYFYDRTRPLGMPLSFTLNELN---DLARIVCKGEETWNSVFSGIAGSLDELESDSHFCLDLSFQVSLL-HTGYDIPLQRELRTGKKIANKEIGWCLG 500          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Nematostella
Match: EDO43911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX67])

HSP 1 Score: 142.51 bits (358), Expect = 6.019e-37
Identity = 134/457 (29.32%), Postives = 207/457 (45.30%), Query Frame = 3
Query:  465 IVAFFLSLCGIIALITIYVINLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCK---ADPGISSFYTNPNKSYNGIKNCLDTKI---IPLIPAEMRKKTFVYLGATAGMRMLSLNNPNAS-QQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTN-ISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFS--AYNLIKTILNEKN-ENLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSIL 1802
            ++  FL  C  +AL++   I  +    Y+V+ DAGS+ ++  +Y     + ++  DV Q+ + K   A PG+SSF  +P     G+   L T I     ++P + + +T VYL ATAGMR+L ++   A   ++  F+RDS  KSP        +  +I+G  E  Y W TVNFL+  L  +        G LDMGGASTQ  F  N  N    T+ L L      +Y+HSYL YG+ +A  RF+  L+         I+NPC +                    +  +D  G E +              +G  N   C+  ++ LF        +CPF+   QP + GKF +FS   Y   +T +  KN E +D E  K +M + C        + N   K+T  RCF + F+  ML + G+   N   +   + I   ++ W LG +     +L
Sbjct:    8 LLLVFLGTC--LALVSARTIPKAK---YAVLFDAGSSGTRCKVYKLIQRQTLHVRDVTQLNVPKPNKAKPGLSSFGESPA----GVGPYLQTLIEGAKKVVPVQYQAQTPVYLFATAGMRLLPVDQKIAVINEVNNFLRDS-KKSPFAFKKG--NAKVISGIDEATYDWVTVNFLMGALTGE---SDTEYGVLDMGGASTQNAFDTN--NTQHITVVLDLTKGMLPLYAHSYLGYGEQEARKRFIRFLVNNRRHNRKVITNPCYNSN---------------FEKRVEVD--GAEYL-------------MRGGFNPQMCHMIIKSLFFCLSSKKDNCPFH--QQPRLKGKFYSFSLFTYAFRETGVVSKNGERIDMETLKRKMLSFCGRDLTEKELAN---KYTTPRCFQLNFIYSMLTD-GYRVDNSFELYNGESINGLDLNWTLGAMLSALKVL 411          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Nematostella
Match: EDO42571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S133])

HSP 1 Score: 104.375 bits (259), Expect = 1.434e-25
Identity = 70/210 (33.33%), Postives = 114/210 (54.29%), Query Frame = 3
Query:  546 YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCK---ADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAE 1166
            Y+V+ DAGS+ ++  +Y  ++   +  +DV Q+ + K   A PG+S F  +P+     ++  +D  I   +P++ + +  VY+ ATAGMR+L  N   A  + +  +  + +KSP        +I +I+G  E +Y W TVNFL+  L  +   +    GAL+MGGAS+Q  F    P N   T  L L   +  +Y+HSYL YG+S+A 
Sbjct:    1 YAVMFDAGSSGTRCKVYKLQTRHSLRISDVSQIKVPKPNKATPGLSFFGDSPSGVGPYLQPLIDAAI-NAVPSQYQSQAPVYVFATAGMRLLPDNKATAVIRAVEQMLSNSSKSPFLFQTG--NIKVISGKDEAIYDWVTVNFLMGVLTGESSTE---YGALEMGGASSQNAF--EVPVNQLHTAILNLRHGTRRLYAHSYLGYGESEAR 202          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Nematostella
Match: EDO31584 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXJ5])

HSP 1 Score: 45.4394 bits (106), Expect = 2.555e-6
Identity = 24/79 (30.38%), Postives = 44/79 (55.70%), Query Frame = 3
Query:  744 LIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKV-NNSISDIAIITGAQEGLYGWTTVNFLLKN 977
            +IP      T V L ATAG+R+L +    +++ +++ + +  + SP  +  +    ++I+ G  EG++ W TVNFL  N
Sbjct:   11 VIPVHQWHATPVALKATAGLRLLPVK---SAKHLLHEVYEVFSASPFNIPAHQPHCVSIMDGLDEGIFAWVTVNFLTGN 86          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 247.284 bits (630), Expect = 9.793e-74
Identity = 146/478 (30.54%), Postives = 250/478 (52.30%), Query Frame = 3
