SMED30012669

Overview
NameSMED30012669
Smed IDSMED30012669
Length (bp)812
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30012669 (SMED30012669) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30012669 (SMED30012669) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30012669 (SMED30012669) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30012669 (SMED30012669) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012669

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012669SMESG000041196.1 SmedASXL_013575SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30012669SMESG000041196.1 dd_Smed_v6_14097_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30012669SMESG000041196.1 Contig17135newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30012669SMESG000041196.1 Contig17135uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30012669SMESG000041196.1 dd_Smed_v4_14097_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012669 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000032:172237..174470 -3851
Homology
BLAST of SMED30012669 vs. Ensembl Human
Match: LRRC61 (leucine rich repeat containing 61 [Source:HGNC Symbol;Acc:HGNC:21704])

HSP 1 Score: 89.3521 bits (220), Expect = 1.958e-20
Identity = 54/163 (33.13%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFL 599
            LK + GEF LE   ++ L   G  ++G L EC+ +E L LS N L  +       +L VL++S N++  LE +  C +L+ L+  GN +A    ++ L  L  L  LRL + +  L+NP+C   +Y A + ++LP L+ +DGE + G     ++   +L+S L
Sbjct:   21 LKSRTGEFSLESILLLKLRGLGLADLGCLGECLGLEWLDLSGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLRLRDPLARLSNPLCANPSYWAAVRELLPGLKVIDGERVIGRGSEFYQLCRDLDSSL 183          
BLAST of SMED30012669 vs. Ensembl Human
Match: LRRC61 (leucine rich repeat containing 61 [Source:HGNC Symbol;Acc:HGNC:21704])

HSP 1 Score: 89.3521 bits (220), Expect = 1.958e-20
Identity = 54/163 (33.13%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFL 599
            LK + GEF LE   ++ L   G  ++G L EC+ +E L LS N L  +       +L VL++S N++  LE +  C +L+ L+  GN +A    ++ L  L  L  LRL + +  L+NP+C   +Y A + ++LP L+ +DGE + G     ++   +L+S L
Sbjct:   21 LKSRTGEFSLESILLLKLRGLGLADLGCLGECLGLEWLDLSGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLRLRDPLARLSNPLCANPSYWAAVRELLPGLKVIDGERVIGRGSEFYQLCRDLDSSL 183          
BLAST of SMED30012669 vs. Ensembl Human
Match: LRRC61 (leucine rich repeat containing 61 [Source:HGNC Symbol;Acc:HGNC:21704])

HSP 1 Score: 89.3521 bits (220), Expect = 1.958e-20
Identity = 54/163 (33.13%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFL 599
            LK + GEF LE   ++ L   G  ++G L EC+ +E L LS N L  +       +L VL++S N++  LE +  C +L+ L+  GN +A    ++ L  L  L  LRL + +  L+NP+C   +Y A + ++LP L+ +DGE + G     ++   +L+S L
Sbjct:   21 LKSRTGEFSLESILLLKLRGLGLADLGCLGECLGLEWLDLSGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLRLRDPLARLSNPLCANPSYWAAVRELLPGLKVIDGERVIGRGSEFYQLCRDLDSSL 183          
BLAST of SMED30012669 vs. Ensembl Human
Match: LRRC9 (leucine rich repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:19848])

HSP 1 Score: 65.855 bits (159), Expect = 1.844e-11
Identity = 48/140 (34.29%), Postives = 72/140 (51.43%), Query Frame = 3
Query:  180 ENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANIN--------------------SIKFLINLENLVSLR--LLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            E I  L+EC N+E LYL  N ++ I +    +KL+VL L+ N I N+EG++   +L+ L++ GN I +I                     S K L NL  L  L+   LND +  TNP+C+  NY   ++  LP L++ D
Sbjct:   89 EKIEGLQECRNLEKLYLYFNKISKIENLEKLIKLKVLWLNHNTIKNIEGLQTLKNLKDLNLAGNLINSIGRCLDSNEQLERLNLSGNQICSFKELTNLTRLPCLKDLCLNDPQYTTNPVCLLCNYSTHVLYHLPCLQRFD 228          
BLAST of SMED30012669 vs. Ensembl Human
Match: LRRC9 (leucine rich repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:19848])

HSP 1 Score: 65.4698 bits (158), Expect = 2.111e-11
Identity = 48/140 (34.29%), Postives = 72/140 (51.43%), Query Frame = 3
Query:  180 ENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANIN--------------------SIKFLINLENLVSLR--LLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            E I  L+EC N+E LYL  N ++ I +    +KL+VL L+ N I N+EG++   +L+ L++ GN I +I                     S K L NL  L  L+   LND +  TNP+C+  NY   ++  LP L++ D
Sbjct:   89 EKIEGLQECRNLEKLYLYFNKISKIENLEKLIKLKVLWLNHNTIKNIEGLQTLKNLKDLNLAGNLINSIGRCLDSNEQLERLNLSGNQICSFKELTNLTRLPCLKDLCLNDPQYTTNPVCLLCNYSTHVLYHLPCLQRFD 228          
BLAST of SMED30012669 vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 50.0618 bits (118), Expect = 5.544e-7
Identity = 50/191 (26.18%), Postives = 95/191 (49.74%), Query Frame = 3
Query:  102 KFNLKKKLGEFD-LEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLV----SLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSDECKYNINDSVLPKVVNVE 659
            ++NL KK+  F  L   + ++L+D+  E + +L+  VN+  L +S N +  I   +  + L  L L  NKI  +EG+E   +++ L+   N I  + ++  L+NLE L      +R +  +  +       L+   + ++I+  L+ L G            KI+ L S L++    ++ND+++ K+ NVE
Sbjct:   57 RWNLLKKIDHFQCLTSLTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQ--LKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDGL-SGLTNLKSLDLNDNIIEKLENVE 244          

HSP 2 Score: 46.595 bits (109), Expect = 8.084e-6
Identity = 30/81 (37.04%), Postives = 40/81 (49.38%), Query Frame = 3
Query:  180 ENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENL 422
            + I   +    +  L L  NLL  I  F C   L  L+L+ N+I  LE +E  ++L  LDV  N I  I  +  LINLE L
Sbjct:   40 QKIWQFENTPGIRDLSLRWNLLKKIDHFQCLTSLTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEEL 120          
BLAST of SMED30012669 vs. Ensembl Fly
Match: CG15208 (gene:FBgn0030247 transcript:FBtr0073383)

HSP 1 Score: 63.5438 bits (153), Expect = 2.708e-11
Identity = 50/140 (35.71%), Postives = 78/140 (55.71%), Query Frame = 3
Query:  279 LRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNP--ICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSDECKYNINDSVLPKVVNVEIVNYSPDSEVF 692
            L VL LS NKI +L+ +  C  L+ L +  N IA+ + +K+L+N ++L SL LL+      NP  I  G NYRA ++++LP L+KLD   +  AE        ELES L  +   ++  ++L  V  +++ N SPD   +
Sbjct:   44 LEVLSLSMNKITSLKSLVRCTRLKELYLRQNEIADFDELKYLVNAKSLTSLWLLD------NPCSIAAGSNYRASVLRMLPNLKKLDN--VDVAE-------EELESALRYDYYPDVGSAILNPV--LDLSNCSPDDMAY 166          
BLAST of SMED30012669 vs. Ensembl Fly
Match: CG15208 (gene:FBgn0030247 transcript:FBtr0339767)

HSP 1 Score: 63.5438 bits (153), Expect = 2.708e-11
Identity = 50/140 (35.71%), Postives = 78/140 (55.71%), Query Frame = 3
Query:  279 LRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNP--ICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSDECKYNINDSVLPKVVNVEIVNYSPDSEVF 692
            L VL LS NKI +L+ +  C  L+ L +  N IA+ + +K+L+N ++L SL LL+      NP  I  G NYRA ++++LP L+KLD   +  AE        ELES L  +   ++  ++L  V  +++ N SPD   +
Sbjct:   44 LEVLSLSMNKITSLKSLVRCTRLKELYLRQNEIADFDELKYLVNAKSLTSLWLLD------NPCSIAAGSNYRASVLRMLPNLKKLDN--VDVAE-------EELESALRYDYYPDVGSAILNPV--LDLSNCSPDDMAY 166          
BLAST of SMED30012669 vs. Ensembl Fly
Match: CG15208 (gene:FBgn0030247 transcript:FBtr0346271)

