FERM domain-containing protein

Overview
NameFERM domain-containing protein
Smed IDSMED30012665
Length (bp)2349
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FERM domain-containing protein (SMED30012665) t-SNE clustered cells

Violin plots show distribution of expression levels for FERM domain-containing protein (SMED30012665) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FERM domain-containing protein (SMED30012665) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FERM domain-containing protein (SMED30012665) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012665

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30012665h1SMcG0021259 dd_Smed_v4_6227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012665h1SMcG0021259 dd_Smed_v4_6227_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD5 (FERM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:28214])

HSP 1 Score: 226.483 bits (576), Expect = 7.431e-65
Identity = 126/358 (35.20%), Postives = 201/358 (56.15%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            +++C V+ L+++E      +  +  GQ+L D +C  L ++ EKDYFG+R+ D DKQR W++ +++V  QL+ +          P F + FR+K YPA P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYDS        S  +  P  + K E KI +IHK  L G TP   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F ++V       +Q+ +KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ +S++ +    P ++    +  R+
Sbjct:   16 EYSCTVRLLDDSE--YTCTIQRDAKGQYLFDLLCHHL-NLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQ----------PPFTMCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYV-------SQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRS 351          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD5 (FERM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:28214])

HSP 1 Score: 227.254 bits (578), Expect = 1.512e-64
Identity = 126/358 (35.20%), Postives = 201/358 (56.15%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            +++C V+ L+++E      +  +  GQ+L D +C  L ++ EKDYFG+R+ D DKQR W++ +++V  QL+ +          P F + FR+K YPA P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYDS        S  +  P  + K E KI +IHK  L G TP   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F ++V       +Q+ +KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ +S++ +    P ++    +  R+
Sbjct:   16 EYSCTVRLLDDSE--YTCTIQRDAKGQYLFDLLCHHL-NLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQ----------PPFTMCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYV-------SQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRS 351          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD5 (FERM domain containing 5 [Source:HGNC Symbol;Acc:HGNC:28214])

HSP 1 Score: 221.861 bits (564), Expect = 1.540e-63
Identity = 122/333 (36.64%), Postives = 188/333 (56.46%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            GQ+L D +C  L ++ EKDYFG+R+ D DKQR W++ +++V  QL+ +          P F + FR+K YPA P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYDS        S  +  P  + K E KI +IHK  L G TP   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F ++V       +Q+ +KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ +S++ +    P ++    +  R+
Sbjct:    5 GQYLFDLLCHHL-NLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQ----------PPFTMCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYV-------SQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRS 317          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD3 (FERM domain containing 3 [Source:HGNC Symbol;Acc:HGNC:24125])

HSP 1 Score: 202.216 bits (513), Expect = 1.216e-55
Identity = 124/374 (33.16%), Postives = 201/374 (53.74%), Query Frame = 1
Query:  193 KMLKQKSEQISDFT----CRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNT 1299
            KM+  +S  +   +    C ++ L+++E  +   +  E  GQ+L+D +C     + EKDYFG+RY D +KQR W++ +++++ Q+K            P + + FR+K YP  P++ ++++   Y LYLQ+++D++ GRLL   +D   L A  VQ+E+GDYD        +S  ++ P  + K E KI +IHKN L G +P   E   L KA  L+TYGV+P   KD  G   ++G T  G   FQG++R HL KW D+ K+ F+GK F +           Q +KK +L F   T  A   LWK   +   F+   +SS+ K V S   IF K   F+++G+  KE+ +++S +    P ++  N    R++
Sbjct:   16 KMIHFRSSSVKSLSQEMRCTIRLLDDSE--ISCHIQRETKGQFLIDHICNYYS-LLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKTH----------PPYTMCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYV--------IGTQKEKKAMLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTV-SSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPEVHRANITQSRSS 366          
BLAST of FERM domain-containing protein vs. Ensembl Human
Match: FRMD3 (FERM domain containing 3 [Source:HGNC Symbol;Acc:HGNC:24125])

HSP 1 Score: 201.445 bits (511), Expect = 4.153e-55
Identity = 124/374 (33.16%), Postives = 201/374 (53.74%), Query Frame = 1
Query:  193 KMLKQKSEQISDFT----CRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNT 1299
            KM+  +S  +   +    C ++ L+++E  +   +  E  GQ+L+D +C     + EKDYFG+RY D +KQR W++ +++++ Q+K            P + + FR+K YP  P++ ++++   Y LYLQ+++D++ GRLL   +D   L A  VQ+E+GDYD        +S  ++ P  + K E KI +IHKN L G +P   E   L KA  L+TYGV+P   KD  G   ++G T  G   FQG++R HL KW D+ K+ F+GK F +           Q +KK +L F   T  A   LWK   +   F+   +SS+ K V S   IF K   F+++G+  KE+ +++S +    P ++  N    R++
Sbjct:   16 KMIHFRSSSVKSLSQEMRCTIRLLDDSE--ISCHIQRETKGQFLIDHICNYYS-LLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKTH----------PPYTMCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYV--------IGTQKEKKAMLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTV-SSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPEVHRANITQSRSS 366          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 149.058 bits (375), Expect = 1.441e-37
Identity = 100/318 (31.45%), Postives = 161/318 (50.63%), Query Frame = 1
Query:  271 LEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSL-NRSSEAKRVKSGGGIFKKRKTFKFAGRCQKE 1221
            L I V     G  L +EV   L D++E+DYFGL+Y+D    + W+D ++ V  Q+             P F + FR+K + + P  +L+++   Y  +LQ+++D+ SGRL        +LAA+A+QSE+GDY+        +S  +  P  + K E +I + +K   G TP + E  +L KA  ++ YGV+   V+ + GN   +GLT +G+  F G ++  LF W  + K+ F+ K   + V  D   +N    + H   F   +  AA   WK A ++  FF L +R  +A R       F+   TFK+ GR + E
Sbjct:   47 LNIVVPRNAVGSELYEEVFYSL-DLEERDYFGLQYTDPFNVQHWLDPTKKVAKQVA----------IGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQLAIELAAFALQSELGDYNPELHTALFISEFRFHPEQDEKMEVEILERYKACRGQTPAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGLFLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLKSRPIQANRKIQ---FFRLGSTFKYRGRTEYE 350          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 149.058 bits (375), Expect = 1.441e-37
Identity = 100/318 (31.45%), Postives = 161/318 (50.63%), Query Frame = 1
Query:  271 LEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSL-NRSSEAKRVKSGGGIFKKRKTFKFAGRCQKE 1221
            L I V     G  L +EV   L D++E+DYFGL+Y+D    + W+D ++ V  Q+             P F + FR+K + + P  +L+++   Y  +LQ+++D+ SGRL        +LAA+A+QSE+GDY+        +S  +  P  + K E +I + +K   G TP + E  +L KA  ++ YGV+   V+ + GN   +GLT +G+  F G ++  LF W  + K+ F+ K   + V  D   +N    + H   F   +  AA   WK A ++  FF L +R  +A R       F+   TFK+ GR + E
Sbjct:   47 LNIVVPRNAVGSELYEEVFYSL-DLEERDYFGLQYTDPFNVQHWLDPTKKVAKQVA----------IGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQLAIELAAFALQSELGDYNPELHTALFISEFRFHPEQDEKMEVEILERYKACRGQTPAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGLFLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLKSRPIQANRKIQ---FFRLGSTFKYRGRTEYE 350          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 149.058 bits (375), Expect = 1.441e-37
Identity = 100/318 (31.45%), Postives = 161/318 (50.63%), Query Frame = 1
Query:  271 LEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSL-NRSSEAKRVKSGGGIFKKRKTFKFAGRCQKE 1221
            L I V     G  L +EV   L D++E+DYFGL+Y+D    + W+D ++ V  Q+             P F + FR+K + + P  +L+++   Y  +LQ+++D+ SGRL        +LAA+A+QSE+GDY+        +S  +  P  + K E +I + +K   G TP + E  +L KA  ++ YGV+   V+ + GN   +GLT +G+  F G ++  LF W  + K+ F+ K   + V  D   +N    + H   F   +  AA   WK A ++  FF L +R  +A R       F+   TFK+ GR + E
Sbjct:   47 LNIVVPRNAVGSELYEEVFYSL-DLEERDYFGLQYTDPFNVQHWLDPTKKVAKQVA----------IGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQLAIELAAFALQSELGDYNPELHTALFISEFRFHPEQDEKMEVEILERYKACRGQTPAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGLFLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLKSRPIQANRKIQ---FFRLGSTFKYRGRTEYE 350          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-2 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:Q9GP93])

HSP 1 Score: 149.058 bits (375), Expect = 1.799e-37
Identity = 100/318 (31.45%), Postives = 161/318 (50.63%), Query Frame = 1
Query:  271 LEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSL-NRSSEAKRVKSGGGIFKKRKTFKFAGRCQKE 1221
            L I V     G  L +EV   L D++E+DYFGL+Y+D    + W+D ++ V  Q+             P F + FR+K + + P  +L+++   Y  +LQ+++D+ SGRL        +LAA+A+QSE+GDY+        +S  +  P  + K E +I + +K   G TP + E  +L KA  ++ YGV+   V+ + GN   +GLT +G+  F G ++  LF W  + K+ F+ K   + V  D   +N    + H   F   +  AA   WK A ++  FF L +R  +A R       F+   TFK+ GR + E
Sbjct:   63 LNIVVPRNAVGSELYEEVFYSL-DLEERDYFGLQYTDPFNVQHWLDPTKKVAKQVA----------IGPPFTLRFRVKFFTSEPSSNLKEELTRYQFFLQIKQDISSGRLQCPHQLAIELAAFALQSELGDYNPELHTALFISEFRFHPEQDEKMEVEILERYKACRGQTPAQAELNYLNKARWIEMYGVDMHIVEGKDGNTYRLGLTPQGMLVFDGPQKIGLFLWEKLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLTSEKAAKHFWKCAIEQHAFFRLKSRPIQANR---KIQFFRLGSTFKYRGRTEYE 366          
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Match: frm-4 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:H2KYZ6])

HSP 1 Score: 147.132 bits (370), Expect = 1.280e-36
Identity = 106/343 (30.90%), Postives = 167/343 (48.69%), Query Frame = 1
Query:  298 SGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGN-NLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDE-------------------------IFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGI--FKKRKTFKFAG-RCQKEIQQSTS 1239
            S Q +LD VC+ L  IQEKD+ GLRY D  K R W+DL+R++ + +K+ +        T S  +  R ++YP+ P   LR     Y L++QL++DL  GRL   ++   +LAA  +Q+++GDY+        +S  KLL     K E +I + HK L G +    E +FLEKASQLDTY  +P+ +K+      +Y+G + +G+  + G  R H   W+++ K+ + GK   I + L E                         I +   +KK   L + C +   A  LW     +  FF+   + + K   S   I    +  TF+F   R  +EI++  S
Sbjct:   50 SAQTILDYVCQ-LKHIQEKDFLGLRYQDHHKHRYWLDLTRSINHVVKNFKKEIKKVGKTESMTLHLRFRYYPSDPAR-LRDPNLRYQLFVQLQRDLLHGRLYCPTSSAAELAALILQAQLGDYNEEKHVGNYVSGYKLLLKQTPKLEERIANNHKELKGKSSESAELEFLEKASQLDTYAFDPYTIKEPHDTLPVYIGASCKGILIYTGQSRTHNIDWSELVKVDYSGKE--IRLTLSENYRGQITAAGTPTGTLNGHGPGSPSIMDKSLTKKPLTLKYTCPSGQFAKHLWIHILSQQAFFNETSAQDVKLKFSKPRIPLLSRGSTFRFPSKRVYREIEEEDS 388          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: CG5022 (gene:FBgn0032225 transcript:FBtr0079999)