Query:  504 LITIYVINLSSI---FTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCK-ADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDN------SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQ--INQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGED---KWTKWRCFDIVFMIQMLI-NLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAV 1889
            L+T+ VI   +I   + Y +++DAGS+ + +Y+Y W + K  N   V Q   C+ A  GISS+   P K+   + +CL  +    IP +M  +T +YLGATAGMR+L L N +AS ++   +  +L   P     S     ++ G +EG +GW TVN+L   L + +       GALD+GGASTQI+F+ +      SP+N    +  +LYG  Y++Y+HS+LCYGK QA    LA   ++ +  T I +PC  +  + T     +++ PCV                SD     +++     G  N+T C   ++ +FN + C +  C FNG++QPP+ G+FGAFSAY  +   LN  + ++  +    ++ + C + +  T +    D   K+    CF   +++ +++    F    +S+I++I KI +++ GW LG++ + T+++P E    P   Y   + +  ++ I+ F +
Sbjct:   32 LVTVLVIQNRTIAQKYKYGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLK-EAKENIPQKMHPETPLYLGATAGMRLLKLENSSASDEVFKAVEKTLRGFPF----SYQGARLLAGQEEGAFGWVTVNYLDDRLTQGL----ETTGALDLGGASTQISFVSDEYNGSESPDN---AVSFRLYGYDYTLYTHSFLCYGKDQALRLALAHQTKVNSGPTAIMDPCFHKGYNETKHYAAVYDSPCV----------------SDQKPQIVSETFIHLGGGNFTQCQEVIKSVFNFTSCRYSRCSFNGIFQPPLQGQFGAFSAYFFVMNFLNLTDTSVPLKTVMQKLSDYCATPW--TQIKKEHDIPLKYLAEYCFSGTYILTLMMEGYNFTSETYSSIKYIQKIKNSDAGWTLGYMLNLTNMIPAEAPDSPPLTYTSYVSVVTVMAILLFVI 479          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Medaka
Match: entpd2b (ectonucleoside triphosphate diphosphohydrolase 2 [Source:NCBI gene;Acc:101169627])

HSP 1 Score: 244.973 bits (624), Expect = 7.939e-73
Identity = 147/472 (31.14%), Postives = 246/472 (52.12%), Query Frame = 3
Query:  444 LMWKPLAIVAFFLSLCGIIALITIYVINLSSI--FTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKAD-PGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKN------LPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTETI-KLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNE---KNENLDFEKYKTRMKNLCNSKYN--STFVLNGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQ 1814
            L +  +A++ F L    +I L+T+   ++     F Y +++DAGS+ + +++Y W ++K      V Q A C     GISS+     ++   +  CLD + +  IP +  + T VYLGATAGMR+L+++NP  S QI+  + D +   P K   +    AI++G +EG YGW TVN+LL+N      + + +      +GALD+GGASTQITF         + + +++LYG+ YS+Y+HS+LCYG +Q   R LA L++ + +  +++NPC     + T   KD+F+ PC       +H      P          +T KG+ NY  C   + ++F+   C F  C FNG+ QP ++G F AFS +  + + L +   K  N   ++ +   +  C+   +  S  + +    W  +    +     +L    F+ S +  I F  K GD +VGW LG+I + +++LP E+
Sbjct:    7 LSFASIALLVFALV---VILLLTVPTQDVQEAPGFMYGIVLDAGSSHTALFIYRWPADKQNGTGVVTQHAECHVQGEGISSYAGQKGEAGESLVACLD-QAVRDIPKDKHQLTPVYLGATAGMRLLNISNPKQSDQILKEVGDKIKSYPFKFEGA----AILSGQEEGAYGWVTVNYLLENFIKYGFIGRWMSPGRATVGALDLGGASTQITFATQERVEGKQNMMEMRLYGHKYSLYTHSFLCYGINQVYNRMLAHLVKSQGYVQSVTNPCYPPDVNTTLKMKDVFSSPCTE-----EHRPKPYNPEG-------TLTVKGSGNYQQCEENMSNMFSFEDCPFSQCSFNGISQPNVTGNFMAFSTFFYVHSSLRKLTGKPVNTP-QQLQEAAQTTCSMTLSQMSNQIPDQGPHWMNYCTASVFIKTLVLRGYAFDNSTFPQISFQKKAGDTSVGWALGYILNLSNLLPAEK 457          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 234.572 bits (597), Expect = 3.424e-69
Identity = 139/472 (29.45%), Postives = 240/472 (50.85%), Query Frame = 3
Query:  534 SIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCK-ADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPK---------KIVKKPNVIGALDMGGASTQITFIDN------SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGED---KWTKWRCFDIVFMIQMLI-NLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAV 1889