HSP 1 Score: 63.5438 bits (153), Expect = 2.708e-11
Identity = 50/140 (35.71%), Postives = 78/140 (55.71%), Query Frame = 3
Query:  279 LRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNP--ICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSDECKYNINDSVLPKVVNVEIVNYSPDSEVF 692
            L VL LS NKI +L+ +  C  L+ L +  N IA+ + +K+L+N ++L SL LL+      NP  I  G NYRA ++++LP L+KLD   +  AE        ELES L  +   ++  ++L  V  +++ N SPD   +
Sbjct:   44 LEVLSLSMNKITSLKSLVRCTRLKELYLRQNEIADFDELKYLVNAKSLTSLWLLD------NPCSIAAGSNYRASVLRMLPNLKKLDN--VDVAE-------EELESALRYDYYPDVGSAILNPV--LDLSNCSPDDMAY 166          
BLAST of SMED30012669 vs. Ensembl Fly
Match: CG14995 (gene:FBgn0035497 transcript:FBtr0073272)

HSP 1 Score: 56.6102 bits (135), Expect = 7.348e-9
Identity = 39/99 (39.39%), Postives = 56/99 (56.57%), Query Frame = 3
Query:  252 ISDFNCFVKLR---VLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPIC--MGLNYRADIIKILPKLEKLD 533
            +SD +   ++R   VL LS NKI  L   E C  L+ L +  N+I++IN I +L NL +L +L L        NP C   G NYR+ +++ LP L+KLD
Sbjct:   31 LSDVSIIKRMRGVEVLALSVNKISTLSTFEDCTKLQELYLRKNSISDINEIAYLQNLPSLRNLWLEE------NPCCERAGPNYRSIVLRALPNLKKLD 123          
BLAST of SMED30012669 vs. Ensembl Fly
Match: CG14995 (gene:FBgn0035497 transcript:FBtr0302304)

HSP 1 Score: 56.225 bits (134), Expect = 8.189e-9
Identity = 39/99 (39.39%), Postives = 56/99 (56.57%), Query Frame = 3
Query:  252 ISDFNCFVKLR---VLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPIC--MGLNYRADIIKILPKLEKLD 533
            +SD +   ++R   VL LS NKI  L   E C  L+ L +  N+I++IN I +L NL +L +L L        NP C   G NYR+ +++ LP L+KLD
Sbjct:   66 LSDVSIIKRMRGVEVLALSVNKISTLSTFEDCTKLQELYLRKNSISDINEIAYLQNLPSLRNLWLEE------NPCCERAGPNYRSIVLRALPNLKKLD 158          
BLAST of SMED30012669 vs. Ensembl Zebrafish
Match: lrrc61 (leucine rich repeat containing 61 [Source:ZFIN;Acc:ZDB-GENE-060616-245])

HSP 1 Score: 90.8929 bits (224), Expect = 3.185e-21
Identity = 59/166 (35.54%), Postives = 99/166 (59.64%), Query Frame = 3
Query:   75 DEISDKILSKFNLKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFE 572
            DEI    ++   LK   GEFDLE    + L + G  ++G + EC+N+E L LS N + ++   +   +L  L+LS N+I NLE +  C SL+ L+V GN I++++++  L +L  L ++RL ++  N TNP+C   +YR  I++I P ++ LDGE + G    +++
Sbjct:    8 DEIECSKITTMLLKSHTGEFDLESILFLKLKNLGIYDLGCIGECINLERLDLSGNNITNLGPLSPLRRLLSLNLSANRISNLEPLATCESLQSLNVAGNVISSVDNLHSLKSLRKLENIRLKDNTYNFTNPVCKNPSYRPLILEIFPNMKVLDGERVVGRGSDLYQ 173          
BLAST of SMED30012669 vs. Ensembl Zebrafish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 58.5362 bits (140), Expect = 1.812e-9
Identity = 44/144 (30.56%), Postives = 77/144 (53.47%), Query Frame = 3
Query:  198 KECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELES----FLSDECKY 617
            K C +++ILYL  NL+  I +     KL  L+L+ N I  +E +E C SL+ LD+  N +  ++S++ L +  +L  L L+       NP      YR  ++  +P+L+ LDG+ ++ AE +  + + EL++     L  E +Y
Sbjct:   41 KWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIEVIENLEGCESLQKLDLTVNFVGRLSSVETLKHNLHLKELYLVG------NPCAEYHGYRQYVVATVPQLQSLDGKEISRAERI--QALQELDAVRTRVLQQETEY 176          
BLAST of SMED30012669 vs. Ensembl Zebrafish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 58.5362 bits (140), Expect = 1.812e-9
Identity = 44/144 (30.56%), Postives = 77/144 (53.47%), Query Frame = 3
Query:  198 KECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELES----FLSDECKY 617
            K C +++ILYL  NL+  I +     KL  L+L+ N I  +E +E C SL+ LD+  N +  ++S++ L +  +L  L L+       NP      YR  ++  +P+L+ LDG+ ++ AE +  + + EL++     L  E +Y
Sbjct:   41 KWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIEVIENLEGCESLQKLDLTVNFVGRLSSVETLKHNLHLKELYLVG------NPCAEYHGYRQYVVATVPQLQSLDGKEISRAERI--QALQELDAVRTRVLQQETEY 176          
BLAST of SMED30012669 vs. Ensembl Zebrafish
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 58.5362 bits (140), Expect = 1.812e-9
Identity = 44/144 (30.56%), Postives = 77/144 (53.47%), Query Frame = 3
Query:  198 KECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELES----FLSDECKY 617
            K C +++ILYL  NL+  I +     KL  L+L+ N I  +E +E C SL+ LD+  N +  ++S++ L +  +L  L L+       NP      YR  ++  +P+L+ LDG+ ++ AE +  + + EL++     L  E +Y
Sbjct:   41 KWCRDLKILYLQNNLIPKIENVGRLKKLEYLNLALNNIEVIENLEGCESLQKLDLTVNFVGRLSSVETLKHNLHLKELYLVG------NPCAEYHGYRQYVVATVPQLQSLDGKEISRAERI--QALQELDAVRTRVLQQETEY 176          
BLAST of SMED30012669 vs. Ensembl Zebrafish
Match: lrrc9 (leucine rich repeat containing 9 [Source:ZFIN;Acc:ZDB-GENE-080917-56])

HSP 1 Score: 52.373 bits (124), Expect = 1.450e-7
Identity = 43/159 (27.04%), Postives = 79/159 (49.69%), Query Frame = 3
Query:  186 IGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIAN--------------------INSIKFLINLENLVSLRLLN--DVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTG------AEGMVFEKI 578
            I  L  C+++E L+L  N ++ I++    V L VL L++N+I +++G++  ++LE +++  N I                      I+S K L +L  L  LR L+  D + + NP+C+  NY   ++  +P L+ LD   ++       AE  V +K+
Sbjct:   94 ISGLHNCLHLEKLFLYDNNIHQITNLEMLVNLCVLWLNKNQISDIQGLDSLVNLEEMNLADNAIETLGHSLDPNCNLQNLNLSGNKISSFKELTHLARLPRLRYLSLKDPQCIPNPVCLLYNYYIHVLYHMPNLQLLDTYDMSSRQLKDTAESTVLKKM 252          
BLAST of SMED30012669 vs. Ensembl Xenopus
Match: celf1 (CUGBP Elav-like family member 1 [Source:Xenbase;Acc:XB-GENE-854036])