HSP 1 Score: 208.379 bits (529), Expect = 4.346e-58
Identity = 129/347 (37.18%), Postives = 191/347 (55.04%), Query Frame = 1
Query:  196 MLKQKSEQISDFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEA---KITDIHKNL-CGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEI 1224
            M + K+E    + C V+ L++++  LE +    + G +LL+ +C  L +I+EKDYFGLRY D  KQR W+DLS+++  Q K+   + F          S R+K YPA P       R    LY QL++DL  GRL     +   L A  VQ E+GDY+   ED+   S +  +     +TE    KI ++HK    G   +    +FL  A  L+TYG++P  VKD +G+  YVG+ + G+STF   +R+  F+W +I KI+F+GK+FI H+      +  +  KKH +GFKC T  A   LW+ A ++M FF+L  S  A  V SGGG F     F++ GR ++EI
Sbjct:    1 MFRSKNEGNIVYKCTVRLLDDSDV-LECEFQPFHKGIYLLEYLCGEL-EIKEKDYFGLRYVDSSKQRHWLDLSKSIIKQCKEMDPLLF----------SLRVKFYPADPFRLTGNARI--MLYQQLKRDLRHGRLYCSLGEAAALGALIVQEELGDYN---EDVHVGSYVSSIELALRQTECLEKKIIELHKKREPGQNLSLAMDEFLGIARGLETYGIDPHPVKDHRGSQQYVGINNTGISTFVAGKRSQHFRWNEIHKINFEGKMFIAHL---SYTDASREPKKHTVGFKCPTGAACRYLWRCAIEQMLFFTLPNSQSAA-VISGGGFFSWGTKFRYTGRTEREI 326          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: yrt (gene:FBgn0004049 transcript:FBtr0114375)

HSP 1 Score: 153.68 bits (387), Expect = 2.583e-38
Identity = 102/334 (30.54%), Postives = 168/334 (50.30%), Query Frame = 1
Query:  235 CRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQST 1236
            CRV  L+  +  L I++S +  G +L ++V   L DI EKDYFGL++ D +  + W+D ++ +  Q+K            P +    ++K Y + P   LR++   Y  +LQL++DL  GRL    +   +L A A+QSE+GDYD+      ++S  + +P      E  I D +K   GLTP + E  FL KA  LD YGV+   V  + G   ++GLT  G+  F+  ++  LF W  I+K+ F+ K   + V  D+   ++  +++H   F+     A   LWK A +   FF L   +  K   +    F+    F+++GR + +  Q +
Sbjct:   60 CRVILLDNTD--LSIELSKKALGSFLYEQVFYAL-DIIEKDYFGLQFMDANHVKHWLDPTKPIKKQVK----------IGPPYTFRLKVKFYSSEP-NTLREELTRYLFFLQLKQDLLEGRLDCPEDKATELCALALQSELGDYDNQEHSAATVSEFRFVPEQTEDLEIAILDEYKTCRGLTPAQAETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIVIEDD---DEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLR--APVKGPSARQNFFRMGSRFRYSGRTEFQTTQQS 374          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: yrt (gene:FBgn0004049 transcript:FBtr0114376)

HSP 1 Score: 153.295 bits (386), Expect = 4.860e-38
Identity = 102/332 (30.72%), Postives = 167/332 (50.30%), Query Frame = 1
Query:  235 CRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQ 1230
            CRV  L+  +  L I++S +  G +L ++V   L DI EKDYFGL++ D +  + W+D ++ +  Q+K            P +    ++K Y + P   LR++   Y  +LQL++DL  GRL    +   +L A A+QSE+GDYD+      ++S  + +P      E  I D +K   GLTP + E  FL KA  LD YGV+   V  + G   ++GLT  G+  F+  ++  LF W  I+K+ F+ K   + V  D+   ++  +++H   F+     A   LWK A +   FF L   +  K   +    F+    F+++GR + +  Q
Sbjct:   60 CRVILLDNTD--LSIELSKKALGSFLYEQVFYAL-DIIEKDYFGLQFMDANHVKHWLDPTKPIKKQVK----------IGPPYTFRLKVKFYSSEP-NTLREELTRYLFFLQLKQDLLEGRLDCPEDKATELCALALQSELGDYDNQEHSAATVSEFRFVPEQTEDLEIAILDEYKTCRGLTPAQAETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIVIEDD---DEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLR--APVKGPSARQNFFRMGSRFRYSGRTEFQTTQ 372          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: yrt (gene:FBgn0004049 transcript:FBtr0082793)

HSP 1 Score: 153.68 bits (387), Expect = 4.951e-38
Identity = 102/332 (30.72%), Postives = 167/332 (50.30%), Query Frame = 1
Query:  235 CRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQ 1230
            CRV  L+  +  L I++S +  G +L ++V   L DI EKDYFGL++ D +  + W+D ++ +  Q+K            P +    ++K Y + P   LR++   Y  +LQL++DL  GRL    +   +L A A+QSE+GDYD+      ++S  + +P      E  I D +K   GLTP + E  FL KA  LD YGV+   V  + G   ++GLT  G+  F+  ++  LF W  I+K+ F+ K   + V  D+   ++  +++H   F+     A   LWK A +   FF L   +  K   +    F+    F+++GR + +  Q
Sbjct:   60 CRVILLDNTD--LSIELSKKALGSFLYEQVFYAL-DIIEKDYFGLQFMDANHVKHWLDPTKPIKKQVK----------IGPPYTFRLKVKFYSSEP-NTLREELTRYLFFLQLKQDLLEGRLDCPEDKATELCALALQSELGDYDNQEHSAATVSEFRFVPEQTEDLEIAILDEYKTCRGLTPAQAETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIVIEDD---DEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLR--APVKGPSARQNFFRMGSRFRYSGRTEFQTTQ 372          
BLAST of FERM domain-containing protein vs. Ensembl Fly
Match: yrt (gene:FBgn0004049 transcript:FBtr0114374)

HSP 1 Score: 153.295 bits (386), Expect = 5.452e-38
Identity = 102/332 (30.72%), Postives = 167/332 (50.30%), Query Frame = 1
Query:  235 CRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQ 1230
            CRV  L+  +  L I++S +  G +L ++V   L DI EKDYFGL++ D +  + W+D ++ +  Q+K            P +    ++K Y + P   LR++   Y  +LQL++DL  GRL    +   +L A A+QSE+GDYD+      ++S  + +P      E  I D +K   GLTP + E  FL KA  LD YGV+   V  + G   ++GLT  G+  F+  ++  LF W  I+K+ F+ K   + V  D+   ++  +++H   F+     A   LWK A +   FF L   +  K   +    F+    F+++GR + +  Q
Sbjct:   60 CRVILLDNTD--LSIELSKKALGSFLYEQVFYAL-DIIEKDYFGLQFMDANHVKHWLDPTKPIKKQVK----------IGPPYTFRLKVKFYSSEP-NTLREELTRYLFFLQLKQDLLEGRLDCPEDKATELCALALQSELGDYDNQEHSAATVSEFRFVPEQTEDLEIAILDEYKTCRGLTPAQAETAFLNKAKWLDMYGVDMHTVLGKDGCEYHLGLTPTGILVFERDQKIGLFFWPKISKLDFKKKKLTLIVIEDD---DEGREQEHTFVFRLYNEKACKHLWKCAVEHHTFFRLR--APVKGPSARQNFFRMGSRFRYSGRTEFQTTQ 372          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: frmd3 (FERM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-070523-1])

HSP 1 Score: 219.164 bits (557), Expect = 9.075e-64
Identity = 135/364 (37.09%), Postives = 200/364 (54.95%), Query Frame = 1
Query:  193 KMLKQKSEQIS----DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLN 1269
            KML+ +S  +S    +  C V+ L+++E  +   +  +  GQ+L+D VC     + EKDYFG+RY D DKQR W+D S+ V  Q+K ++  + C          FR+K YP  PI+ ++++   Y LYLQL++D+Y GRLL    D   L A  VQ+E+GDYD        +S+ KL P  + K E KI +IH+N L G  P+  E   L++A  LDTYGV+P   KD  G+  ++G T  G   FQG++R HL KWAD++K  F+GK F +              KK VL F   T  A   LWK   +   F+   +SS+ K V S   IF K   F+++GR  KE+ +++S +  + P ++
Sbjct:    2 KMLRFRSPSLSSLALELQCTVRLLDDSE--ISCSIQRDTKGQFLVDHVCNHYS-LLEKDYFGIRYVDPDKQRHWLDPSKPVVKQMKCQQPYTMC----------FRVKFYPQEPIK-IKEELTRYLLYLQLKRDVYHGRLLCPFADAAYLGACIVQAELGDYDPEEHPADYISDFKLFPKQSLKLERKIMEIHQNELRGQCPSLAELNLLQRAHTLDTYGVDPHPCKDFTGSTAFLGFTARGFVVFQGNKRIHLLKWADVSKFKFEGKTFYV------------IGKKLVLTFHTSTPAACKHLWKCGVENQAFYKCAKSSQIKTV-SSSSIFFKGSRFRYSGRVAKEVIEASSKIQRDPPVVH 338          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: FRMD5 (si:ch211-69m14.1 [Source:ZFIN;Acc:ZDB-GENE-050419-226])

HSP 1 Score: 223.016 bits (567), Expect = 3.187e-63
Identity = 123/358 (34.36%), Postives = 195/358 (54.47%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            ++ C V+ L++ E      +  +  GQ+L D +C  L ++ EKDYFG+RY D DKQR W++ ++++  Q+K +          P F +  R+K YP  P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E +I +IHK  L G TP   E KFL+KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F        I+ NQ+  KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ + ++ +    P ++    +  R+
Sbjct:   17 EYMCTVRLLDDTE--YTCTIQRDAKGQYLFDLICHHL-NLLEKDYFGIRYVDPDKQRHWLEFTKSISKQMKSQ----------PPFTMCLRVKFYPPDPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAAMLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERRIAEIHKTELIGQTPETSELKFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGKTF-------HIYANQKEDKKIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMEQSAKIKREPPEIHRAGLVPSRS 352          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: frmd5 (FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-060810-165])

HSP 1 Score: 213.001 bits (541), Expect = 4.913e-60
Identity = 117/358 (32.68%), Postives = 191/358 (53.35%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            +F C V+ L+++E      V  +  G WL ++VC+ L ++ EKDYFG+R+ D DKQR W++ S+ +  Q++ +          P + +  R+K YP  P   L+++   Y L+LQ+++DLY GRLL +S+D   LAA+ +Q+EIGDYD         S  +  P  + + E +I +IHK+ L G +P   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG+RR H  KW ++ K+ F+ K F        I+   Q  +K +L +   T  A   LWK   +   F+   +SS+ + V S    FK  + F+++G+  KE+ + ++ +    P ++    +  R+
Sbjct:   16 EFNCTVRLLDDSE--YTCTVQRDAKGHWLFEQVCQHL-NLLEKDYFGIRFVDPDKQRHWLEFSKPITKQMRSQ----------PPYTMCLRVKFYPPDPAA-LKEEITRYLLFLQIKRDLYHGRLLCKSSDAATLAAFILQAEIGDYDPGKHPEGYSSKFQFFPKHSERLERRIAEIHKSELTGQSPETSELNFLRKAQTLETYGVDPHPCKDVSGNTAFLAFTPFGFVVLQGNRRIHFLKWNEVTKLKFEAKTF-------HIYATHQEDQKIILTYFAPTPEACKHLWKCGVENQAFYQFEKSSQVRTVSSSNLFFKGSR-FRYSGKVAKEVMEQSAKIRREPPEIHRAGMVPSRS 351          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: frmd5 (FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-060810-165])