            ++ TY +++DAGS+ + +Y+Y W + K  N   V Q   C+ A  GISS+   P K+   + +CL  +    IP +M  +T +YLGATAGMR+L L N +AS ++   +  +L   P     S     ++ G +EG +GW TVN+L   L +          +    +  GALD+GGASTQI+F+ +      SP+N    +  +LYG  Y++Y+HS+LCYGK QA    L+         T I +PC  +  + T     +++ PCV  +            P     +++     G  N+T C   ++ +FN + C +  C FNG++QPP+ G+FGAFSAY  +   LN  + ++  +    ++ + C + +         D   K+    CF   +++ +++    F    +S+I++I KI +++ GW LG++ + T+++P E    P   Y   + +  ++ I+ F +
Sbjct:   25 TLVTYGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLK-EAKENIPQKMHPETPLYLGATAGMRLLKLENSSASDEVFKAVEKTLRGFPF----SYQGARLLAGQEEGAFGWVTVNYLDDRLTQVSMGGFKYTSVHGNESAKGALDLGGASTQISFVSDEYNGSESPDN---AVSFRLYGYDYTLYTHSFLCYGKDQALRLALSG-------PTAIMDPCFHKGYNETKHYAAVYDSPCVSDQ-----------KPQI---VSETFIHLGGGNFTQCQEVIKSVFNFTSCRYSRCSFNGIFQPPLQGQFGAFSAYFFVMNFLNLTDTSVPLKTVMQKLSDYCATPWTQVCAYFKHDIPLKYLAEYCFSGTYILTLMMEGYNFTSETYSSIKYIQKIKNSDAGWTLGYMLNLTNMIPAEAPDSPPLTYTSYVSVVTVMAILLFVI 467          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 219.164 bits (557), Expect = 6.630e-64
Identity = 133/428 (31.07%), Postives = 224/428 (52.34%), Query Frame = 3
Query:  504 LITIYVINLSSI---FTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCK-ADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDN------SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGED---KWTKWRCFDIVFMIQMLI-NLGFNESNWSNIEFIDKI 1745
            L+T+ VI   +I   + Y +++DAGS+ + +Y+Y W + K  N   V Q   C+ A  GISS+   P K+   + +CL  +    IP +M  +T +YLGATAGMR+L L N +AS ++   +  +L   P     S     ++ G +EG +GW TVN+L   L + +       GALD+GGASTQI+F+ +      SP+N    +  +LYG  Y++Y+HS+LCYGK QA    LA   + ++  T I +PC  +  + T     +++ PCV  +            P     +++     G  N+T C   ++ +FN + C +  C FNG++QPP+ G+FGAFSAY  +   LN  + ++  +    ++ + C + +  T +    D   K+    CF   +++ +++    F    +S+I++I K+
Sbjct:   32 LVTVLVIQNRTIAQKYKYGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLK-EAKENIPQKMHPETPLYLGATAGMRLLKLENSSASDEVFKAVEKTLRGFPF----SYQGARLLAGQEEGAFGWVTVNYLDDRLTQGL----ETTGALDLGGASTQISFVSDEYNGSESPDN---AVSFRLYGYDYTLYTHSFLCYGKDQALRLALAH--QTKSGPTAIMDPCFHKGYNETKHYAAVYDSPCVSDQ-----------KPQI---VSETFIHLGGGNFTQCQEVIKSVFNFTSCRYSRCSFNGIFQPPLQGQFGAFSAYFFVMNFLNLTDTSVPLKTVMQKLSDYCATPW--TQIKKEHDIPLKYLAEYCFSGTYILTLMMEGYNFTSETYSSIKYIQKV 429          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 203.371 bits (516), Expect = 1.234e-57
Identity = 135/475 (28.42%), Postives = 228/475 (48.00%), Query Frame = 3
Query:  546 YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCK-ADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIV------------KKPNVIGALDMGGASTQITFIDN------SPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQ--INQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAF-----SAYNLIKTILNEKNENLDFEK-YKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAV 1889
            Y +++DAGS+ + +Y+Y W + K  N   V Q   C+ A  GISS+   P K+   + +CL  +    IP +M  +T +YLGATAGMR+L L N +AS ++   +  +L   P     +     ++ G +EG +GW TVN+L   L +  +                  GALD+GGASTQI+F+ +      SP+N    +  +LYG  Y++Y+HS+LCYGK QA        + +    T I +PC  +  + T     +++ PCV                SD     +++     G  N+T C   ++ +FN + C +  C FNG++QPP+ G+FG F     +   LI +I    ++ L  +K +   +K L    ++ T++L                   M+    F    +S+I++I K+   + GW LG++ + T+++P E    P   Y   + +  ++ I+ F +