HSP 1 Score: 91.2781 bits (225), Expect = 2.891e-21
Identity = 64/220 (29.09%), Postives = 111/220 (50.45%), Query Frame = 3
Query:   72 MDEISDKILSKFNLKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSDECKYNIND---SVLPKVVNVEIVNYSPDSEVFDKINSINNEI 722
             D  S +I S+  LK + GEFDLE    + L   G   +G + +C N+E L LS N +  +   +    L  L+LS N+I +LE +  C +L+ L+V GN + +I  ++ L  L  L S+ L + V NL+NP+C   +YR  ++  +P +  +DG+ ++G    ++    ++++ L       + D   SV P V         P S++ ++     NE+
Sbjct:    9 QDSDSGRITSQM-LKLRTGEFDLESILFLKLRGLGLAELGCIGDCTNLERLDLSNNHIVHLGPLSSLKMLVALNLSCNRISSLEPLASCENLQTLNVAGNLLCSIEGLQCLKGLRRLESIWLRDPVYNLSNPLCNSASYRHAVLDTIPSVRVIDGQRVSGTGSDLYHLCKDIDNSLKRVLGSGLADAPGSVRPWVEEGYWDPTPPQSDLIEETYKQFNEV 227          
BLAST of SMED30012669 vs. Ensembl Xenopus
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:394985])

HSP 1 Score: 57.3806 bits (137), Expect = 7.822e-9
Identity = 41/122 (33.61%), Postives = 66/122 (54.10%), Query Frame = 3
Query:  198 KECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGM 563
            K C  ++ILYL  NL+  I + +   KL  L+L+ N I  +E +E C SL+ LD+  N + +++SI  L   EN    R L +   + NP      YR  ++  LP+L+ LDG+ +  +E +
Sbjct:   41 KWCRELKILYLQNNLIGKIENVSKLKKLEYLNLALNNIEKIENLEGCESLQKLDLTVNFVGDLSSINSL--QEN----RQLREFYLVGNPCAEYEGYRQYVVATLPQLKWLDGKEIERSERI 156          
BLAST of SMED30012669 vs. Ensembl Xenopus
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:394985])

HSP 1 Score: 56.9954 bits (136), Expect = 1.138e-8
Identity = 41/120 (34.17%), Postives = 65/120 (54.17%), Query Frame = 3
Query:  198 KECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAE 557
            K C  ++ILYL  NL+  I + +   KL  L+L+ N I  +E +E C SL+ LD+  N + +++SI  L   EN    R L +   + NP      YR  ++  LP+L+ LDG+ +  +E
Sbjct:   37 KWCRELKILYLQNNLIGKIENVSKLKKLEYLNLALNNIEKIENLEGCESLQKLDLTVNFVGDLSSINSL--QEN----RQLREFYLVGNPCAEYEGYRQYVVATLPQLKWLDGKEIERSE 150          
BLAST of SMED30012669 vs. Ensembl Xenopus
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:394985])

HSP 1 Score: 56.6102 bits (135), Expect = 1.175e-8
Identity = 41/120 (34.17%), Postives = 65/120 (54.17%), Query Frame = 3
Query:  198 KECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAE 557
            K C  ++ILYL  NL+  I + +   KL  L+L+ N I  +E +E C SL+ LD+  N + +++SI  L   EN    R L +   + NP      YR  ++  LP+L+ LDG+ +  +E
Sbjct:   41 KWCRELKILYLQNNLIGKIENVSKLKKLEYLNLALNNIEKIENLEGCESLQKLDLTVNFVGDLSSINSL--QEN----RQLREFYLVGNPCAEYEGYRQYVVATLPQLKWLDGKEIERSE 154          
BLAST of SMED30012669 vs. Ensembl Xenopus
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:394985])

HSP 1 Score: 56.6102 bits (135), Expect = 1.339e-8
Identity = 41/120 (34.17%), Postives = 65/120 (54.17%), Query Frame = 3
Query:  198 KECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAE 557
            K C  ++ILYL  NL+  I + +   KL  L+L+ N I  +E +E C SL+ LD+  N + +++SI  L   EN    R L +   + NP      YR  ++  LP+L+ LDG+ +  +E
Sbjct:   90 KWCRELKILYLQNNLIGKIENVSKLKKLEYLNLALNNIEKIENLEGCESLQKLDLTVNFVGDLSSINSL--QEN----RQLREFYLVGNPCAEYEGYRQYVVATLPQLKWLDGKEIERSE 203          
BLAST of SMED30012669 vs. Ensembl Mouse
Match: Lrrc61 (leucine rich repeat containing 61 [Source:MGI Symbol;Acc:MGI:2652848])

HSP 1 Score: 92.4337 bits (228), Expect = 8.034e-22
Identity = 53/163 (32.52%), Postives = 91/163 (55.83%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFL 599
            LK   GEF L+   ++ L   G  ++G L EC+N+E L LS N L  +       +L VL++S N++  LE +  C +L+ L+  GN +     ++ L  L+ L  LRL + +  L+NP+C   +Y A + ++LP L+ +DGE ++G    +++   +L+S L
Sbjct:   21 LKSHSGEFALDSILLLKLRGLGVVDLGCLGECLNLEWLDLSGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLAACENLQSLNAAGNLLTTPGQLQCLAGLQALEHLRLRDPLARLSNPLCANASYWAVVQELLPGLKVIDGERVSGRGSELYQLCRDLDSSL 183          
BLAST of SMED30012669 vs. Ensembl Mouse
Match: Lrrc61 (leucine rich repeat containing 61 [Source:MGI Symbol;Acc:MGI:2652848])

HSP 1 Score: 92.4337 bits (228), Expect = 8.034e-22
Identity = 53/163 (32.52%), Postives = 91/163 (55.83%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFL 599
            LK   GEF L+   ++ L   G  ++G L EC+N+E L LS N L  +       +L VL++S N++  LE +  C +L+ L+  GN +     ++ L  L+ L  LRL + +  L+NP+C   +Y A + ++LP L+ +DGE ++G    +++   +L+S L
Sbjct:   21 LKSHSGEFALDSILLLKLRGLGVVDLGCLGECLNLEWLDLSGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLAACENLQSLNAAGNLLTTPGQLQCLAGLQALEHLRLRDPLARLSNPLCANASYWAVVQELLPGLKVIDGERVSGRGSELYQLCRDLDSSL 183          
BLAST of SMED30012669 vs. Ensembl Mouse
Match: Lrrc9 (leucine rich repeat containing 9 [Source:MGI Symbol;Acc:MGI:1925507])

HSP 1 Score: 63.929 bits (154), Expect = 4.769e-11
Identity = 46/140 (32.86%), Postives = 71/140 (50.71%), Query Frame = 3
Query:  180 ENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIAN--------------------INSIKFLINLENLVSLR--LLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            E I  L+ C N+E LYL  N ++ I +    +KL VL L+ N I N+EG++   +L+ L++ GN +++                    I S K L NL  L  L+   LND +  +NP+C   NY   ++  LP L++LD
Sbjct:   89 EKIEGLQGCRNLEKLYLYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDPNEQLEKLNLSGNQITSFKDLTNLTKLTRLKDLCLNDPQYKSNPVCQLCNYSTHVLYHLPSLQRLD 228          
BLAST of SMED30012669 vs. Ensembl Mouse
Match: Lrrc9 (leucine rich repeat containing 9 [Source:MGI Symbol;Acc:MGI:1925507])

HSP 1 Score: 63.929 bits (154), Expect = 4.851e-11
Identity = 46/140 (32.86%), Postives = 71/140 (50.71%), Query Frame = 3
Query:  180 ENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIAN--------------------INSIKFLINLENLVSLR--LLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            E I  L+ C N+E LYL  N ++ I +    +KL VL L+ N I N+EG++   +L+ L++ GN +++                    I S K L NL  L  L+   LND +  +NP+C   NY   ++  LP L++LD
Sbjct:   89 EKIEGLQGCRNLEKLYLYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDPNEQLEKLNLSGNQITSFKDLTNLTKLTRLKDLCLNDPQYKSNPVCQLCNYSTHVLYHLPSLQRLD 228          
BLAST of SMED30012669 vs. Ensembl Mouse
Match: Lrrc9 (leucine rich repeat containing 9 [Source:MGI Symbol;Acc:MGI:1925507])