HSP 1 Score: 212.616 bits (540), Expect = 5.692e-60
Identity = 117/358 (32.68%), Postives = 191/358 (53.35%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            +F C V+ L+++E      V  +  G WL ++VC+ L ++ EKDYFG+R+ D DKQR W++ S+ +  Q++ +          P + +  R+K YP  P   L+++   Y L+LQ+++DLY GRLL +S+D   LAA+ +Q+EIGDYD         S  +  P  + + E +I +IHK+ L G +P   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG+RR H  KW ++ K+ F+ K F        I+   Q  +K +L +   T  A   LWK   +   F+   +SS+ + V S    FK  + F+++G+  KE+ + ++ +    P ++    +  R+
Sbjct:   16 EFNCTVRLLDDSE--YTCTVQRDAKGHWLFEQVCQHL-NLLEKDYFGIRFVDPDKQRHWLEFSKPITKQMRSQ----------PPYTMCLRVKFYPPDPAA-LKEEITRYLLFLQIKRDLYHGRLLCKSSDAATLAAFILQAEIGDYDPGKHPEGYSSKFQFFPKHSERLERRIAEIHKSELTGQSPETSELNFLRKAQTLETYGVDPHPCKDVSGNTAFLAFTPFGFVVLQGNRRIHFLKWNEVTKLKFEAKTF-------HIYATHQEDQKIILTYFAPTPEACKHLWKCGVENQAFYQFEKSSQVRTVSSSNLFFKGSR-FRYSGKVAKEVMEQSAKIRREPPEIHRAGMVPSRS 351          
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Match: frmd5 (FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-060810-165])

HSP 1 Score: 212.616 bits (540), Expect = 2.183e-59
Identity = 117/358 (32.68%), Postives = 191/358 (53.35%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            +F C V+ L+++E      V  +  G WL ++VC+ L ++ EKDYFG+R+ D DKQR W++ S+ +  Q++ +          P + +  R+K YP  P   L+++   Y L+LQ+++DLY GRLL +S+D   LAA+ +Q+EIGDYD         S  +  P  + + E +I +IHK+ L G +P   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG+RR H  KW ++ K+ F+ K F        I+   Q  +K +L +   T  A   LWK   +   F+   +SS+ + V S    FK  + F+++G+  KE+ + ++ +    P ++    +  R+
Sbjct:   16 EFNCTVRLLDDSE--YTCTVQRDAKGHWLFEQVCQHL-NLLEKDYFGIRFVDPDKQRHWLEFSKPITKQMRSQ----------PPYTMCLRVKFYPPDPAA-LKEEITRYLLFLQIKRDLYHGRLLCKSSDAATLAAFILQAEIGDYDPGKHPEGYSSKFQFFPKHSERLERRIAEIHKSELTGQSPETSELNFLRKAQTLETYGVDPHPCKDVSGNTAFLAFTPFGFVVLQGNRRIHFLKWNEVTKLKFEAKTF-------HIYATHQEDQKIILTYFAPTPEACKHLWKCGVENQAFYQFEKSSQVRTVSSSNLFFKGSR-FRYSGKVAKEVMEQSAKIRREPPEIHRAGMVPSRS 351          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: mertk (MER proto-oncogene, tyrosine kinase [Source:Xenbase;Acc:XB-GENE-493221])

HSP 1 Score: 214.157 bits (544), Expect = 5.521e-60
Identity = 120/356 (33.71%), Postives = 195/356 (54.78%), Query Frame = 1
Query:  232 TCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
             C V+ L++ E      V  +  GQ L D +C  L ++ EKDYFG+RY D +KQR W++ ++ +  Q++ +          P +++ FR+K YP  P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  + LP  + K E +I +IH+N L GL P   E  FL KA  L+TYGV+P   KD  GN+ ++  T  G    QG++R H  KW D  K+ F+GK F ++V        ++ +K+ VL +      A   LWK   +   F+ L  S++ + V S    FK  + F+++GR  KE+ +S++++  + P ++    +  R+
Sbjct:   18 VCPVRMLDDWE--YTCNVQKDAKGQQLFDFLCHHL-NLLEKDYFGIRYVDPEKQRHWLEFTKGIAKQMRAR----------PPYVMCFRVKFYPPDPAA-LKEEITRYLVFLQVKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFLPKHSEKLERRIAEIHRNELSGLNPAASELCFLRKAQTLETYGVDPHPCKDASGNSAFLAFTPFGFIVLQGNKRVHFIKWGDATKMKFEGKTFNLYV-------REKEEKRLVLTYVAPNPEACKHLWKCGVENQSFYKLENSNQVRTVSSSNLFFKGSR-FRYSGRVAKEVMESSAMIKRDPPEIHRAGMVPSRS 351          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: mertk (MER proto-oncogene, tyrosine kinase [Source:Xenbase;Acc:XB-GENE-493221])

HSP 1 Score: 213.001 bits (541), Expect = 1.709e-59
Identity = 115/329 (34.95%), Postives = 187/329 (56.84%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGI 1284
            GQ L D +C  L ++ EKDYFG+RY D +KQR W++ ++ +  Q++ +          P +++ FR+K YP  P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  + LP  + K E +I +IH+N L GL P   E  FL KA  L+TYGV+P   KD  GN+ ++  T  G    QG++R H  KW D  K+ F+GK F ++V        ++ +K+ VL +      A   LWK   +   F+ L  S++ + V S    FK  + F+++GR  KE+ +S++++  + P ++ ++G+
Sbjct:   53 GQQLFDFLCHHL-NLLEKDYFGIRYVDPEKQRHWLEFTKGIAKQMRAR----------PPYVMCFRVKFYPPDPAA-LKEEITRYLVFLQVKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFLPKHSEKLERRIAEIHRNELSGLNPAASELCFLRKAQTLETYGVDPHPCKDASGNSAFLAFTPFGFIVLQGNKRVHFIKWGDATKMKFEGKTFNLYV--------REKEKRLVLTYVAPNPEACKHLWKCGVENQSFYKLENSNQVRTVSSSNLFFKGSR-FRYSGRVAKEVMESSAMIKRDPPEIHRMSGL 360          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:779965])

HSP 1 Score: 211.846 bits (538), Expect = 8.160e-59
Identity = 125/349 (35.82%), Postives = 191/349 (54.73%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLN 1269
            D  C ++ L++ E  +   +  +  GQ+LLD +C    ++ EKDYFG+R+ D +KQR W+D S+ V  Q+K            P + + FR+K YP  P++ ++++   Y LYLQ+++D++ GRLL    D   L A  VQ+EIGDYD        + + K+ P  + K E KI +IHKN L G +P+  E   L KA  L+TYGV+P   KD  G   ++G T  G   FQG++R HL KW DI K+ F GK F  HV +       Q +KK++L +   T  A   LWK   +   F+   +SS+ K V S   IF K   F++ G+  KE+ +++S +  + P ++
Sbjct:   30 DMRCTIRLLDDTE--ISFNIQRDTKGQFLLDYICNHY-NLLEKDYFGIRFVDPEKQRHWLDPSKPVAKQMKSH----------PPYTMCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCCFADAAFLGACIVQAEIGDYDPDEHPDNYICDFKIFPKQSQKLERKIVEIHKNELRGQSPSVSEFNLLLKAHSLETYGVDPHPCKDSTGTTTFLGYTAAGFVVFQGNKRIHLIKWPDICKMKFDGKTF--HVVV------MQKEKKNILTYHTSTPAACKHLWKCGVENQAFYKYAKSSQVKTVTS-SNIFFKGSRFRYCGKVAKEVVEASSKIQRDPPEVH 355          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:779965])

HSP 1 Score: 208.764 bits (530), Expect = 2.087e-58
Identity = 124/347 (35.73%), Postives = 190/347 (54.76%), Query Frame = 1
Query:  235 CRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNG 1272
            C ++ L++ E  +   +  +  GQ+LLD +C    ++ EKDYFG+R+ D +KQR W+D S+ V  Q+K            P + + FR+K YP  P++ ++++   Y LYLQ+++D++ GRLL    D   L A  VQ+EIGDYD        + + K+ P  + K E KI +IHKN L G +P+  E   L KA  L+TYGV+P   KD  G   ++G T  G   FQG++R HL KW DI K+ F GK F  HV +       Q +KK++L +   T  A   LWK   +   F+   +SS+ K V S   IF K   F++ G+  KE+ +++S +  + P ++ 
Sbjct:    3 CTIRLLDDTE--ISFNIQRDTKGQFLLDYICNHY-NLLEKDYFGIRFVDPEKQRHWLDPSKPVAKQMKSH----------PPYTMCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCCFADAAFLGACIVQAEIGDYDPDEHPDNYICDFKIFPKQSQKLERKIVEIHKNELRGQSPSVSEFNLLLKAHSLETYGVDPHPCKDSTGTTTFLGYTAAGFVVFQGNKRIHLIKWPDICKMKFDGKTF--HVVV------MQKEKKNILTYHTSTPAACKHLWKCGVENQAFYKYAKSSQVKTVTS-SNIFFKGSRFRYCGKVAKEVVEASSKIQRDPPEVHS 326          
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:779965])

HSP 1 Score: 210.69 bits (535), Expect = 2.116e-58
Identity = 125/349 (35.82%), Postives = 191/349 (54.73%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLN 1269
            D  C ++ L++ E  +   +  +  GQ+LLD +C    ++ EKDYFG+R+ D +KQR W+D S+ V  Q+K            P + + FR+K YP  P++ ++++   Y LYLQ+++D++ GRLL    D   L A  VQ+EIGDYD        + + K+ P  + K E KI +IHKN L G +P+  E   L KA  L+TYGV+P   KD  G   ++G T  G   FQG++R HL KW DI K+ F GK F  HV +       Q +KK++L +   T  A   LWK   +   F+   +SS+ K V S   IF K   F++ G+  KE+ +++S +  + P ++
Sbjct:   30 DMRCTIRLLDDTE--ISFNIQRDTKGQFLLDYICNHY-NLLEKDYFGIRFVDPEKQRHWLDPSKPVAKQMKSH----------PPYTMCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCCFADAAFLGACIVQAEIGDYDPDEHPDNYICDFKIFPKQSQKLERKIVEIHKNELRGQSPSVSEFNLLLKAHSLETYGVDPHPCKDSTGTTTFLGYTAAGFVVFQGNKRIHLIKWPDICKMKFDGKTF--HVVV------MQKEKKNILTYHTSTPAACKHLWKCGVENQAFYKYAKSSQVKTVTS-SNIFFKGSRFRYCGKVAKEVVEASSKIQRDPPEVH 355          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd5 (FERM domain containing 5 [Source:MGI Symbol;Acc:MGI:2442557])