Sbjct:   31 YGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLK-EAKENIPQKMHPETPLYLGATAGMRLLKLENSSASDEVFKAVEKTLRGFPFSYQGA----RLLAGQEEGAFGWVTVNYLDDRLTQVSMGGFKYTSVHGNESGLETTGALDLGGASTQISFVSDEYNGSESPDN---AVSFRLYGYDYTLYTHSFLCYGKDQA--------LRLSG-PTAIMDPCFHKGYNETKHYAAVYDSPCV----------------SDQKPQIVSETFIHLGGGNFTQCQEVIKSVFNFTSCRYSRCSFNGIFQPPLQGQFGTFVLFIYTQRFLIISIHFSPSQRLQIKKEHDIPLKYLAEYCFSGTYILT-----------------LMMEGYNFTSETYSSIKYIQKV-SCDAGWTLGYMLNLTNMIPAEAPDSPPLTYTSYVSVVTVMAILLFVI 454          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Planmine SMEST
Match: SMESG000051033.1 (SMESG000051033.1)

HSP 1 Score: 1234.17 bits (3192), Expect = 0.000e+0
Identity = 601/604 (99.50%), Postives = 603/604 (99.83%), Query Frame = 3
Query:  141 MEKFPIKISFSKSIGEINEKLEIFVYGNELLLSLSKLACTKVGISFQEKYEFINSLKMPFSMLNTIESNNINKDDHLILTDPDMENNSEYHTEYRTKNYQTLMWKPLAIVAFFLSLCGIIALITIYVINLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAVAFTYFFCVTNRQKGLFINHPN 1952
            MEKFPIKISFSKSIGEINEKLEIFVYGNELLLSLSKLACTKVGISFQEKYEFINSLKMPFSMLNTIESNNINKDDHLILTDPDMENNSEYHTEY+TKNYQTLMWKPLAIVAFFLSLCGIIALITIYVINLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIR+SLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPK IVKKPNVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAVAFTYFFCVTNRQKGLFINHPN
Sbjct:    1 MEKFPIKISFSKSIGEINEKLEIFVYGNELLLSLSKLACTKVGISFQEKYEFINSLKMPFSMLNTIESNNINKDDHLILTDPDMENNSEYHTEYKTKNYQTLMWKPLAIVAFFLSLCGIIALITIYVINLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRNSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKNIVKKPNVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAVAFTYFFCVTNRQKGLFINHPN 604          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Planmine SMEST
Match: SMESG000068450.1 (SMESG000068450.1)

HSP 1 Score: 363.999 bits (933), Expect = 8.928e-118
Identity = 198/512 (38.67%), Postives = 297/512 (58.01%), Query Frame = 3
Query:  423 RTKNYQTLMWKPLAIVAFFLSLCGIIALITIYVINLSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIV-----KKPNVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELIE--IENFTTN-----ISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSAY-----NLIKTILNEKNENLDFEKYKTR---MKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHFLPIENYLFGILLAVLLVIMCFAVAFT 1898
            + K+     W  + IV   LS+CGI+ +  ++      +++Y +IIDAGSTS+K++L+ W       N +V QV MCK+ PGIS F  +PN + +GI+ CL+ +++PLIP  +R K+FVYLGATAGMR++   NP A + I   +   L  + LK+ + + D+ II+G+ EG+  W T N+L   L    V      K    GALD+GGASTQITF+ N       T K++LYG +Y++YSHSYLCYGKSQAEYR LA L +  I N+  N     I NPCM + ++ +Y  + I  +PCV G ++  ++G  V  P     I  N+T+ GT++   C   V++LF +S C+  +C FN VYQP I+GKF AF+ +      L+K   +   +N DF   K+R    +N       +T     ++ W KWRCF  +++ ++L   GFN  NW +I F + I +AN+GW LG++ +KTS++P E+  + +    F  +L V LVI+     F 
Sbjct:    6 KLKDIPKPAWYSMTIVFLTLSICGIVIICVLWAFANQLVYSYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIEYRNPKAMRLIFEVVERFLLSTGLKMKDGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNGTIESGNT-KVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQQNFGTSVDLPDSLKNIVLNVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIA-KSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIPIEKPLISMSLGAFVAILIVFLVILSIGCLFA 515          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Planmine SMEST
Match: SMESG000010140.1 (SMESG000010140.1)

HSP 1 Score: 112.464 bits (280), Expect = 7.133e-26
Identity = 111/444 (25.00%), Postives = 188/444 (42.34%), Query Frame = 3