HSP 1 Score: 63.929 bits (154), Expect = 5.346e-11
Identity = 46/140 (32.86%), Postives = 71/140 (50.71%), Query Frame = 3
Query:  180 ENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIAN--------------------INSIKFLINLENLVSLR--LLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            E I  L+ C N+E LYL  N ++ I +    +KL VL L+ N I N+EG++   +L+ L++ GN +++                    I S K L NL  L  L+   LND +  +NP+C   NY   ++  LP L++LD
Sbjct:   89 EKIEGLQGCRNLEKLYLYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDPNEQLEKLNLSGNQITSFKDLTNLTKLTRLKDLCLNDPQYKSNPVCQLCNYSTHVLYHLPSLQRLD 228          
BLAST of SMED30012669 vs. UniProt/SwissProt
Match: sp|Q8R2R5|LRC61_MOUSE (Leucine-rich repeat-containing protein 61 OS=Mus musculus OX=10090 GN=Lrrc61 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 5.393e-21
Identity = 53/163 (32.52%), Postives = 91/163 (55.83%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFL 599
            LK   GEF L+   ++ L   G  ++G L EC+N+E L LS N L  +       +L VL++S N++  LE +  C +L+ L+  GN +     ++ L  L+ L  LRL + +  L+NP+C   +Y A + ++LP L+ +DGE ++G    +++   +L+S L
Sbjct:   21 LKSHSGEFALDSILLLKLRGLGVVDLGCLGECLNLEWLDLSGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLAACENLQSLNAAGNLLTTPGQLQCLAGLQALEHLRLRDPLARLSNPLCANASYWAVVRELLPGLKVIDGERVSGRGSELYQLCRDLDSSL 183          
BLAST of SMED30012669 vs. UniProt/SwissProt
Match: sp|Q9BV99|LRC61_HUMAN (Leucine-rich repeat-containing protein 61 OS=Homo sapiens OX=9606 GN=LRRC61 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 9.402e-20
Identity = 54/163 (33.13%), Postives = 89/163 (54.60%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFL 599
            LK + GEF LE   ++ L   G  ++G L EC+ +E L LS N L  +       +L VL++S N++  LE +  C +L+ L+  GN +A    ++ L  L  L  LRL + +  L+NP+C   +Y A + ++LP L+ +DGE + G     ++   +L+S L
Sbjct:   21 LKSRTGEFSLESILLLKLRGLGLADLGCLGECLGLEWLDLSGNALTHLGPLASLRQLAVLNVSNNRLTGLEPLATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLRLRDPLARLSNPLCANPSYWAAVRELLPGLKVIDGERVIGRGSEFYQLCRDLDSSL 183          
BLAST of SMED30012669 vs. UniProt/SwissProt
Match: sp|Q2T9T5|LRC61_BOVIN (Leucine-rich repeat-containing protein 61 OS=Bos taurus OX=9913 GN=LRRC61 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 8.572e-14
Identity = 54/166 (32.53%), Postives = 90/166 (54.22%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSDE 608
            LK + GEF LE   ++ L   G   +G L +C+ +E L LS N L  +       +L VL+++ N++  LE +  C +L+ L+  GN +A    ++ L  L  L  LRL + +  L+NP+C    Y A + ++LP L+ LDGE ++G     ++   +L+S LS +
Sbjct:   21 LKARSGEFALESILLLKLRGLGLVGLGCLGDCLGLEWLDLSGNALTQLGPLASLRQLAVLNVADNRLTGLEPLAACENLQCLNAAGNLLAGPAQLQCLAGLRGLERLRLRDPLARLSNPLCASPCYWASVRELLPGLKVLDGERVSGRGSDFYQLCRDLDSSLSPD 186          
BLAST of SMED30012669 vs. UniProt/SwissProt
Match: sp|Q6ZRR7|LRRC9_HUMAN (Leucine-rich repeat-containing protein 9 OS=Homo sapiens OX=9606 GN=LRRC9 PE=2 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 1.014e-10
Identity = 48/140 (34.29%), Postives = 72/140 (51.43%), Query Frame = 3
Query:  180 ENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANIN--------------------SIKFLINLENLVSLR--LLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            E I  L+EC N+E LYL  N ++ I +    +KL+VL L+ N I N+EG++   +L+ L++ GN I +I                     S K L NL  L  L+   LND +  TNP+C+  NY   ++  LP L++ D
Sbjct:   89 EKIEGLQECRNLEKLYLYFNKISKIENLEKLIKLKVLWLNHNTIKNIEGLQTLKNLKDLNLAGNLINSIGRCLDSNEQLERLNLSGNQICSFKELTNLTRLPCLKDLCLNDPQYTTNPVCLLCNYSTHVLYHLPCLQRFD 228          
BLAST of SMED30012669 vs. UniProt/SwissProt
Match: sp|Q8CDN9|LRRC9_MOUSE (Leucine-rich repeat-containing protein 9 OS=Mus musculus OX=10090 GN=Lrrc9 PE=1 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 3.393e-10
Identity = 46/140 (32.86%), Postives = 71/140 (50.71%), Query Frame = 3
Query:  180 ENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIAN--------------------INSIKFLINLENLVSLR--LLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            E I  L+ C N+E LYL  N ++ I +    +KL VL L+ N I N+EG++   +L+ L++ GN +++                    I S K L NL  L  L+   LND +  +NP+C   NY   ++  LP L++LD
Sbjct:   89 EKIEGLQGCRNLEKLYLYYNKISKIENLEKLIKLEVLWLNHNMIKNIEGLQTLKNLKDLNLAGNLVSSIGRCLDPNEQLEKLNLSGNQITSFKDLTNLTKLTRLKDLCLNDPQYKSNPVCQLCNYSTHVLYHLPSLQRLD 228          
BLAST of SMED30012669 vs. TrEMBL
Match: K1P8S7 (Leucine-rich repeat-containing protein 61 OS=Crassostrea gigas OX=29159 GN=CGI_10006745 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.708e-27
Identity = 68/189 (35.98%), Postives = 106/189 (56.08%), Query Frame = 3
Query:   75 DEISDKILSKFNLKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSDECKYNINDSVLP 641
            + + D  ++K  LK + GEFD+E    ++L D G  ++G + EC  +E L LSRN L  ++       L  L+LS N+I N EG++   SL+ +++ GN I ++NS++ L  L+ L  LRL + V++L+NP+C    YR D++ +LP L+ LDGE + G    VF    E+E  L      N   S  P
Sbjct:   32 NRMEDGKITKALLKTRSGEFDIESIHTLNLRDCGLSDLGCISECTQLERLNLSRNDLTKLNKLAGLGNLSSLNLSGNRITNPEGLQALESLQSVNLAGNLIGSVNSLRCLTALDKLEDLRLHDPVRDLSNPLCHSNTYRKDVLDMLPNLKVLDGERILGLGSDVFSMCREIEESLERRQDVNSQQSSNP 220          
BLAST of SMED30012669 vs. TrEMBL
Match: A0A267HB64 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016705g2 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.569e-25
Identity = 65/177 (36.72%), Postives = 101/177 (57.06%), Query Frame = 3
Query:   72 MDEISDKILSKFNLKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLS 602
            M    D  +SK  LK+  GEF+L+    +DL+  G E++G L +C ++E L LS N L   +      +LR LDLS N++ +L G+E C +L  LD+ GN IA    +  L +L NL SL+L +  ++LTNPIC+   Y   I+ +LP+L  LDG  + G+    ++   +++  LS
Sbjct:    1 MASDQDLAVSKAALKRLTGEFELDSVFRLDLAKRGLESLGCLPDCTSLEFLNLSSNRLADAAMLGGLKRLRYLDLSGNRLASLAGLEGCEALLHLDLAGNLIACTEDLHSLTDLANLESLQLQDRSRDLTNPICLSAGYADKILDLLPQLSCLDGIRVRGSGDSYYQLCRQIDQALS 177          
BLAST of SMED30012669 vs. TrEMBL
Match: C3YBF6 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_118496 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.012e-25
Identity = 61/185 (32.97%), Postives = 106/185 (57.30%), Query Frame = 3
Query:   96 LSKFNLKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLS---DECKYNINDSVLP 641
            +++  LK   GEF+L+  + I+  D G  ++G + EC N++ L +S N ++ ++  +    L  LD+S N+I  L+ ++   SL  L+  GN I++I+ +  L  LE+  +LRL + V  L NP+C G +Y+  ++ ++P+L+ LDGE L+G    VF   +E+++ L    D   Y IN S  P
Sbjct:   18 VTRQALKTHSGEFELDSITYINFHDRGISDLGCIGECTNLQHLNVSMNDISRLAPLSTLKHLVTLDISANRITQLDALKDADSLHTLNAAGNLISSIDKLACLAKLEHFSNLRLQDKVHQLFNPVCHGASYKKRLLSLMPRLKVLDGEVLSGKGSEVFRICSEIDAALQAAHDSGLYAINTSKPP 202          
BLAST of SMED30012669 vs. TrEMBL
Match: A0A267DQR9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003867g2 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.708e-25
Identity = 65/177 (36.72%), Postives = 100/177 (56.50%), Query Frame = 3
Query:   72 MDEISDKILSKFNLKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLS 602
            M    D  +SK  LK+  GEF+L+    +DL+  G E++G L +C  +E L LS N L   +      +LR LDLS N++ +L G+E C +L  LD+ GN IA    +  L +L NL SL+L +  ++LTNPIC+   Y   I+ +LP+L  LDG  + G+    ++   +++  LS
Sbjct:    1 MASDQDLAVSKAALKRLTGEFELDSVFRLDLAKRGLESLGCLPDCTCLEFLNLSSNRLADAAMLGGLKRLRYLDLSGNRLASLAGLEGCEALLHLDLAGNLIACTEDLHSLTDLANLESLQLQDRSRDLTNPICLSAGYADKILDLLPQLSCLDGIRVRGSGDFYYQLCRQIDQALS 177          
BLAST of SMED30012669 vs. TrEMBL
Match: A0A401PYA8 (Uncharacterized protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0019359 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.956e-25
Identity = 63/173 (36.42%), Postives = 111/173 (64.16%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLS--DECKYNI 623
            LK K G+FDLE    + L + G  N+G + +CVN+E L LS N +++++       L VL+LS N+I NL  +  C +L+ L++ GN I+++++++ L  L+NL ++RL + V N TNP+CM  +YR+ +++I PK+  LDGE ++G+   +++   +++S L   +  +YNI
Sbjct:   19 LKSKTGQFDLESIMFLKLQNFGICNLGCIGDCVNLERLNLSGNNISNLTPLASLKLLTVLNLSANRISNLGPLYSCENLQNLNLSGNLISSVDALRSLSELKNLETIRLKDTVCNFTNPVCMNTSYRSAMLEIFPKINVLDGERMSGSGRDLYQLCKDMDSSLRGLEPFRYNI 191          
BLAST of SMED30012669 vs. Ensembl Cavefish
Match: lrrc61 (leucine rich repeat containing 61 [Source:NCBI gene;Acc:103039592])