HSP 1 Score: 224.942 bits (572), Expect = 2.219e-64
Identity = 125/358 (34.92%), Postives = 200/358 (55.87%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            +++C V+ L+++E      +  +  GQ+L D +C  L ++ EKDYFG+R+ D DKQR W++ +++V  QL+ +          P F + FR+K YPA P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E KI +IHK  L G TP   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F ++V       +Q+ +KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ +S++ +    P ++    +  R+
Sbjct:   16 EYSCTVRLLDDSE--YTCTIQRDAKGQYLFDLLCHHL-NLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQ----------PPFTMCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYV-------SQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRS 351          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd5 (FERM domain containing 5 [Source:MGI Symbol;Acc:MGI:2442557])

HSP 1 Score: 225.713 bits (574), Expect = 3.930e-64
Identity = 125/358 (34.92%), Postives = 200/358 (55.87%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            +++C V+ L+++E      +  +  GQ+L D +C  L ++ EKDYFG+R+ D DKQR W++ +++V  QL+ +          P F + FR+K YPA P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E KI +IHK  L G TP   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F ++V       +Q+ +KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ +S++ +    P ++    +  R+
Sbjct:   16 EYSCTVRLLDDSE--YTCTIQRDAKGQYLFDLLCHHL-NLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQ----------PPFTMCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYV-------SQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRS 351          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd5 (FERM domain containing 5 [Source:MGI Symbol;Acc:MGI:2442557])

HSP 1 Score: 219.935 bits (559), Expect = 1.043e-62
Identity = 121/333 (36.34%), Postives = 187/333 (56.16%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            GQ+L D +C  L ++ EKDYFG+R+ D DKQR W++ +++V  QL+ +          P F + FR+K YPA P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E KI +IHK  L G TP   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F ++V       +Q+ +KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ +S++ +    P ++    +  R+
Sbjct:   31 GQYLFDLLCHHL-NLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQ----------PPFTMCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYV-------SQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRS 343          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd5 (FERM domain containing 5 [Source:MGI Symbol;Acc:MGI:2442557])

HSP 1 Score: 218.394 bits (555), Expect = 4.014e-62
Identity = 121/333 (36.34%), Postives = 187/333 (56.16%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            GQ+L D +C  L ++ EKDYFG+R+ D DKQR W++ +++V  QL+ +          P F + FR+K YPA P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E KI +IHK  L G TP   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F ++V       +Q+ +KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ +S++ +    P ++    +  R+
Sbjct:   31 GQYLFDLLCHHL-NLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQ----------PPFTMCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYV-------SQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRS 343          
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Match: Frmd3 (FERM domain containing 3 [Source:MGI Symbol;Acc:MGI:2442466])

HSP 1 Score: 205.297 bits (521), Expect = 5.918e-57
Identity = 121/367 (32.97%), Postives = 198/367 (53.95%), Query Frame = 1
Query:  193 KMLKQKSEQIS----DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLN 1278
            KM+  +S  I     +  C ++ L+++E  +   +  E  GQ+L++ +C     + EKDYFG+RY D +KQR W++ +++++ Q+K            P + + FR+K YP  P++ ++++   Y LYLQ+++D++ GRLL   +D   L A  VQ+E GDY         +S  ++ P  + K E KI +IH N L G +P   E   L KA  L+TYGV+P   KD +G   ++G T  G   FQG++R HL KW+D+ K+ F+GK F +           Q +K  VL F   T  A   LWK   +   F+   +SS+ K V S   IF K   F+++G+  KE+ +++S +  + P ++ +N
Sbjct:   16 KMIHFRSSSIKSLNQEMKCTIRLLDDSE--VSCHIQRETKGQFLIEYICNYYS-LLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKSH----------PPYTMCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAEFGDYYPDEHPENYISEFEIFPKQSQKLERKIMEIHNNELRGQSPAIAEFNLLLKAHTLETYGVDPHPCKDSRGATAFLGFTAAGFVVFQGNKRIHLRKWSDVCKLKFEGKTFYV--------IGSQKEKNAVLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTV-SSSKIFFKGSRFRYSGKVAKEVVEASSKIQRDPPEVHRVN 359          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7Z6J6|FRMD5_HUMAN (FERM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FRMD5 PE=1 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 7.261e-64
Identity = 126/358 (35.20%), Postives = 201/358 (56.15%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            +++C V+ L+++E      +  +  GQ+L D +C  L ++ EKDYFG+R+ D DKQR W++ +++V  QL+ +          P F + FR+K YPA P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYDS        S  +  P  + K E KI +IHK  L G TP   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F ++V       +Q+ +KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ +S++ +    P ++    +  R+
Sbjct:   16 EYSCTVRLLDDSE--YTCTIQRDAKGQYLFDLLCHHL-NLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQ----------PPFTMCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDSGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYV-------SQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRS 351          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P5H6|FRMD5_MOUSE (FERM domain-containing protein 5 OS=Mus musculus OX=10090 GN=Frmd5 PE=1 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.552e-63
Identity = 125/358 (34.92%), Postives = 200/358 (55.87%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            +++C V+ L+++E      +  +  GQ+L D +C  L ++ EKDYFG+R+ D DKQR W++ +++V  QL+ +          P F + FR+K YPA P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E KI +IHK  L G TP   E  FL KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F ++V       +Q+ +KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ +S++ +    P ++    +  R+
Sbjct:   16 EYSCTVRLLDDSE--YTCTIQRDAKGQYLFDLLCHHL-NLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQLRSQ----------PPFTMCFRVKFYPADPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLEKKIAEIHKTELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKLKFEGKTFYLYV-------SQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRS 351          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0P4Q4|FRMD3_XENTR (FERM domain-containing protein 3 OS=Xenopus tropicalis OX=8364 GN=frmd3 PE=2 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 1.121e-57
Identity = 125/349 (35.82%), Postives = 191/349 (54.73%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLN 1269
            D  C ++ L++ E  +   +  +  GQ+LLD +C    ++ EKDYFG+R+ D +KQR W+D S+ V  Q+K            P + + FR+K YP  P++ ++++   Y LYLQ+++D++ GRLL    D   L A  VQ+EIGDYD        + + K+ P  + K E KI +IHKN L G +P+  E   L KA  L+TYGV+P   KD  G   ++G T  G   FQG++R HL KW DI K+ F GK F  HV +       Q +KK++L +   T  A   LWK   +   F+   +SS+ K V S   IF K   F++ G+  KE+ +++S +  + P ++
Sbjct:   30 DMRCTIRLLDDTE--ISFNIQRDTKGQFLLDYICNHY-NLLEKDYFGIRFVDPEKQRHWLDPSKPVAKQMKSH----------PPYTMCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCCFADAAFLGACIVQAEIGDYDPDEHPDNYICDFKIFPKQSQKLERKIVEIHKNELRGQSPSVSEFNLLLKAHSLETYGVDPHPCKDSTGTTTFLGYTAAGFVVFQGNKRIHLIKWPDICKMKFDGKTF--HVVV------MQKEKKNILTYHTSTPAACKHLWKCGVENQAFYKYAKSSQVKTVTS-SNIFFKGSRFRYCGKVAKEVVEASSKIQRDPPEVH 355          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BHD4|FRMD3_MOUSE (FERM domain-containing protein 3 OS=Mus musculus OX=10090 GN=Frmd3 PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 1.809e-55
Identity = 121/367 (32.97%), Postives = 198/367 (53.95%), Query Frame = 1
Query:  193 KMLKQKSEQIS----DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLN 1278
            KM+  +S  I     +  C ++ L+++E  +   +  E  GQ+L++ +C     + EKDYFG+RY D +KQR W++ +++++ Q+K            P + + FR+K YP  P++ ++++   Y LYLQ+++D++ GRLL   +D   L A  VQ+E GDY         +S  ++ P  + K E KI +IH N L G +P   E   L KA  L+TYGV+P   KD +G   ++G T  G   FQG++R HL KW+D+ K+ F+GK F +           Q +K  VL F   T  A   LWK   +   F+   +SS+ K V S   IF K   F+++G+  KE+ +++S +  + P ++ +N
Sbjct:   16 KMIHFRSSSIKSLNQEMKCTIRLLDDSE--VSCHIQRETKGQFLIEYICNYYS-LLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKSH----------PPYTMCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAEFGDYYPDEHPENYISEFEIFPKQSQKLERKIMEIHNNELRGQSPAIAEFNLLLKAHTLETYGVDPHPCKDSRGATAFLGFTAAGFVVFQGNKRIHLRKWSDVCKLKFEGKTFYV--------IGSQKEKNAVLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTV-SSSKIFFKGSRFRYSGKVAKEVVEASSKIQRDPPEVHRVN 359          
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R803|FRMD3_PONAB (FERM domain-containing protein 3 OS=Pongo abelii OX=9601 GN=FRMD3 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.207e-54
Identity = 125/374 (33.42%), Postives = 201/374 (53.74%), Query Frame = 1
Query:  193 KMLKQKSEQISDFT----CRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNT 1299
            KM+  +S  I   +    C ++ L+++E  +   +  E  GQ+L+D +C     + EKDYFG+RY D +KQR W++ +++++ Q+K            P + + FR+K YP  P++ ++++   Y LYLQ+++D++ GRLL   +D   L A  VQ+E+GDYD        +S  ++ P  + K E KI +IHKN L G +P   E   L KA  L+TYGV+P   KD  G   ++G T  G   FQG++R HL KW D+ K+ F+GK F +           Q +KK +L F   T  A   LWK   +   F+   +SS+ K V S   IF K   F+++G+  KE+ +++S +    P ++  N    R++
Sbjct:   16 KMIHFRSSSIKSLSQEMRCTIRLLDDSE--ISCHIQRETKGQFLIDHICNYYS-LLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKTH----------PPYTMCFRVKFYPHEPLK-IKEELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFPKQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFTAAGFVVFQGNKRIHLIKWPDVCKLKFEGKTFYV--------IGTQKEKKAMLAFHTSTPAACKHLWKCGVENQAFYKYAKSSQIKTV-SSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPEVHRANITQSRSS 366          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A0R3U2V5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS837 PE=4 SV=2)