Query:  546 YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPK-KIVKKP--NVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELI------EIENFTTNI-------SNPCMSE-TESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAF-SAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGED-KWTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDKTSILPKEQHF 1820
            + ++IDAGS  ++ YLY W       N +V ++  C  D     ++ N N+    +  C+ + ++ L   + +    +YL ATAGMR+L + N   ++ +   I+         +  +   + I+ G  EG+ GWTTVN+L   + K   V+K   +  G LD+GG+STQI F   + +       + L+   Y +YS SYLCYG +    R+L   +      E+  F           S  C SE +  I       F  P        +     +    D +Q+++ + F   + + Y N+ +   +                   ++GK+ +F  A  L  T           E Y T      ++KY       G+D K+ +  C    F+I +    G N SN+ N+ F +KI   N GW LG++  +T  +P  + F
Sbjct:   94 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVTDKLQILYFQNRNED---LMKCIKSLLLKLRAVKFKPP--IYLAATAGMRILEIENKTLTKVMFNEIKSLF----YVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTVRKDRFSTFGVLDLGGSSTQIAFETKTGD------PVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAAD--CRNQIAKAIGKNVDVIQVDKKMRFVAVAVFAYYNAFLTKYYR------------------MTGKYNSFVQATGLFCT-----------EDYAT-----LDAKY-------GKDAKFAQNYCLVGNFIIVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAF 479          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Planmine SMEST
Match: SMESG000077421.1 (SMESG000077421.1)

HSP 1 Score: 101.293 bits (251), Expect = 1.235e-22
Identity = 106/426 (24.88%), Postives = 189/426 (44.37%), Query Frame = 3
Query:  546 YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIK---NCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFL----AELIEIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPSDWLQINQNITFKGTS-----NYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISGKFGAFSA-YNLIKTILNEKNENLDFEKYK-TRMKNLCNSKYNSTFVLNGEDKWTKWRCFDIVFMIQMLINL-GFNESNWSNIEFIDKIGDANVGWGLGF 1778
            + +++D GST ++  L+++E  +  N  +++      +   +S F ++    +  ++   N L +  +  IP E    T +Y+  TAG+R +   N   S++I+  IRDSL KS  K  +    + I++  +EG + W +VNFLL           + +G LD+GG ST+I F  N  +   ET K  ++G  Y+++S  Y   G       +      E ++ +N    + +PC+                P VM  F   H+G            N +I   GT       Y  C ST  + F + R           Y   I  +F A SA Y++I +++       DF +YK ++++   N +  +   L   D +  ++C D+ F+  +L    GF+  N   ++F  KI + ++ W LG+
Sbjct:   34 FIIVVDGGSTGTR--LHFFEFKQMDNQINLILTDKFSSKVALSKF-SDVRAEWGLMRIMFNNLTSFAMSKIPKECFISTPIYVKVTAGVRQM---NQAVSKKILNHIRDSLIKSQFKFESKF--VGILSTKEEGKFSWISVNFLLGKFQND--NCLDTVGVLDLGGGSTEIAFSTNDDDLIPETTKTVIFGQQYNVFSEGYDKMGMDVMRLEYFNAKHCEGLKCQN--QVMRSPCLH---------------PSVMTNF---HFG------------NMSIQIGGTPIETEMRYLACFSTALYTFREYRKV-------QSYMKHI--EFVAISAFYHIINSVIKSNKSKTDFLEYKVSKIQEEANLRCINP--LKETDNYKHFQCLDMSFIAILLWGFYGFD--NNYKLKFSKKIKNVSLSWALGY 404          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Planmine SMEST
Match: SMESG000072841.1 (SMESG000072841.1)

HSP 1 Score: 102.449 bits (254), Expect = 2.509e-22
Identity = 126/507 (24.85%), Postives = 204/507 (40.24%), Query Frame = 3
Query:  528 LSSIFTYSVIIDAGSTSSKIYLYYWESNKYINNADVLQVA----------MCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNL---------------------PKKIVKKPNVIGALDMGGASTQITF-----IDNSPNNWTETIKLKLYGN----SYSIYSHSYLCYGKSQAEYRFLAELIE---------IENFTTNISNPC-MSETESITYGAKDIFNV----PCVMGKFALDHYGHEVIPPSDWLQINQN-------------------ITFKGTSNYTYCNSTVQHLFNKSRCA-----FGS-CPFNGVYQPPI---SGKFGAFSAY-NLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTF-----VLNGEDKWTKWR--CFDIVFMIQMLIN-LGFNESNWSNIEFIDKIGDANVGWGLG 1775