HSP 1 Score: 100.523 bits (249), Expect = 7.139e-25
Identity = 68/213 (31.92%), Postives = 119/213 (55.87%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSDECKYNINDSVLPKVVNVEIVNYSPDSEVFDKINSINNEIQKNLNAIVN 749
            LK + GEFDLE    + L   G  ++G + EC+N+E L LS N + ++S       L VL+LS N+I NLE +  C SL+ L++ GN +++ +S+  L +L  L S+RL ++  N +NP+C   +YR  ++++ P ++ LDGE + G    +++   +++    D  K    +  LP+V         PD + +  ++    EI+++ NAIV+
Sbjct:   21 LKSRTGEFDLESILFLKLRSLGIYDLGCIGECINLERLDLSGNNITNLSQLASLRLLVVLNLSANRISNLEALGSCESLQSLNLAGNLVSSTDSLHALKSLRKLESIRLKDNTYNYSNPVCKNTSYRGILLEMFPNIKVLDGERVVGRGSDLYQLCKDID----DTIKGMYKNGQLPEV---------PDCKPW--VDDGFWEIKRSNNAIVD 218          
BLAST of SMED30012669 vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 62.003 bits (149), Expect = 2.011e-10
Identity = 38/125 (30.40%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  162 LSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNL-EGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            L D+    I SL+   N+++L+L+ N+++ I   +    LR L+L+ N I ++   ++   +L+ L++ GN I++   +  L  L  L  L L  D ++  NP+CM  NY   I+  +P L++LD
Sbjct:  108 LYDNNISKISSLELLTNLQVLWLNNNIISEIEGLSMLGNLRELNLADNLIESIGNSLDQNTNLQKLNLSGNKISSFKELTHLTRLSKLRELGL-KDPQSRPNPVCMLCNYFTHILYHVPTLQRLD 231          
BLAST of SMED30012669 vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 62.003 bits (149), Expect = 2.015e-10
Identity = 38/125 (30.40%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  162 LSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNL-EGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            L D+    I SL+   N+++L+L+ N+++ I   +    LR L+L+ N I ++   ++   +L+ L++ GN I++   +  L  L  L  L L  D ++  NP+CM  NY   I+  +P L++LD
Sbjct:  108 LYDNNISKISSLELLTNLQVLWLNNNIISEIEGLSMLGNLRELNLADNLIESIGNSLDQNTNLQKLNLSGNKISSFKELTHLTRLSKLRELGL-KDPQSRPNPVCMLCNYFTHILYHVPTLQRLD 231          
BLAST of SMED30012669 vs. Ensembl Cavefish
Match: LRRC9 (leucine-rich repeat-containing protein 9-like [Source:NCBI gene;Acc:103026999])

HSP 1 Score: 61.2326 bits (147), Expect = 2.924e-10
Identity = 38/125 (30.40%), Postives = 69/125 (55.20%), Query Frame = 3
Query:  162 LSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNL-EGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            L D+    I SL+   N+++L+L+ N+++ I   +    LR L+L+ N I ++   ++   +L+ L++ GN I++   +  L  L  L  L L  D ++  NP+CM  NY   I+  +P L++LD
Sbjct:  108 LYDNNISKISSLELLTNLQVLWLNNNIISEIEGLSMLGNLRELNLADNLIESIGNSLDQNTNLQKLNLSGNKISSFKELTHLTRLSKLRELGL-KDPQSRPNPVCMLCNYFTHILYHVPTLQRLD 231          
BLAST of SMED30012669 vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 60.077 bits (144), Expect = 6.154e-10
Identity = 49/143 (34.27%), Postives = 75/143 (52.45%), Query Frame = 3
Query:  117 KKLGEFD--LEFASV--IDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            KK+ + D   EF S+  + L+++  E I  L++  N+  L LS N +  I      VKL+ L LS N+I  +E ++    LEIL +  N I+ I+++ +L   +NL SL L        NPIC   NY+  ++  LP L  LD
Sbjct:   53 KKILQIDHLWEFTSLTKLQLNNNSIEKIQGLEKLTNLLWLDLSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDTLEHLEILSLGENVISQIDNVIYLRRFKNLRSLNLAR------NPICQETNYKIFVVAYLPDLVYLD 189          
BLAST of SMED30012669 vs. Ensembl Sea Lamprey
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 51.2174 bits (121), Expect = 7.612e-8
Identity = 36/132 (27.27%), Postives = 61/132 (46.21%), Query Frame = 3
Query:  150 SVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYL 545
            +V+ +  +    I  L   VN++ LYLS N +  I       KL  LD++ N++  +E + H   L+   +  N I+N N +  L N   L ++ L        NP+     YR  I+  LP + ++D  Y+
Sbjct:  213 TVLSIQSNRITKIEGLSSLVNLQELYLSHNGIEVIEGLENNKKLTTLDIAANRVRRIENVGHLTELQEFWMNDNQISNWNDVDELKNARGLQTVYLER------NPLQRDPQYRRKIMLALPWVRQIDATYV 338          