HSP 1 Score: 358.221 bits (918), Expect = 4.134e-104
Identity = 175/344 (50.87%), Postives = 241/344 (70.06%), Query Frame = 1
Query:  229 FTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKD--KRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXT---EAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLL 1245
            FT  VK L++ + PL + VS    GQWL DEV  RLG + E++YFGLRY DK KQRQW+DLS+ VY QLK+   RT++F            R+KHYP  P+ +L+Q+++ YFLYLQLR+DL+SGRL+GR+ND++ LAA+ +Q+EIGD +     +    +L  L    + T   EAKI +I++ L GL+  E E KFLE+AS+L+TYGVEP +V+D+KGN+ YVGL+HEGV+ F+G+R+AH+F W+ I +I F GKLFII V        +  +++H LGFKC+T  AA ALWKWA DR CFF+L RS++AK+ K+ G  F+KR+ + F GRCQ+E+QQ TS L
Sbjct:  236 FTVEVKLLSDEQQPLLVDVSASALGQWLFDEVINRLGGVLEREYFGLRYLDKSKQRQWLDLSKTVYKQLKNVCPRTLNF------------RVKHYPGKPLGELKQEKSRYFLYLQLRRDLHSGRLIGRNNDMHVLAAHILQAEIGDIEKLDGFLGENGSLADLKMFENMTPRVEAKIREIYRCLHGLSTAEAEAKFLERASELETYGVEPVFVQDRKGNHFYVGLSHEGVTAFRGNRKAHVFTWSKIHRISFDGKLFIIQV--------EWERRRHTLGFKCQTTEAAEALWKWAVDRQCFFTLTRSTDAKKAKASGRFFRKRQLYSFTGRCQREMQQMTSSL 559          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A068WUP1 (FERM domain containing protein 5 OS=Echinococcus granulosus OX=6210 GN=EgrG_000343200 PE=4 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 3.003e-100
Identity = 170/352 (48.30%), Postives = 244/352 (69.32%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXT---EAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQ-STSLLSMNNPSLN---GLNGIGRRNTILRDTVQIEDID 1335
            GQWL DEV  +LG + E DYFGLRY DK+KQRQW+DLS+ VY QLK     S          ++FR+KHYPA P+E+L+Q+++ Y LYLQLR+DL+SGRL+GR+ND++ LAA+ +Q+EIGD D   + + +  +L  L    + T   E KI +++K L GL+ +E E KFLE+AS ++TYGVEP +V+D+KGN+ YVGL+HEGV+ F+G+R+AH+F W  I +I + GKLF+I V        +  +++H LGFKC+T  AA ALWKWA DR CFF+LN+S+EAK  K+ G +F+KR+ + F GRCQKE+ Q +TS+ ++  PS++    L  I R  ++ R  +  E ++
Sbjct:   43 GQWLFDEVINQLGGLLESDYFGLRYLDKNKQRQWLDLSKTVYKQLKHVIPRS----------LNFRVKHYPAKPLEELKQEKSRYCLYLQLRRDLHSGRLIGRNNDMHVLAAHILQAEIGDIDQLEDYLGTNGSLADLKMFENMTPRVEGKIRELYKTLRGLSVSEAEGKFLERASGMETYGVEPVFVQDRKGNHFYVGLSHEGVTAFRGNRKAHVFSWPKIYRISYDGKLFVIQV--------EWEQRRHTLGFKCQTTEAAEALWKWAVDRQCFFTLNKSTEAKTSKARGRLFRKRQLYSFTGRCQKEMLQITTSMPNIPQPSVSRSRSLLNIARSVSLSRQAMSHEQLN 376          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A068Y1N2 (FERM domain containing protein 5 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000343200 PE=4 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 9.452e-100
Identity = 170/352 (48.30%), Postives = 244/352 (69.32%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXT---EAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQ-STSLLSMNNPSLN---GLNGIGRRNTILRDTVQIEDID 1335
            GQWL DEV  +LG + E DYFGLRY DK+KQRQW+DLS+ VY QLK     S          ++FR+KHYPA P+E+L+Q+++ Y LYLQLR+DL+SGRL+GR+ND++ LAA+ +Q+EIGD D   + + +  +L  L    + T   E KI +++K L GL+ +E E KFLE+AS ++TYGVEP +V+D+KGN+ YVGL+HEGV+ F+G+R+AH+F W  I +I + GKLF+I V        +  +++H LGFKC+T  AA ALWKWA DR CFF+LN+S+EAK  K+ G +F+KR+ + F GRCQKE+ Q +TS+ ++  PS++    L  I R  ++ R  +  E ++
Sbjct:   43 GQWLFDEVINQLGGLLESDYFGLRYLDKNKQRQWLDLSKTVYKQLKHVIPRS----------LNFRVKHYPAKPLEELKQEKSRYCLYLQLRRDLHSGRLIGRNNDMHVLAAHILQAEIGDIDQLEDYLGTNGSLADLKMFENMTPRVEGKIRELYKTLRGLSVSEAEGKFLERASGMETYGVEPVFVRDRKGNHFYVGLSHEGVTAFRGNRKAHVFSWPKIYRISYDGKLFVIQV--------EWEQRRHTLGFKCQTAEAAEALWKWAVDRQCFFTLNKSTEAKTSKARGRLFRKRQLYSFTGRCQKEMLQITTSMPNIPQPSVSRSRSLLNIARSVSLSRQAMSHERLN 376          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A4E0RY78 (FERM domain-containing protein 5 OS=Fasciola hepatica OX=6192 GN=D915_002012 PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 1.740e-99
Identity = 181/398 (45.48%), Postives = 266/398 (66.83%), Query Frame = 1
Query:  229 FTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMR---XXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQ-QSTSLLSMNNPSLNGLNGIGRRNTILRDTVQIE---DIDEENKAKYNTMPSRERGTMLGTQ 1401
            F   VK L++ E PL+++V++   G+ L ++V ERL  I  KDYFGLRY D+ KQRQW+++S+ VY QLK          Y     ++FR+KHYP++P+E+  Q++  Y LYLQLR+DL+SGRL+GR+ ++++LAA  +Q+EIGDYD  ++ +    +L++LK+  N+   TEAKI + HK+L G T  E E KFLE AS+ +TYG+EP YV+D+KGN+ Y+GL HEGV TF+GS++AH+F W  I KI ++GKLFII V        +  +++H LGFKC T  +A ALWKWA DR CFF+L+RS +AK  K+ GGIFK+R+ + F GRCQKE+   ++SL S+  PS++    +      +R + Q +   D+D +  A  +++P    G+M G Q
Sbjct:  101 FMVEVKLLSDEEAPLQLEVTNTCLGRALFNQVIERLNGIVAKDYFGLRYLDRAKQRQWLEMSKTVYKQLK----------YVSPRSLNFRVKHYPSNPLEEFTQEKTRYLLYLQLRRDLHSGRLIGRNVEMHRLAACILQAEIGDYDLLADYLGEDGTLADLKMFSNVTPGTEAKIAEFHKSLRGATMEEAENKFLELASKFETYGIEPLYVQDRKGNHFYMGLNHEGVVTFRGSKKAHVFSWQKINKISYEGKLFIIQV--------EWEQRRHTLGFKCPTAESAEALWKWAVDRQCFFTLSRSVDAKESKANGGIFKRRQFYTFTGRCQKELMLLNSSLPSIPQPSVSRSRSLLHLAKGVRQSRQSKSQNDLDRQFGASTDSLPDGHMGSMNGLQ 480          
BLAST of FERM domain-containing protein vs. TrEMBL
Match: A0A4S2MA58 (FERM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002849 PE=4 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.125e-98
Identity = 170/357 (47.62%), Postives = 241/357 (67.51%), Query Frame = 1
Query:  229 FTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYD---------STSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQ-QSTSLLSMNNPSLN 1269
            F   VK L++ E PL+++V++   G+ L ++V ERL  I  KDYFGLRY D++KQRQW+++S+ VY QLK           TP  + +FR+KHYP+ P+ + RQ++  Y LYLQLR+DL+SGRL+GR+ +++ LAA  +Q+EIGDYD          T  D++  +N+         TEAKI ++HK L G +  E E KFLE AS  +TYG+EP YV+D+KGN+ Y+GL+HEGV TF+GSR+AH+F W  I KI ++GKLFII V  ++        ++H LGFKC T  +A ALWKWA DR CFF+L+RS +AK  K+ GGIFK+R+ + F GRCQKE+   ++SL ++  PS++
Sbjct:   76 FMVEVKLLSDEEAPLQLEVTNSCLGRALFNQVIERLNGIVAKDYFGLRYLDRNKQRQWLEMSKTVYKQLKH---------VTPRSL-NFRVKHYPSDPLAEFRQEKTRYLLYLQLRRDLHSGRLIGRNTEMHMLAACILQAEIGDYDVLVDYLGSEGTLADLKMFANVTPR------TEAKICELHKTLKGPSMEEAENKFLEHASHFETYGIEPLYVQDRKGNHFYMGLSHEGVVTFRGSRKAHVFTWHKINKISYEGKLFIIQVEWEQ--------RRHTLGFKCPTAESAEALWKWAVDRQCFFTLSRSVDAKESKANGGIFKRRQFYTFTGRCQKELMLLNSSLPTIPQPSVS 408          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:103044356])

HSP 1 Score: 223.016 bits (567), Expect = 2.665e-63
Identity = 150/485 (30.93%), Postives = 241/485 (49.69%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNTILRDTVQIEDIDEENKAKYNTMP-SRERGTMLGTQDTLDSLFIPNHHGSVDNAASHSPFNTPVDSPKLVERKH-----TESQRNPSLDHIIEEPCIQEHSKLVADDRK---SVHSIMSSRASSSGT 1650
            +F+C V+ L++ E      +  +  GQ+L D +C  L ++ EKDYFG+RY D DKQR W++ ++++  Q+K +          P F +  R+K YP  P   L+++   Y ++LQL++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E +I +IHK  L G TP   E  FL+KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F        ++ NQ+  KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ + ++ +    P ++    +  R+               +  + +++P +R R   +   + L+SL    H   V  + SH     P       E         +   NPS D ++  P + EHS  +A  R+   +  SI   + S +GT
Sbjct:   16 EFSCTVRLLDDTE--YTCTIQRDAKGQYLFDLICHHL-NLLEKDYFGIRYVDPDKQRHWLEFTKSISKQMKSQ----------PPFTMCLRVKFYPPDPAA-LKEEITRYLVFLQLKRDLYHGRLLCKTSDAAILAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERRIAEIHKTELIGQTPETSELNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGKTF-------HVYANQKEDKKIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMEQSAKIKREPPEIHRAGLVPSRSC----------PSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPV-RSVSHGESFIPRSRSHAAEAGDGSAVIADESYNPS-DSVLPTP-VAEHSLELAVSRQINGAPCSIEEEKESEAGT 465          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:103038726])

HSP 1 Score: 222.246 bits (565), Expect = 9.771e-63
Identity = 139/365 (38.08%), Postives = 203/365 (55.62%), Query Frame = 1
Query:  193 KMLKQKSEQIS----DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLF-IIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLN 1269
            KML+ +S  +S    +  C V+ L+++E  L   +  +  GQ+LLD VC     + EKDYFG+RY D +KQR W+D ++ V  Q+K ++  + C          FR+K YP  PI+ ++++   Y LYLQL++DLY GRLL    D   L A  VQ+E+GDYD+       +S+ KL P  + K E KI +IH+N L G  P   E   L++A  LDTYGV+P   KD  G   ++G T  G   FQG++R HL KWAD++K  F+GK F +I V         Q +KK VL F   T  A   LWK   +   F+   +SS+ K V S   IF K   F+++GR  KE+ +++S +  + P ++
Sbjct:    4 KMLRLRSPSVSSLEPELHCTVRLLDDSE--LSCSIQRDTKGQFLLDHVCNHYS-LLEKDYFGIRYVDPEKQRHWLDPTKPVAKQMKCQQPYTMC----------FRVKFYPQEPIK-IKEELTRYLLYLQLKRDLYHGRLLCPFADAAYLGACIVQAELGDYDADEHPSDYISDFKLFPKQSLKLERKIMEIHQNELRGQCPALAELNLLQRAHTLDTYGVDPHPCKDFTGTTAFLGFTARGFMVFQGNKRIHLLKWADVSKYKFEGKTFYVIGV---------QREKKLVLTFHTSTPAACKHLWKCGVENQAFYKCAKSSQIKTV-SSSNIFFKGTRFRYSGRVAKEVIEASSKIQRDPPVVH 344          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:103044356])