            + S + Y VIIDAGS+ S++++Y+W  +   N  ++LQ+           + K +PG+SSF   P  + + IK  L+      +P  + K+T  YL ATAGMRM+S     A   I+  IR    K   +   S S   +ITG +EG++GW T N+LL                         ++   +   +G +DMGG S QI +         P + + T  L    N    +Y ++  ++L +G + A  R+   L+           E+      +P  +  T   T  A  +  V    PC+       H G E+   S  ++I  +                     F+GT  Y  C S +  + NK  C       GS C  +G   P I   S +F  FS +    + +L    +   F  +   +++      + TF     +    D W + R  CF   ++  +L   LGF  + +S    + +I  A V W LG
Sbjct:   44 VDSNYNYGVIIDAGSSGSRLFIYFWPPHTG-NGGELLQMKPLLDNKGKPIVKKVNPGLSSFADQPENAISYIKPLLELAASS-VPVSLHKETPFYLMATAGMRMIS---NEAQTAILNNIR-RFVKKKYQFLFSDSHAKVITGQEEGIFGWITTNYLLGRFNHNHSDGVPIIPVPVSDSAFRSEQFHHRKRTVGVVDMGGGSMQIAYELEPNARKDPTDSSVTFNLGCRENDADHTYKVFVTTFLGFGANSARTRYERLLVRDYLRSHVNSSESLPNVTGSPATVPATVPATAPAPVVRTVTIEDPCL-------HRGSEI---SQKVKITNDSQGGLSLSSKQIRKLPTVMAVFRGTGKYHQCESRLATVLNKIPCPSAMPNSGSICTMSGRLHPAIDLASSQFYGFSEFWYSTEDVLGLGGQYNYFRLHSESLEHCGKDWASLTFDYKKGIYKAAD-WPRMRYQCFKSAWITNVLHQGLGFPNA-FSKFISVQEINGAEVQWSLG 532          
The following BLAST results are available for this feature:
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENTPD12.882e-8030.21ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
ENTPD11.006e-7930.37ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
ENTPD11.740e-7930.66ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
ENTPD89.065e-7431.56ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
ENTPD89.065e-7431.56ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mig-236.508e-2023.04Nucleoside-diphosphatase mig-23 [Source:UniProtKB... [more]
uda-13.420e-1921.68Nucleoside-diphosphatase uda-1 [Source:UniProtKB/... [more]
ntp-13.147e-1630.17Nucleoside-triphosphatase ntp-1 [Source:UniProtKB... [more]
ntp-13.147e-1630.17Nucleoside-triphosphatase ntp-1 [Source:UniProtKB... [more]
ntp-13.700e-1630.17Nucleoside-triphosphatase ntp-1 [Source:UniProtKB... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTPase7.078e-2533.86gene:FBgn0024947 transcript:FBtr0332459[more]
NTPase7.132e-2533.86gene:FBgn0024947 transcript:FBtr0077683[more]
NTPase1.774e-2435.09gene:FBgn0024947 transcript:FBtr0332460[more]
NTPase2.206e-735.16gene:FBgn0024947 transcript:FBtr0077680[more]
NTPase2.206e-735.16gene:FBgn0024947 transcript:FBtr0077682[more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
entpd12.304e-7932.41ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd12.583e-7932.41ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd2a.22.419e-7834.27ectonucleoside triphosphate diphosphohydrolase 2a,... [more]
entpd2a.13.293e-7834.27ectonucleoside triphosphate diphosphohydrolase 2a,... [more]
entpd33.418e-7332.11ectonucleoside triphosphate diphosphohydrolase 3 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
n4bp2l12.109e-8131.71NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc... [more]
n4bp2l11.556e-8032.47NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc... [more]
n4bp2l11.747e-8032.48NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc... [more]
pgrmc11.671e-7031.88progesterone receptor membrane component 1 [Source... [more]
pgrmc12.822e-7031.93progesterone receptor membrane component 1 [Source... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Entpd11.921e-8331.41ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