HSP 2 Score: 45.4394 bits (106), Expect = 6.251e-6
Identity = 32/89 (35.96%), Postives = 50/89 (56.18%), Query Frame = 3
Query:  156 IDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENL 422
            +DL D+  + I +L   VN+E+L +S N+L  I   +   K+R L L  NKI  +E +     L +L+V  N I  I +I+ L NL++L
Sbjct:  105 LDLYDNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIETLKNLDSL 193          
BLAST of SMED30012669 vs. Ensembl Sea Lamprey
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 51.6026 bits (122), Expect = 8.398e-8
Identity = 28/89 (31.46%), Postives = 48/89 (53.93%), Query Frame = 3
Query:  156 IDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENL 422
            +DL  +  E I  L    ++ +L L +N +  I+      KL VLDL  N+I  +E + H   L +L++ GN I +++S++ L +L  L
Sbjct:   79 LDLYANELEEISGLYNLRSLRVLMLGKNRIRKITSLESLTKLDVLDLHGNQIVRIENLSHLSELRVLNLAGNQITHVDSLRGLHSLAEL 167          
BLAST of SMED30012669 vs. Ensembl Sea Lamprey
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 50.447 bits (119), Expect = 1.597e-7
Identity = 32/118 (27.12%), Postives = 64/118 (54.24%), Query Frame = 3
Query:  204 CVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAE 557
            C +++ LYL  N++  I + +   +L  ++L+ N +  +E ++ C SL+ LD+  N +  ++S+      E L    LL ++  + NP      YR  ++  LP+L++LDG+ +  +E
Sbjct:   40 CRHLKTLYLHNNVIPRIENLSRLKELEYINLALNNVERIENLQGCESLQKLDLTVNFVGELSSV------ETLRHNPLLEELFLVGNPCADFEGYRPYVVATLPQLKRLDGQEIERSE 151          
BLAST of SMED30012669 vs. Ensembl Nematostella
Match: EDO33388 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSD9])

HSP 1 Score: 92.4337 bits (228), Expect = 2.565e-21
Identity = 58/179 (32.40%), Postives = 106/179 (59.22%), Query Frame = 3
Query:   72 MDEISDKILSKFNLKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGL-NYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSD 605
            M+   ++ ++   LK + GEF+L     +DLS+ G +++  + +C  +  L LS N + S++       L +LDLS NKI +L G+E+  +L  +++  N + +I+ ++ L +LENL  LRL + V+  +NP+C    +Y+  + +ILP L+ LDGE LTG+   ++   +E+E+ L +
Sbjct:    1 MNARGNRAITAHMLKLETGEFELGSIHSLDLSNMGIQDLSIVGQCTGLLYLNLSSNNITSLTQLGNLKLLEMLDLSSNKISSLNGMENLTNLGSVNLASNMVMSIDELQCLSDLENLTKLRLQDFVRKQSNPVCQSTKDYKKRVQEILPNLKVLDGELLTGSGSELYAICDEMEAILQE 179          
BLAST of SMED30012669 vs. Ensembl Nematostella
Match: EDO36714 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU6])

HSP 1 Score: 52.373 bits (124), Expect = 2.360e-8
Identity = 35/93 (37.63%), Postives = 57/93 (61.29%), Query Frame = 3
Query:  267 CFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIA---NINSIKFLINLENLVSLRLLNDVKNLTNPICMG-LNYRADIIKILPKLEKLD 533
             F +L+ LDLS+N I +L+G+E    LE L++  NNI+   +++++K+L NL+ L  LRL        NP+     +YR  I+ +LP L++LD
Sbjct:   25 SFTRLKNLDLSRNAIQSLQGVESLQLLETLNLYYNNISYLQDLSALKYLTNLKEL-DLRL--------NPVTKNEPDYRLYIVHLLPSLKRLD 108          
BLAST of SMED30012669 vs. Ensembl Nematostella
Match: EDO46786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP35])

HSP 1 Score: 51.2174 bits (121), Expect = 6.114e-8
Identity = 45/137 (32.85%), Postives = 62/137 (45.26%), Query Frame = 3
Query:  189 GSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCI-SLEILDVCGNNIANI----------------NSIKFLINLENLVSLRLLNDVKNLTNPI----CMGLNYRADIIKILPKLEKLDG 536
             SL    N E L LS N +  I++ N    L+VL L +N I NL G+E    +LE L +  NNI  +                NS+K       L  L  L D+  + NP+        ++R +  K LPKL+KLDG
Sbjct:   42 ASLSTLSNCEKLSLSTNCIEKIANLNGLKNLKVLSLGRNNIKNLNGLEAVADTLEELWISYNNIEKLKGVGVLKKLKVLYMSNNSVKAWEEFTKLGELPALEDLLFIGNPLEEKHSSDGDWRGEATKRLPKLKKLDG 178          
BLAST of SMED30012669 vs. Ensembl Nematostella
Match: EDO31770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWZ7])

HSP 1 Score: 52.373 bits (124), Expect = 6.717e-8
Identity = 39/147 (26.53%), Postives = 68/147 (46.26%), Query Frame = 3
Query:  162 LSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHC-----------------------ISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLD 533
            +S+S  + +  + +C N++ +Y   N ++ I + +   +L VL L+ N I  +EG+E                           LE+LD+  N I +   +  L++L +L SL  L D     NP+ +  NY   ++  LPKL +LD
Sbjct:  114 VSESSLKELSGIDKCTNLKKVYFYDNHISKIENLSSLTRLTVLWLNNNNIQAIEGLESLAQLTDLNLASNKITSIGDTLQRNTHLEVLDLSANRIGSFKDLTNLVHLPHLKSLS-LKDPTYGPNPVSLLCNYATHLLFHLPKLTRLD 259          
BLAST of SMED30012669 vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 51.9878 bits (123), Expect = 6.846e-8
Identity = 42/129 (32.56%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  156 IDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENL-VSLRLLNDVKNLTNPICMG-LNYRADIIKILPKLEKLDG 536
            +D  D+    I +L   VN+ IL LS N++  I + N   KL  L L QNKI  +EG+EH   L ++++  N I  +  ++ L  LE+L V    + +++NL+    +  L+ +++ I  L  LE LD 
Sbjct:   76 LDFYDNQISKIENLDRLVNLRILDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDS 204          
BLAST of SMED30012669 vs. Ensembl Medaka
Match: lrrc61 (leucine rich repeat containing 61 [Source:NCBI gene;Acc:101174745])

HSP 1 Score: 91.2781 bits (225), Expect = 1.770e-21
Identity = 54/154 (35.06%), Postives = 94/154 (61.04%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFE 572
            LK + GEFDL+    + L   G  ++G + ECVN+E L LS N + +++       L VL++S N+I NLE + +C +L+ L+V GN I+++ ++  L++L  L S RL ++  N TNP+C   +YR  ++++ P ++ LDGE + G    +++
Sbjct:   22 LKSRTGEFDLQSILFLKLRGLGICDLGCIGECVNLERLDLSGNNITNLASLASLRLLSVLNISANRITNLEPLHNCENLQNLNVAGNYISSVENLHCLVSLRKLESFRLKDNTYNYTNPVCRNSSYRTVVLEMFPNIKVLDGERVVGRGSELYQ 175          
BLAST of SMED30012669 vs. Ensembl Medaka
Match: lrrc61 (leucine rich repeat containing 61 [Source:NCBI gene;Acc:101174745])

HSP 1 Score: 67.781 bits (164), Expect = 4.839e-13
Identity = 45/119 (37.82%), Postives = 73/119 (61.34%), Query Frame = 3
Query:  111 LKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNP 467
            LK + GEFDL+    + L   G  ++G + ECVN+E L LS N + +++       L VL++S N+I NLE + +C +L+ L+V GN I+++ ++  L++L  L S RL ++  N TNP
Sbjct:   22 LKSRTGEFDLQSILFLKLRGLGICDLGCIGECVNLERLDLSGNNITNLASLASLRLLSVLNISANRITNLEPLHNCENLQNLNVAGNYISSVENLHCLVSLRKLESFRLKDNTYNYTNP 140          
BLAST of SMED30012669 vs. Ensembl Medaka
Match: LRRC9 (leucine-rich repeat-containing protein 9 [Source:NCBI gene;Acc:101159959])