HSP 1 Score: 209.92 bits (533), Expect = 1.006e-58
Identity = 116/319 (36.36%), Postives = 175/319 (54.86%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFK 1179
            +F+C V+ L++ E      +  +  GQ+L D +C  L ++ EKDYFG+RY D DKQR W++ ++++  Q+K +          P F +  R+K YP  P   L+++   Y ++LQL++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E +I +IHK  L G TP   E  FL+KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F        ++ NQ+  KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK
Sbjct:   16 EFSCTVRLLDDTE--YTCTIQRDAKGQYLFDLICHHL-NLLEKDYFGIRYVDPDKQRHWLEFTKSISKQMKSQ----------PPFTMCLRVKFYPPDPAA-LKEEITRYLVFLQLKRDLYHGRLLCKTSDAAILAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERRIAEIHKTELIGQTPETSELNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGKTF-------HVYANQKEDKKIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFK 313          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:103038726])

HSP 1 Score: 172.17 bits (435), Expect = 3.109e-45
Identity = 123/367 (33.51%), Postives = 186/367 (50.68%), Query Frame = 1
Query:  193 KMLKQKSEQIS----DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN----LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLN 1269
            KML+ +S  +S    +  C V+ L+++E  L   +  +  GQ+LLD VC     + EKDYFG+RY D +KQR W+D ++ V  Q+K ++  + C          FR+K YP  PI+ ++++   Y LYLQL++DLY GRLL    D   L A  VQ+E+GDYD+       +S+ KL P  + K E KI +IH+N    L G+  +      L     +D Y     +++D  G   ++G T  G   FQG++R HL KW                    + F N Q  KK VL F   T  A   LWK   +   F+   +SS+ K V S   IF K   F+++GR  KE+ +++S +  + P ++
Sbjct:   18 KMLRLRSPSVSSLEPELHCTVRLLDDSE--LSCSIQRDTKGQFLLDHVCNHYS-LLEKDYFGIRYVDPEKQRHWLDPTKPVAKQMKCQQPYTMC----------FRVKFYPQEPIK-IKEELTRYLLYLQLKRDLYHGRLLCPFADAAYLGACIVQAELGDYDADEHPSDYISDFKLFPKQSLKLERKIMEIHQNELSFLVGIFFSYFVFSKLFHFYSVDAYA----FLQDFTGTTAFLGFTARGFMVFQGNKRIHLLKWY-------------------KNFGNLQ--KKLVLTFHTSTPAACKHLWKCGVENQAFYKCAKSSQIKTV-SSSNIFFKGTRFRYSGRVAKEVIEASSKIQRDPPVVH 344          
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:103044356])

HSP 1 Score: 165.236 bits (417), Expect = 8.191e-44
Identity = 129/439 (29.38%), Postives = 205/439 (46.70%), Query Frame = 1
Query:  487 VSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNTILRDTVQIEDIDEENKAKYNTMP-SRERGTMLGTQDTLDSLFIPNHHGSVDNAASHSPFNTPVDSPKLVERKH-----TESQRNPSLDHIIEEPCIQEHSKLVADDRK---SVHSIMSSRASSSGTLYDLVDGNSLQSKLSSSHGDIANALEQLQIAVTDAVDQRVA 1773
            +  R+K YP  P   L+++   Y ++LQL++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E +I +IHK  L G TP   E  FL+KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F        ++ NQ+  KK +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++GR  KE+ + ++ +    P ++    +  R+               +  + +++P +R R   +   + L+SL    H   V  + SH     P       E         +   NPS D ++  P + EHS  +A  R+   +  SI   + S +GT         +  +L     D + A   LQ+A     +Q  A
Sbjct:    1 MCLRVKFYPPDPAA-LKEEITRYLVFLQLKRDLYHGRLLCKTSDAAILAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERRIAEIHKTELIGQTPETSELNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGKTF-------HVYANQKEDKKIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGRVAKEVMEQSAKIKREPPEIHRAGLVPSRSC----------PSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPV-RSVSHGESFIPRSRSHAAEAGDGSAVIADESYNPS-DSVLPTP-VAEHSLELAVSRQINGAPCSIEEEKESEAGT--------PMGGELGELGAD-SRAAGSLQVAALSEAEQPAA 408          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: frmd3 (FERM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-070523-1])

HSP 1 Score: 199.904 bits (507), Expect = 5.727e-56
Identity = 118/336 (35.12%), Postives = 187/336 (55.65%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNTIL 1305
            G++L+D VC  L D+ E+DYFG+R+ D DKQR W+D  +++  Q+K +          P F + FR+K YP  P   +R++   Y LYLQ+++D+  GRLL  +++   L A  +Q+E+GDY+        +S ++L P L+ K EA++ +IH++ L G TP   E  FL +A  LDTY V+P   KD  G  +++G T  G   FQG++R  L KW D+ K+ ++GK F IH          Q++KK VL +   T  A   LWK   +   F+   +S E K V S    F+  + F++ GR  KE+ ++++ +   +P +   N IG+  + L
Sbjct:    9 GRFLMDHVCNHL-DLLERDYFGIRFVDPDKQRHWLDPKKSIVRQMKCQ----------PPFTMCFRVKFYPQEP-SKVREEITRYQLYLQIKRDVVHGRLLCPTSEAAWLGACILQAELGDYNPLDHHDGYVSAMQLFPRLSQKLEARVAEIHRHELRGQTPAVAEINFLIRAQGLDTYTVDPHPCKDPSGATVFLGFTPAGFVGFQGNKRVQLLKWMDVGKLKYEGKSFYIH--------GVQNRKKTVLTYHAPTPSACKHLWKCGVENQAFYKFEKSCEIKTVLSSNLFFRGSR-FRYRGRVAKEVIEASARIQRKSPEVQ-RNSIGKSRSSL 322          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 138.658 bits (348), Expect = 7.576e-36
Identity = 94/305 (30.82%), Postives = 151/305 (49.51%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQ 1215
            GQ L D+V   L DI E DYFGL++ D  +   W+D ++N+  Q+K            P +    R+K Y + P  +L ++   Y   LQL++D+ SG+L        QLA Y++Q+E+GD D    +   +S  + +P+ + + E  I +  K+  G TP + E  +L KA  L+ YGV+   VK + GN   +GLT  GV  F+G  +  LF W  I ++ F+     + V  D   ++Q  +++H   F+ +   A   LWK A +   FF L   S+     S     +    F+F+GR +
Sbjct:    5 GQDLFDQVMYHL-DILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVK----------IGPPYCFHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNPALVSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVED---DDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSKTNADPS--SFIRMGSRFRFSGRTE 292          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 138.272 bits (347), Expect = 1.110e-35
Identity = 94/305 (30.82%), Postives = 151/305 (49.51%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQ 1215
            GQ L D+V   L DI E DYFGL++ D  +   W+D ++N+  Q+K            P +    R+K Y + P  +L ++   Y   LQL++D+ SG+L        QLA Y++Q+E+GD D    +   +S  + +P+ + + E  I +  K+  G TP + E  +L KA  L+ YGV+   VK + GN   +GLT  GV  F+G  +  LF W  I ++ F+     + V  D   ++Q  +++H   F+ +   A   LWK A +   FF L   S+     S     +    F+F+GR +
Sbjct:    5 GQDLFDQVMYHL-DILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVK----------IGPPYCFHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNPALVSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVED---DDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSKTNADPS--SFIRMGSRFRFSGRTE 292          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 138.272 bits (347), Expect = 1.175e-35
Identity = 94/305 (30.82%), Postives = 151/305 (49.51%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQ 1215
            GQ L D+V   L DI E DYFGL++ D  +   W+D ++N+  Q+K            P +    R+K Y + P  +L ++   Y   LQL++D+ SG+L        QLA Y++Q+E+GD D    +   +S  + +P+ + + E  I +  K+  G TP + E  +L KA  L+ YGV+   VK + GN   +GLT  GV  F+G  +  LF W  I ++ F+     + V  D   ++Q  +++H   F+ +   A   LWK A +   FF L   S+     S     +    F+F+GR +
Sbjct:    5 GQDLFDQVMYHL-DILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVK----------IGPPYCFHMRVKFYSSEP-NNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNPALVSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVED---DDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSKTNADPS--SFIRMGSRFRFSGRTE 292          
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001312.1 (pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 gene:ENSPMAG00000001156.1 transcript:ENSPMAT00000001312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.354 bits (355), Expect = 8.087e-35
Identity = 96/333 (28.83%), Postives = 160/333 (48.05%), Query Frame = 1
Query:  235 CRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQR-QWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQ 1230
            C +  L+     + ++ +   +G+ LLD V   L D+ E DYFGL+++D   +  +W+D ++ +  Q+K           +  +I +FR+K +   P   L+++   Y  +LQLR D+   RL    N    LA+Y VQSE+GDY  T      LS+L+ LP      E ++  +HK   G+TP + E  +L  A  ++ YGVE  Y +DQ    + VG+T  GV+ +    R   F W  I KI F+ K F +     ++   Q   +++++GF      A   LWK   +   FF + R +    +      F     F+++GR + +  Q
Sbjct:   31 CHINLLDNTA--ITLRANKSEAGKALLDAVFAHL-DLAETDYFGLQFADDSTETPRWLDPTKPLRKQIKR----------SSPYIFNFRVKFFVTDP-SKLQEEYTRYHYFLQLRNDILEARLPCPHNTAALLASYIVQSELGDYSETEHLPGYLSDLRFLPRQGLDFEKEVAKLHKQHVGMTPADAEFNYLNVAKNVEFYGVELHYARDQSNVEIMVGVTAGGVNVYNNGVRISNFPWIKIVKIFFKLKHFFV-----QLRKEQNETRENIIGFNLGNYRACKTLWKACVEHHTFFRMARPASPPHLGFLAQYFSLGSKFRYSGRTEMQTVQ 344          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO34391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH7])

HSP 1 Score: 185.267 bits (469), Expect = 5.160e-53
Identity = 113/311 (36.33%), Postives = 173/311 (55.63%), Query Frame = 1
Query:  196 MLK--QKSEQISDFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFF 1122
            MLK   KS   ++F  ++  L++ E   E +   +  GQ + D VC+ L D+ EKDYFGLRY D  KQR W+DLS++V  Q+K  +         P F + FR+K Y   P   + ++   Y  +LQ+++D+  GRLL   N+L +L AY VQ+E+GDYD   ++   +S  +++P  + K E KI DIH++L G  P+  E+ FL+K   LD YGV+P   KDQ    LY+GLT  G++  +  ++   F+WA I K  ++GK+F + V  D+        +K   GF+    +A   LWK A +   F+
Sbjct:    1 MLKIGSKSNLDAEFVVKISLLDDTELTCEFR--RDAKGQTVFDTVCKAL-DLVEKDYFGLRYVDDSKQRHWLDLSKSVIKQMKSLK---------PPFKLFFRVKFYALDP-GLIHEEITRYQCFLQIKRDILHGRLLCSYNELAELGAYIVQAELGDYDPEDQEDNYVSEFRIVPKQSEKLENKIADIHRSLSGQVPSVAEKNFLDKVKSLDMYGVDPHPCKDQDNVQLYLGLTPTGIAIIRDGKKVSGFEWAQIIKCSYEGKVFYVQVHKDD--------RKANYGFRLPDPLACKHLWKCAVEHHAFY 290          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO30224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E3])