Entpd17.316e-8232.02ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
Entpd81.186e-7329.76ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
Entpd81.186e-7329.76ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
Entpd21.594e-7130.98ectonucleoside triphosphate diphosphohydrolase 2 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P55772|ENTP1_MOUSE5.117e-8132.02Ectonucleoside triphosphate diphosphohydrolase 1 O... [more]
sp|P49961|ENTP1_HUMAN8.356e-7930.66Ectonucleoside triphosphate diphosphohydrolase 1 O... [more]
sp|A0JND9|ENTP8_BOVIN5.414e-7631.10Ectonucleoside triphosphate diphosphohydrolase 8 O... [more]
sp|O93295|ENTP8_CHICK1.366e-7432.61Ectonucleoside triphosphate diphosphohydrolase 8 O... [more]
sp|Q5DRK1|ENTP8_RAT1.406e-7330.44Ectonucleoside triphosphate diphosphohydrolase 8 O... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EYZ32.000e-8735.77Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3P9313.358e-8736.85Ectonucleoside triphosphate diphosphohydrolase 1 (... [more]
A0A5N5MKI62.870e-8534.16Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A3B4DBU01.693e-8335.48Ectonucleoside triphosphate diphosphohydrolase 1 O... [more]
A0A553Q6915.842e-8332.80Uncharacterized protein OS=Danionella translucida ... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
entpd19.928e-8232.92ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd33.097e-7433.19ectonucleoside triphosphate diphosphohydrolase 3 [... [more]
entpd18.808e-7232.81ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd2a.11.287e-7031.43ectonucleoside triphosphate diphosphohydrolase 2 [... [more]
entpd81.355e-6330.08ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008355.12.112e-6432.23pep scaffold:Pmarinus_7.0:GL477173:2090:22790:1 ge... [more]
ENSPMAT00000003192.12.859e-5531.58pep scaffold:Pmarinus_7.0:GL484058:1986:12022:-1 g... [more]
ENSPMAT00000007714.11.299e-4231.60pep scaffold:Pmarinus_7.0:GL476707:293032:299205:-... [more]
entpd62.017e-2424.06ectonucleoside triphosphate diphosphohydrolase 6 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YND11.387e-2826.40Apyrase with wide substrate specificity; helps pre... [more]
GDA11.241e-2424.83Guanosine diphosphatase located in the Golgi; invo... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO439116.019e-3729.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425711.434e-2533.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315842.555e-630.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
entpd19.793e-7430.54ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd2b7.939e-7331.14ectonucleoside triphosphate diphosphohydrolase 2 [... [more]
entpd13.424e-6929.45ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd16.630e-6431.07ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd11.234e-5728.42ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051033.10.000e+099.50SMESG000051033.1[more]
SMESG000068450.18.928e-11838.67SMESG000068450.1[more]
SMESG000010140.17.133e-2625.00SMESG000010140.1[more]
SMESG000077421.11.235e-2224.88SMESG000077421.1[more]
SMESG000072841.12.509e-2224.85SMESG000072841.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012672 ID=SMED30012672|Name=Ectonucleoside triphosphate diphosphohydrolase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2043bp
CAACAATTCATTTCCATAAACACATATTTTACATAAGATTTTTTTATTTT
TTAAATATCCTAAAATCATAAAAAAATTATTGAATTTCCAGTTTTAAACA