HSP 1 Score: 56.225 bits (134), Expect = 1.280e-8
Identity = 41/133 (30.83%), Postives = 70/133 (52.63%), Query Frame = 3
Query:  207 VNVEILYLSRNLLNSISDFNCFVKLRVLDLSQN---KIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDG------EYLTGAEGMVFEKI 578
            VN+E+L+L+ N +  I   +    L+ L+L+ N   KI N   ++  +SLEIL++ GN I++   +  L +L  L  L  L D  +  NP+C+  NY   ++  +P L++LD       +    AE  V +K+
Sbjct:  161 VNLEVLWLNNNCITKIQGLDMLQNLKELNLADNLIEKIGN--SLDPNVSLEILNLSGNQISSFKELAQLAHLPRLKEL-ALKDPMSTPNPVCLLCNYATHVLYHIPGLQQLDSYNVSDKQVKEAAEAAVMKKM 290          
BLAST of SMED30012669 vs. Ensembl Medaka
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:101163520])

HSP 1 Score: 53.1434 bits (126), Expect = 1.076e-7
Identity = 44/142 (30.99%), Postives = 75/142 (52.82%), Query Frame = 3
Query:  132 FDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAE 557
            F LE  S+  L     E+I   + C  + ILYL  NL+  I +     +L+ L+L+ N I  +E +E C SL+ LD+  N + +++S+    +L + + LR   D+  + NP      YR  ++  LP+L+ LDG  ++ +E
Sbjct:   21 FSLEELSLHQLDIEKIEHID--RWCSKLVILYLQNNLIPRIENLGHLKRLQYLNLALNNIEVIENLEGCESLQKLDLMVNFVGHLSSVD---SLRHNIHLR---DLCLMGNPCSRFEGYRQYVVAALPQLQCLDGTEISRSE 154          
BLAST of SMED30012669 vs. Ensembl Medaka
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:101163520])

HSP 1 Score: 52.373 bits (124), Expect = 2.029e-7
Identity = 44/142 (30.99%), Postives = 75/142 (52.82%), Query Frame = 3
Query:  132 FDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAE 557
            F LE  S+  L     E+I   + C  + ILYL  NL+  I +     +L+ L+L+ N I  +E +E C SL+ LD+  N + +++S+    +L + + LR   D+  + NP      YR  ++  LP+L+ LDG  ++ +E
Sbjct:   64 FSLEELSLHQLDIEKIEHID--RWCSKLVILYLQNNLIPRIENLGHLKRLQYLNLALNNIEVIENLEGCESLQKLDLMVNFVGHLSSVD---SLRHNIHLR---DLCLMGNPCSRFEGYRQYVVAALPQLQCLDGTEISRSE 197          
BLAST of SMED30012669 vs. Planmine SMEST
Match: SMESG000041196.1 (SMESG000041196.1)

HSP 1 Score: 457.603 bits (1176), Expect = 2.742e-165
Identity = 237/241 (98.34%), Postives = 240/241 (99.59%), Query Frame = 3
Query:   72 MDEISDKILSKFNLKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSDECKYNINDSVLPKVVNVEIVNYSPDSEVFDKINSINNEIQKNLNAIVNIRDRIYEIMLNMKNK 794
            MDEIS+KILSKFNLKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLN+VKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSDECKYNINDSV+PKVVNVEIVNYSPDSEVFDKINSINNEIQKNLN IVNIRDRIYEIMLNMKNK
Sbjct:    1 MDEISEKILSKFNLKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNEVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGMVFEKINELESFLSDECKYNINDSVVPKVVNVEIVNYSPDSEVFDKINSINNEIQKNLNTIVNIRDRIYEIMLNMKNK 241          
BLAST of SMED30012669 vs. Planmine SMEST
Match: SMESG000026105.1 (SMESG000026105.1)

HSP 1 Score: 65.855 bits (159), Expect = 3.347e-12
Identity = 49/142 (34.51%), Postives = 71/142 (50.00%), Query Frame = 3
Query:  150 SVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMG-------LNYRADIIKILPKLEKLDGEYLTGA 554
            +V+ +  +    I  L   +N+E LYLS N ++ I +     KL  LDLS N+I  +E + H   LE      NN+A+ NSI  L+NLE L ++          NPI           NYR  I  +LPKL+++D  +LTG 
Sbjct:  182 TVLSIQGNRITQIDGLDNLINLEQLYLSHNGISKIENLGNLTKLTTLDLSSNRISKVENLSHLKILEEFWFNDNNLADWNSIDELVNLEKLATVYFER------NPIWYTPDRSKEDPNYRRKIRLLLPKLKQIDA-HLTGV 316          

HSP 2 Score: 46.9802 bits (110), Expect = 6.248e-6
Identity = 32/81 (39.51%), Postives = 46/81 (56.79%), Query Frame = 3
Query:  180 ENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENL 422
            EN+ SL   VN+E+L L  N +  I + +   KL  L L +NKI  LE ++   +L +L + GN I  I+ +  LINLE L
Sbjct:  129 ENLNSL---VNIEMLELGSNSIKRIENLDSLTKLDQLYLGKNKISKLENLDFMKNLTVLSIQGNRITQIDGLDNLINLEQL 206          
BLAST of SMED30012669 vs. Planmine SMEST
Match: SMESG000058220.1 (SMESG000058220.1)

HSP 1 Score: 58.9214 bits (141), Expect = 9.306e-10
Identity = 45/127 (35.43%), Postives = 68/127 (53.54%), Query Frame = 3
Query:  198 KECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAEGM-VFEK 575
            K C  ++ILYL  NL++ I + +   KL  ++L+ N I  +E +E+C SL+ LD+  N +  + SI  L NL N   L L        NP      YR  +I  LP+L+ LDG  +T +E +  F+K
Sbjct:   41 KWCRELKILYLQSNLISRIENVSRLKKLEYINLALNNIEIIENLENCESLKKLDLTVNFVGILTSIGNLKNLYNFEELYLTG------NPCQSYDGYREYVITTLPQLQTLDGVEITKSERISAFQK 161          
BLAST of SMED30012669 vs. Planmine SMEST
Match: SMESG000065271.1 (SMESG000065271.1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.321e-9
Identity = 47/140 (33.57%), Postives = 71/140 (50.71%), Query Frame = 3
Query:  150 SVIDLSDSGYENIGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEH---CISLEILDVCGNNIANINSIKFLINLENLVSLRLLN-DVKNLTNPICMGLNYRADIIKILPKLEKLDGEYLTGAE 557
            S++ L D     +  +K   N++ L +    L+S+  F     L  LDLS NKI +  G+EH   C +L+ + + GN    ++ IK L   ENL  L  ++ D+  + N       YR ++ K+LPKLE LDGE   G E
Sbjct:   21 SILILDDCKNSTVADIKVFSNLKNLSIVNAGLSSLEGFPEIKSLEKLDLSDNKIGD--GLEHLKGCSNLKQILLSGNKFKTLDQIKVLTEFENLKFLEFISCDISQIEN-------YREEVFKLLPKLEYLDGENREGKE 151          
BLAST of SMED30012669 vs. Planmine SMEST
Match: SMESG000016752.1 (SMESG000016752.1)