HSP 1 Score: 137.117 bits (344), Expect = 9.725e-35
Identity = 105/352 (29.83%), Postives = 170/352 (48.30%), Query Frame = 1
Query:  229 FTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSD-KDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQL-AAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLN 1278
            F C V Q+   +   E  +     G  L D+VC+ +G + EK+YFGLRY D KD Q  W++  R++  Q+  K  + F           F +K YP +P   LR+D   Y   LQLR+DL  GR+   SN ++ L A+Y +Q+E+GD      ++  LS+LK  P    +   KI   H+   G+TP++ E ++L+   +L  YG + +     +G  + + ++  GV  FQ +R+ H F W  I  I F+ K F + +      +     K   + FKC +  AA  +WK   +   FF L    E   +      FK    F+++GR Q + + + S+     PS + ++
Sbjct:    7 FNCTV-QVAGLDSDYECPIDKTTKGDHLFDQVCDHIG-LAEKEYFGLRYIDEKDGQFNWLEGDRSIKRQM-GKAPLHFY----------FAVKFYPENPT-TLREDITRYQFVLQLREDLLKGRIQC-SNPIHALLASYVMQAELGDLHPEEHEVAYLSDLKFFPKQPPELRQKIEAFHRKHVGMTPSDAEFQYLDNVRKLPLYGRDMYQAWGDEGQAVTIAISAWGVEVFQNNRQMHRFVWPKIISIGFKSKKFSLTL---RAPSEDDYYKSTTIYFKCGSQRAAKRVWKVCVEHHAFFRLK---EPVPLPKNTNFFKIGSKFRYSGRTQHQARNNESVGVREQPSFDRVS 337          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO32045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW61])

HSP 1 Score: 132.109 bits (331), Expect = 2.945e-34
Identity = 88/300 (29.33%), Postives = 151/300 (50.33%), Query Frame = 1
Query:  223 SDFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFF 1122
            ++F C +  L+E+E P+EI  S    G  +L++V + L ++ E+DYFGLR+ +K+ Q +W+D  ++V  QLK            P +++ F +K Y A P   L ++   Y  +LQ+++D++ G      +    ++++ + +E+GD+D  S     +S  + +P      E KI+D HK L G+ P+  E  +L+KA  L+ YGV+   VK + G   +V L   GV  +        + W  I KI F+GK F ++V         +  +++V  F      A   LWK   +   FF
Sbjct:    9 TEFFCHIVLLDESEFPIEITKS--TKGFEVLEKVFDHL-NLLERDYFGLRFIEKNTQSRWLDPMKSVTKQLKA----------GPPYLMYFCVKFYAADP-NKLHEELTRYLFFLQVKRDIFQGSAPCEIHADTLISSFILLAELGDFDYQSYTPGYVSEFRFVPKQTEDLEEKISDCHKRLIGVVPSVAEYMYLDKAKWLEMYGVDLHLVKGEDGVEYFVALKPAGVVVYHNKTAVGTYLWQKITKIDFKGKKFSLNV-------QGKEDREYVYVFYLPNKSACKHLWKCCVEHHAFF 287          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO33626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN5])

HSP 1 Score: 132.88 bits (333), Expect = 1.081e-31
Identity = 94/308 (30.52%), Postives = 155/308 (50.32%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEI 1224
            G  L  +V E L ++ E++YFGL Y DK     W+D  + +  Q+K+   + F           F +K Y A P   L+++   Y   LQ++KDL +G L    +    LA+Y VQ E+GD+D+ S     L++ +  P     +EA+I+D HK    L+PT+ +   L+ A +L+ YGV  +  KD+   +L +   + G+  FQ   + +   WA I K+ F+ K F+I +   EIF +     K V+ F+  +  A  + WK A     FF  + S    R +    +F +  +++F+GR QK+I
Sbjct:   45 GDILYKQVYEYL-NLDEREYFGLSYYDKSDNLFWLDQLKPIKKQVKEIGKVLF----------RFCVKFYTADPAM-LQEEYTRYLFALQVKKDLVNGGLKCSESTAALLASYVVQGELGDFDTLSCRPGYLADFQFFPEQTVDSEARISDFHKQHRSLSPTDCDYNLLDVARRLEMYGVILYPAKDKDNVDLELAAANMGIIVFQSGSKINTLSWAKIRKLSFKRKRFLIKLH-PEIFGHY----KDVVEFQMASRNACKSFWKVAISTHAFFRQSESQSPPRHRP--RVFSRGSSYRFSGRTQKQI 333          
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Match: EDO44823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW8])

HSP 1 Score: 128.257 bits (321), Expect = 1.888e-30
Identity = 97/328 (29.57%), Postives = 162/328 (49.39%), Query Frame = 1
Query:  235 CRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRY-SDKD------KQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLN--RSSEAKRVKSGGGIFKKRKT 1191
            C V+ L+++E    I V     G  LL+EV   L DIQEK YFGL+Y SD         + QW          L+D + I      TP +I  F ++ + + P   L +D   Y+ YLQ+++D+ +GRL    +   +L++Y +Q+E+GDYD        +S  + +P+     E +  + HK+  G TP + E  FLE A  LD YGV+    KD  G +L++G++  G++ +    + + F W+ I K+ F+ K F I +  D           +++GF+  T  +   LWK   +   F+  +  +++E + ++ G     K KT
Sbjct:   37 CVVELLDDSE--FIIDVDKNAKGTVLLNEVFRHL-DIQEKHYFGLQYVSDSPDNMVGGAKEQW----------LQDDKIIRKQKKGTPPYIFYFCVRFFVSDP-SKLVEDLTRYYFYLQIKRDILTGRLPCLYDTAAELSSYILQAELGDYDPKLHLDGYVSEFRFIPDQTDDFEERAAEFHKHHIGQTPADAEFNFLEVAKTLDLYGVDLHCAKDHDGTDLFLGVSALGLTVYHNKCKINFFPWSKIVKVCFKRKRFFIQIRPD-----WNEWTDNIIGFQMLTYRSCKNLWKVCVEYHSFYRTHYPKATEKRVLRMGSKYRYKGKT 345          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:101158442])

HSP 1 Score: 216.853 bits (551), Expect = 4.688e-61
Identity = 143/480 (29.79%), Postives = 241/480 (50.21%), Query Frame = 1
Query:  226 DFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNTILRDTVQIEDIDEENKAKYNTMP-SRERGTMLGTQDTLDSLFIPNHHGSVDNAASHSPFNTPVDSPKLVERKHTESQRNPSLDHIIEEPCIQEHSKLVADDRK---SVHSIMSSRASSSGT 1650
            ++ C V+ L++ E      +  +  GQ+L D +C  L ++ EKDYFG+RY D DKQR W++ ++++  Q+K +          P F +  R+K YP  P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E +I DIHK  + G TP   E+ FL+KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F        I+ NQ   K+ +L +   T  A   LWK   +   F+ L +SS+ + V S    F+  + F+++GR  KE+ + ++ +    P ++    +  R+               +  + +++P +R R   +   + L+SL    H   V + +    F     S    E   ++   +PS D ++  P + +HS  ++  R+   +  SI   + S +GT
Sbjct:   16 EYNCTVRLLDDTE--YTCTIQRDAKGQYLFDLICHNL-NLLEKDYFGIRYVDPDKQRHWLEFTKSIAKQMKSQ----------PPFTMCLRVKFYPPDPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAAMLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKQSEKLERRIADIHKTEMIGQTPETSERNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGKTF-------HIYANQ---KEIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFRGSR-FRYSGRVAKEVMERSAKIKREPPEIHRAGLVPSRSC----------PSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSVSHGESFMPRCRSQATEEAVISDEAYSPS-DSVLPTP-VADHSVELSVSRQINGAPCSIEEEKESEAGT 458          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: frmd5 (FERM domain-containing protein 5 [Source:NCBI gene;Acc:101175227])

HSP 1 Score: 216.853 bits (551), Expect = 4.940e-61
Identity = 119/355 (33.52%), Postives = 194/355 (54.65%), Query Frame = 1
Query:  235 CRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRN 1296
            C V+ L+++E      +  ++ GQ+L D +C  L ++ EKDYFG+RY D DKQR W++ ++++  Q+K +          P F +  R+K YP  P   LR++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E +I +IHK  L G +P   E  FL+KA  L+TYGV+P   KD  GN  ++  T  G +  QG+RR H   W ++ K+ F+ K F        I+ NQ+  +K +L +   T  A   LWK   +   F+ L +SS+ + V S    FK  + F+++G+  KE+ + ++ +  + P ++    +  R+
Sbjct:   19 CTVRLLDDSE--YTCTIQRDSKGQYLFDLICHHL-NLLEKDYFGIRYVDPDKQRHWLEFTKSIAKQIKSQ----------PPFTMCLRVKFYPPDPAA-LREEITRYLVFLQVKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERRIAEIHKTELIGQSPETSELNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFTVLQGNRRVHFLTWEEVTKLKFEAKTF-------HIYANQKEDRKIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSR-FRYSGKVAKEVMEQSAKIKRDPPEIHRAGMVPSRS 351          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:101158442])

HSP 1 Score: 211.846 bits (538), Expect = 1.861e-59
Identity = 139/455 (30.55%), Postives = 230/455 (50.55%), Query Frame = 1
Query:  301 GQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNTILRDTVQIEDIDEENKAKYNTMP-SRERGTMLGTQDTLDSLFIPNHHGSVDNAASHSPFNTPVDSPKLVERKHTESQRNPSLDHIIEEPCIQEHSKLVADDRK---SVHSIMSSRASSSGT 1650
            GQ+L D +C  L ++ EKDYFG+RY D DKQR W++ ++++  Q+K +          P F +  R+K YP  P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E +I DIHK  + G TP   E+ FL+KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F        I+ NQ   K+ +L +   T  A   LWK   +   F+ L +SS+ + V S    F+  + F+++GR  KE+ + ++ +    P ++    +  R+               +  + +++P +R R   +   + L+SL    H   V + +    F     S    E   ++   +PS D ++  P + +HS  ++  R+   +  SI   + S +GT
Sbjct:   19 GQYLFDLICHNL-NLLEKDYFGIRYVDPDKQRHWLEFTKSIAKQMKSQ----------PPFTMCLRVKFYPPDPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAAMLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKQSEKLERRIADIHKTEMIGQTPETSERNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGKTF-------HIYANQ---KEIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFRGSR-FRYSGRVAKEVMERSAKIKREPPEIHRAGLVPSRSC----------PSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSVSHGESFMPRCRSQATEEAVISDEAYSPS-DSVLPTP-VADHSVELSVSRQINGAPCSIEEEKESEAGT 438          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: frmd3 (FERM domain containing 3 [Source:NCBI gene;Acc:101171252])