TAGTTTTATCATAATTTTATCAATCACCTAAAACAATCCGATGGAAAAAT
TTCCAATAAAAATTTCCTTCAGTAAATCTATTGGTGAAATCAATGAGAAA
TTAGAAATATTTGTTTATGGAAATGAATTGTTGCTTTCACTTTCAAAATT
GGCTTGTACAAAAGTTGGAATAAGTTTTCAGGAGAAATATGAATTTATAA
ATTCTTTAAAAATGCCATTTTCAATGTTGAACACTATTGAAAGTAATAAT
ATCAATAAAGATGATCATTTAATACTTACAGATCCAGATATGGAAAACAA
TAGTGAATATCATACAGAATATAGAACTAAAAACTATCAAACGCTGATGT
GGAAGCCTTTGGCAATAGTTGCATTTTTTCTTTCTTTGTGTGGTATTATT
GCACTAATAACAATTTATGTTATAAATTTATCTTCAATATTTACATACAG
TGTGATTATTGATGCTGGGTCAACCTCTTCTAAGATATATTTATATTACT
GGGAGTCCAATAAATACATAAATAATGCAGACGTTTTGCAGGTGGCAATG
TGTAAAGCTGATCCTGGTATTTCATCGTTTTATACGAATCCAAATAAATC
ATATAATGGAATTAAAAACTGCCTTGATACTAAAATTATACCTTTAATAC
CAGCAGAGATGCGTAAGAAAACCTTTGTTTATCTTGGAGCGACTGCCGGA
ATGAGAATGCTATCGCTGAACAATCCTAACGCATCTCAACAGATAATGTA
TTTCATTAGAGATTCTTTAACAAAATCTCCTTTAAAAGTGAATAATTCCA
TCTCAGATATTGCTATAATTACAGGTGCTCAAGAAGGTCTCTATGGATGG
ACGACAGTAAACTTTTTACTAAAAAATCTACCAAAGAAAATTGTCAAGAA
ACCAAACGTAATTGGTGCCTTGGACATGGGTGGAGCCAGTACACAGATAA
CATTTATTGACAACTCCCCAAATAATTGGACAGAAACCATCAAGTTGAAA
CTTTATGGGAATTCATATTCCATTTACAGTCATAGTTATTTGTGTTATGG
TAAATCTCAAGCGGAATACCGATTTTTAGCAGAATTGATAGAGATTGAAA
ATTTTACTACGAACATTTCGAATCCTTGCATGTCAGAAACGGAGTCAATT
ACATATGGAGCAAAAGATATTTTTAATGTACCATGTGTCATGGGGAAATT
TGCATTAGATCATTACGGCCATGAAGTAATTCCTCCTTCAGATTGGTTGC
AGATAAATCAAAATATAACTTTTAAAGGAACAAGTAATTATACATATTGC
AACTCAACAGTTCAGCATTTATTCAACAAGAGTAGATGCGCATTTGGATC
GTGTCCATTTAATGGAGTCTACCAACCACCAATCTCTGGGAAATTTGGGG
CTTTCTCAGCATACAATTTAATTAAAACAATTTTAAATGAGAAAAACGAA
AATTTGGATTTTGAAAAATATAAAACCAGAATGAAAAACCTATGCAATTC
CAAATACAATAGCACTTTTGTTTTAAATGGCGAGGACAAGTGGACTAAAT
GGAGATGCTTTGATATTGTATTTATGATTCAAATGTTAATTAATTTGGGA
TTTAATGAATCAAATTGGAGCAACATAGAATTTATAGATAAAATTGGTGA
TGCTAATGTTGGATGGGGTCTTGGATTTATTTTTGACAAAACGTCTATTC
TTCCAAAAGAACAACATTTTCTTCCGATTGAAAACTATTTATTCGGAATT
CTCCTAGCGGTCCTATTGGTTATTATGTGTTTTGCCGTTGCCTTTACTTA
TTTCTTTTGTGTAACAAATAGACAAAAAGGGTTGTTTATAAACCATCCTA
ATTTAATCGAGGAAGAGAAATTGCTCACGTAACTGTTATAAATGGGAAAT
ATCTGTAATGAATACTTTCTAGTATACTAAATTTCTATTTGTA
back to top

protein sequence of SMED30012672-orf-1

>SMED30012672-orf-1 ID=SMED30012672-orf-1|Name=SMED30012672-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=614bp
MEKFPIKISFSKSIGEINEKLEIFVYGNELLLSLSKLACTKVGISFQEKY
EFINSLKMPFSMLNTIESNNINKDDHLILTDPDMENNSEYHTEYRTKNYQ
TLMWKPLAIVAFFLSLCGIIALITIYVINLSSIFTYSVIIDAGSTSSKIY
LYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKII
PLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRDSLTKSPLKV
NNSISDIAIITGAQEGLYGWTTVNFLLKNLPKKIVKKPNVIGALDMGGAS
TQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFLAELI
EIENFTTNISNPCMSETESITYGAKDIFNVPCVMGKFALDHYGHEVIPPS
DWLQINQNITFKGTSNYTYCNSTVQHLFNKSRCAFGSCPFNGVYQPPISG
KFGAFSAYNLIKTILNEKNENLDFEKYKTRMKNLCNSKYNSTFVLNGEDK
WTKWRCFDIVFMIQMLINLGFNESNWSNIEFIDKIGDANVGWGLGFIFDK
TSILPKEQHFLPIENYLFGILLAVLLVIMCFAVAFTYFFCVTNRQKGLFI
NHPNLIEEEKLLT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000407GDA1_CD39_NTPase
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 136..547
e-value: 1.3E-103
score: 349.2
NoneNo IPR availableGENE3DG3DSA:3.30.420.150coord: 261..536
e-value: 1.3E-103
score: 349.2
NoneNo IPR availablePANTHERPTHR11782:SF102coord: 97..588
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 569..591
IPR000407Nucleoside phosphatase GDA1/CD39PFAMPF01150GDA1_CD39coord: 135..558
e-value: 2.9E-81
score: 273.3
IPR000407Nucleoside phosphatase GDA1/CD39PANTHERPTHR11782ADENOSINE/GUANOSINE DIPHOSPHATASEcoord: 97..588