HSP 1 Score: 50.8322 bits (120), Expect = 5.895e-7
Identity = 45/148 (30.41%), Postives = 71/148 (47.97%), Query Frame = 3
Query:  186 IGSLKECVNVEILYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGNNIANI---------------------NSIKFLI----NLENLVSLRLLNDVK-NLTNPICMGLNYRADIIKILPKLEKLDGEYLTG 551
            I  L+  +N+  L LS NL+  IS  +  + LR L+LS N+I  +EGI     L  L+V  N+I++I                     N IK +     N + L++LR L  +  N +NP+C   +YR  ++  L +L+ LD +   G
Sbjct:   50 IKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNG 197          
The following BLAST results are available for this feature:
BLAST of SMED30012669 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRC611.958e-2033.13leucine rich repeat containing 61 [Source:HGNC Sym... [more]
LRRC611.958e-2033.13leucine rich repeat containing 61 [Source:HGNC Sym... [more]
LRRC611.958e-2033.13leucine rich repeat containing 61 [Source:HGNC Sym... [more]
LRRC91.844e-1134.29leucine rich repeat containing 9 [Source:HGNC Symb... [more]
LRRC92.111e-1134.29leucine rich repeat containing 9 [Source:HGNC Symb... [more]
back to top
BLAST of SMED30012669 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
K10D2.85.544e-726.18pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
back to top
BLAST of SMED30012669 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG152082.708e-1135.71gene:FBgn0030247 transcript:FBtr0073383[more]
CG152082.708e-1135.71gene:FBgn0030247 transcript:FBtr0339767[more]
CG152082.708e-1135.71gene:FBgn0030247 transcript:FBtr0346271[more]
CG149957.348e-939.39gene:FBgn0035497 transcript:FBtr0073272[more]
CG149958.189e-939.39gene:FBgn0035497 transcript:FBtr0302304[more]
back to top
BLAST of SMED30012669 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc613.185e-2135.54leucine rich repeat containing 61 [Source:ZFIN;Acc... [more]
lrrc61.812e-930.56leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc61.812e-930.56leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc61.812e-930.56leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc91.450e-727.04leucine rich repeat containing 9 [Source:ZFIN;Acc:... [more]
back to top
BLAST of SMED30012669 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
celf12.891e-2129.09CUGBP Elav-like family member 1 [Source:Xenbase;Ac... [more]
lrrc67.822e-933.61leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc61.138e-834.17leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc61.175e-834.17leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc61.339e-834.17leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30012669 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrc618.034e-2232.52leucine rich repeat containing 61 [Source:MGI Symb... [more]
Lrrc618.034e-2232.52leucine rich repeat containing 61 [Source:MGI Symb... [more]
Lrrc94.769e-1132.86leucine rich repeat containing 9 [Source:MGI Symbo... [more]
Lrrc94.851e-1132.86leucine rich repeat containing 9 [Source:MGI Symbo... [more]
Lrrc95.346e-1132.86leucine rich repeat containing 9 [Source:MGI Symbo... [more]
back to top
BLAST of SMED30012669 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R2R5|LRC61_MOUSE5.393e-2132.52Leucine-rich repeat-containing protein 61 OS=Mus m... [more]
sp|Q9BV99|LRC61_HUMAN9.402e-2033.13Leucine-rich repeat-containing protein 61 OS=Homo ... [more]
sp|Q2T9T5|LRC61_BOVIN8.572e-1432.53Leucine-rich repeat-containing protein 61 OS=Bos t... [more]
sp|Q6ZRR7|LRRC9_HUMAN1.014e-1034.29Leucine-rich repeat-containing protein 9 OS=Homo s... [more]
sp|Q8CDN9|LRRC9_MOUSE3.393e-1032.86Leucine-rich repeat-containing protein 9 OS=Mus mu... [more]
back to top
BLAST of SMED30012669 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1P8S71.708e-2735.98Leucine-rich repeat-containing protein 61 OS=Crass... [more]
A0A267HB641.569e-2536.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
C3YBF62.012e-2532.97Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A267DQR92.708e-2536.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A401PYA82.956e-2536.42Uncharacterized protein OS=Scyliorhinus torazame O... [more]
back to top
BLAST of SMED30012669 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc617.139e-2531.92leucine rich repeat containing 61 [Source:NCBI gen... [more]
LRRC92.011e-1030.40leucine-rich repeat-containing protein 9-like [Sou... [more]
LRRC92.015e-1030.40leucine-rich repeat-containing protein 9-like [Sou... [more]
LRRC92.924e-1030.40leucine-rich repeat-containing protein 9-like [Sou... [more]
drc36.154e-1034.27dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
back to top
BLAST of SMED30012669 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppp1r77.612e-827.27protein phosphatase 1, regulatory (inhibitor) subu... [more]
LRRC498.398e-831.46leucine rich repeat containing 49 [Source:HGNC Sym... [more]
lrrc61.597e-727.12leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30012669 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012669 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO333882.565e-2132.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO367142.360e-837.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467866.114e-832.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317706.717e-826.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449376.846e-832.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30012669 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc611.770e-2135.06leucine rich repeat containing 61 [Source:NCBI gen... [more]
lrrc614.839e-1337.82leucine rich repeat containing 61 [Source:NCBI gen... [more]
LRRC91.280e-830.83leucine-rich repeat-containing protein 9 [Source:N... [more]
lrrc61.076e-730.99leucine rich repeat containing 6 [Source:NCBI gene... [more]
lrrc62.029e-730.99leucine rich repeat containing 6 [Source:NCBI gene... [more]
back to top
BLAST of SMED30012669 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041196.12.742e-16598.34SMESG000041196.1[more]
SMESG000026105.13.347e-1234.51SMESG000026105.1[more]
SMESG000058220.19.306e-1035.43SMESG000058220.1[more]
SMESG000065271.11.321e-933.57SMESG000065271.1[more]
SMESG000016752.15.895e-730.41SMESG000016752.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012669 ID=SMED30012669|Name=SMED30012669|organism=Schmidtea mediterranea sexual|type=transcript|length=812bp
TACTTTTTAAAATTTAATTATTAGCTATGTTGATACATAAATAATTATTA
ATTAAAGTAATCATATTAAATATGGATGAAATATCAGATAAGATACTATC
AAAATTTAATCTAAAAAAGAAACTTGGAGAATTCGATTTAGAATTTGCCT
CTGTTATTGATTTAAGTGATTCAGGTTATGAAAACATAGGCAGTCTCAAA
GAATGTGTAAATGTAGAAATTTTATATTTATCACGAAATCTTCTTAATTC
AATTAGTGATTTTAACTGTTTTGTCAAACTTCGAGTATTGGATTTATCAC
AAAATAAGATATTCAATCTTGAAGGTATTGAACATTGTATTTCGTTGGAA
ATTCTAGACGTTTGCGGTAATAATATTGCCAACATAAATTCTATCAAATT
TTTGATAAATCTCGAAAATTTGGTTAGTCTTAGGCTTTTAAATGATGTTA
AAAACCTAACAAATCCTATTTGTATGGGATTGAATTACCGCGCAGATATA
ATAAAGATTTTACCGAAATTGGAAAAACTTGATGGTGAATATTTGACGGG
CGCAGAAGGTATGGTTTTTGAAAAAATTAACGAATTGGAGTCTTTTCTCA
GTGATGAATGCAAATACAATATTAACGATTCGGTGCTCCCTAAGGTTGTG
AATGTCGAAATAGTAAATTATTCCCCAGATTCCGAGGTTTTCGACAAAAT
AAATTCTATTAACAATGAAATTCAAAAAAATTTAAACGCCATTGTAAATA
TACGGGATAGAATTTATGAAATTATGTTAAATATGAAAAATAAATAATTT
ATTTAACTTGTC
back to top

protein sequence of SMED30012669-orf-1

>SMED30012669-orf-1 ID=SMED30012669-orf-1|Name=SMED30012669-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=242bp
MDEISDKILSKFNLKKKLGEFDLEFASVIDLSDSGYENIGSLKECVNVEI
LYLSRNLLNSISDFNCFVKLRVLDLSQNKIFNLEGIEHCISLEILDVCGN
NIANINSIKFLINLENLVSLRLLNDVKNLTNPICMGLNYRADIIKILPKL
EKLDGEYLTGAEGMVFEKINELESFLSDECKYNINDSVLPKVVNVEIVNY
SPDSEVFDKINSINNEIQKNLNAIVNIRDRIYEIMLNMKNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0000278mitotic cell cycle
GO:0051301cell division
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 67..88
e-value: 0.04
score: 23.1
coord: 45..66
e-value: 46.0
score: 10.2
NoneNo IPR availablePANTHERPTHR18849LEUCINE RICH REPEAT PROTEINcoord: 5..223
NoneNo IPR availablePANTHERPTHR18849:SF8LEUCINE-RICH REPEAT-CONTAINING 61coord: 5..223
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 28..160
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 5..169
e-value: 6.0E-27
score: 95.7
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 41..80
e-value: 2.2E-6
score: 27.4
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 91..112
score: 7.489
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 69..90
score: 8.975
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 47..68
score: 6.796