HSP 1 Score: 211.075 bits (536), Expect = 1.719e-58
Identity = 132/384 (34.38%), Postives = 203/384 (52.86%), Query Frame = 1
Query:  193 KMLKQKSEQI----SDFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSL--------NGLNGIGRRNTIL 1305
            KML+ +S  I     +  C ++ L+++E  L   +  +  GQ+LLD VC    ++ EKDYFG+RY D +KQR W++ ++ V  Q+K  +    C          FR+K YP  P++ ++++   Y LYLQL++D+Y GRLL    +   L A  VQ+E+GDYD+       + + KL P  + K E KI +IHKN L G +    E   L++A  L+TYGV+P   KD  G   ++G T  G   FQG++R HL KW D++K+ F+GK F +           Q +KK VL F   T  A   LWK   +   F+   +SS+ K V S   IF K   F+++GR  KE+ +++S +  + P +           N +  +N I+
Sbjct:    2 KMLRFRSPSIRSLDQEILCTIRLLDDSE--LSCSIQKDTKGQFLLDHVCNHY-NLLEKDYFGIRYVDPEKQRHWLEPNKPVVRQMKSHQPYMMC----------FRVKFYPHEPMK-IKEELTRYLLYLQLKRDIYHGRLLCPFVEAAYLGACIVQAELGDYDAEEHPCDYIRDFKLFPKQSLKLERKIMEIHKNELRGQSAALAELNMLQRAHSLETYGVDPHPCKDFTGATAFLGFTATGFVVFQGNKRIHLLKWMDVSKLKFEGKTFYV--------IGIQKEKKLVLTFHTSTPAACKHLWKCGVENQAFYKCAKSSQIKTV-SSSNIFFKGSRFRYSGRVAKEVIEASSKIQRDAPEVRRAQFGQSRSFNSLSHKNLIM 362          
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Match: si:ch211-69m14.1 (FERM domain containing 5 [Source:NCBI gene;Acc:101158442])

HSP 1 Score: 167.933 bits (424), Expect = 7.093e-45
Identity = 116/393 (29.52%), Postives = 194/393 (49.36%), Query Frame = 1
Query:  487 VSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKN-LCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNTILRDTVQIEDIDEENKAKYNTMP-SRERGTMLGTQDTLDSLFIPNHHGSVDNAASHSPFNTPVDSPKLVERKHTESQRNPSLDHIIEEPCIQEHSKLVADDRK---SVHSIMSSRASSSGT 1650
            +  R+K YP  P   L+++   Y ++LQ+++DLY GRLL +++D   LAAY +Q+EIGDYD         S  +  P  + K E +I DIHK  + G TP   E+ FL+KA  L+TYGV+P   KD  GN  ++  T  G    QG++R H  KW ++ K+ F+GK F        I+ NQ+  KK +L +   T  A   LWK   +   F+ L +SS+ + V S    F+  + F+++GR  KE+ + ++ +    P ++    +  R+               +  + +++P +R R   +   + L+SL    H   V + +    F     S    E   ++   +PS D ++  P + +HS  ++  R+   +  SI   + S +GT
Sbjct:    1 MCLRVKFYPPDPAA-LKEEITRYLVFLQIKRDLYHGRLLCKTSDAAMLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKQSEKLERRIADIHKTEMIGQTPETSERNFLQKAQMLETYGVDPHPCKDVSGNPAFLAFTPFGFVVLQGNKRVHFLKWNEVTKLKFEGKTF-------HIYANQKEDKKIILTYFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFRGSR-FRYSGRVAKEVMERSAKIKREPPEIHRAGLVPSRSC----------PSITHGPRLSSVPRTRRRAVHISIMEGLESLRDSAHSTPVRSVSHGESFMPRCRSQATEEAVISDEAYSPS-DSVLPTP-VADHSVELSVSRQINGAPCSIEEEKESEAGT 372          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000062741.1 (SMESG000062741.1)

HSP 1 Score: 1135.94 bits (2937), Expect = 0.000e+0
Identity = 623/633 (98.42%), Postives = 623/633 (98.42%), Query Frame = 1
Query:  196 MLKQKSEQISDFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNTILRDTVQIEDIDEENKAKYNTMPSRERGTMLGTQDTLDSLFIPNHHGSVDNAASHSPFNTPVDSPKLVERKHTESQRNPSLDHIIEEPCIQEHSKLVADDRKSVHSIMSSRASSSGTLYDLVDGNSLQSKLSSSHGDIANALEQLQIAVTDAVDQRVAKRSRFHFYLTQFXXXXXXXXXXXXXXXXXXXXXXXXXXHYRTDSGMYDYSKFLTDIVTNPREAVHLISSEQLSKVARNSYSSFYRYIMXXXXXXXXXXXXXXXDTDL 2094
            MLKQKSEQISDFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKD          TPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRSLSNLKLLPNLNSKTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNTILRDTVQIEDIDEENKAKYNTMPSRERGTMLGTQDTLDSLFIPNHHGSVDNAASHSPFNTPVDSPKLVERKHTESQRNPSLDHIIEEPCIQEHSKLVADDRKSVHSIMSSRASSSGTLYDLVDGNSLQSKLSSSHGDIANALEQLQIAVTDAVDQRVAKRSRFHFYLTQFLCLGCLLTIGLLLIVMIIILIMVLGLHYRTDSGMYDYSKFLTDIVTNPREAVHLISSEQLSKVARNSYSSFYRYIMSSSNNSNNIHNINNNDTDL
Sbjct:    1 MLKQKSEQISDFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKD----------TPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDYDSTSEDMRSLSNLKLLPNLNSKTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLSMNNPSLNGLNGIGRRNTILRDTVQIEDIDEENKAKYNTMPSRERGTMLGTQDTLDSLFIPNHHGSVDNAASHSPFNTPVDSPKLVERKHTESQRNPSLDHIIEEPCIQEHSKLVADDRKSVHSIMSSRASSSGTLYDLVDGNSLQSKLSSSHGDIANALEQLQIAVTDAVDQRVAKRSRFHFYLTQFLCLGCLLTIGLLLIVMIIILIMVLGLHYRTDSGMYDYSKFLTDIVTNPREAVHLISSEQLSKVARNSYSSFYRYIMSSSNNSNNIHNINNNDTDL 623          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000033159.1 (SMESG000033159.1)

HSP 1 Score: 236.113 bits (601), Expect = 2.290e-68
Identity = 145/393 (36.90%), Postives = 228/393 (58.02%), Query Frame = 1
Query:  226 DF-TCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDY--DSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLS--MNNPSLNGLN--GIGRRNT---ILRDTVQIEDIDEENKAKYNTMPSR 1374
            DF +C +  L+EN+P L I + +   G  LLDEVC  LG   EKDYF LR+SDK +Q+ W++L + V  QLK  +T S          + F +KHYP  P+ DL ++ A Y LYLQLRKDLYS  L+   + L +L +  +Q E+ D    ST   + ++++LK++ N+ +    ++ +    L  +   E+E +F++  SQL++YGVEP  V D  GN +++G+ H+G+ TF G +R  ++ W +I+K+ F  KLFI+ +     FNN + K    L FK ++  AA+A W WA DR  F +LN SSEA++VKS   +F+++   +F+GR +KE+ +S   +S     P +   N   I R N+   + RD++ + D ++     Y T+P R
Sbjct:   20 DFNSCSIYFLDENKPNLVINLKNNTLGSSLLDEVCLNLGKFVEKDYFSLRFSDKKEQQFWLNLDKPVIKQLKSAKTNS----------LYFLVKHYPGEPLVDLVEELAQYQLYLQLRKDLYSEHLIVNEDVLPKLISLVIQGEMEDMCDPSTEIILNAVNSLKIVKNITNNMLKRVCEAITTLNWIENREMESQFIQIVSQLESYGVEPNRVIDPTGNVIFLGMNHQGICTFIGEKRISIYYWENISKMMFISKLFIMEIN----FNNTKRK----LEFKFKSEKAANAFWMWAMDRQNFMTLNNSSEARKVKSNSQLFRRKVKHRFSGRSKKEVTESCLTISSVSKPPVIRTRNPVTISRSNSAKAVCRDSMVV-DTEQTRPNSYATLPKR 393          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000033159.1 (SMESG000033159.1)

HSP 1 Score: 236.498 bits (602), Expect = 4.235e-68
Identity = 145/393 (36.90%), Postives = 228/393 (58.02%), Query Frame = 1
Query:  226 DF-TCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGRSNDLYQLAAYAVQSEIGDY--DSTSEDMRXXXXXXXXXXXXXXTEAKITDIHKNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVSTFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFKCETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGRCQKEIQQSTSLLS--MNNPSLNGLN--GIGRRNT---ILRDTVQIEDIDEENKAKYNTMPSR 1374
            DF +C +  L+EN+P L I + +   G  LLDEVC  LG   EKDYF LR+SDK +Q+ W++L + V  QLK  +T S          + F +KHYP  P+ DL ++ A Y LYLQLRKDLYS  L+   + L +L +  +Q E+ D    ST   + ++++LK++ N+ +    ++ +    L  +   E+E +F++  SQL++YGVEP  V D  GN +++G+ H+G+ TF G +R  ++ W +I+K+ F  KLFI+ +     FNN + K    L FK ++  AA+A W WA DR  F +LN SSEA++VKS   +F+++   +F+GR +KE+ +S   +S     P +   N   I R N+   + RD++ + D ++     Y T+P R
Sbjct:   20 DFNSCSIYFLDENKPNLVINLKNNTLGSSLLDEVCLNLGKFVEKDYFSLRFSDKKEQQFWLNLDKPVIKQLKSAKTNS----------LYFLVKHYPGEPLVDLVEELAQYQLYLQLRKDLYSEHLIVNEDVLPKLISLVIQGEMEDMCDPSTEIILNAVNSLKIVKNITNNMLKRVCEAITTLNWIENREMESQFIQIVSQLESYGVEPNRVIDPTGNVIFLGMNHQGICTFIGEKRISIYYWENISKMMFISKLFIMEIN----FNNTKRK----LEFKFKSEKAANAFWMWAMDRQNFMTLNNSSEARKVKSNSQLFRRKVKHRFSGRSKKEVTESCLTISSVSKPPVIRTRNPVTISRSNSAKAVCRDSMVV-DTEQTRPNSYATLPKR 393          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000016667.1 (SMESG000016667.1)

HSP 1 Score: 164.081 bits (414), Expect = 2.079e-47
Identity = 77/82 (93.90%), Postives = 81/82 (98.78%), Query Frame = 1
Query:  196 MLKQKSEQISDFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKD 441
            MLKQKSEQI+DFTCRVKQLNENEPPLEIKVSH NSGQWLLDEVCERLGD+Q+KDYFGLRYSDKDK+RQWIDLSRNVYNQLKD
Sbjct:    1 MLKQKSEQITDFTCRVKQLNENEPPLEIKVSHGNSGQWLLDEVCERLGDMQDKDYFGLRYSDKDKRRQWIDLSRNVYNQLKD 82          
BLAST of FERM domain-containing protein vs. Planmine SMEST
Match: SMESG000053535.1 (SMESG000053535.1)

HSP 1 Score: 155.221 bits (391), Expect = 2.597e-44
Identity = 79/95 (83.16%), Postives = 81/95 (85.26%), Query Frame = 1
Query:  196 MLKQKSEQISDFTCRVKQLNENEPPLEIKVSHENSGQWLLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISFCTDYTPS 480
            MLKQKSEQISDF    KQLNENEPPLEIKVSHENSGQWLLDEVCE LG+IQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKD    S   D  P+
Sbjct:    1 MLKQKSEQISDF----KQLNENEPPLEIKVSHENSGQWLLDEVCECLGNIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDLHENSLGLDENPN 91          
The following BLAST results are available for this feature:
BLAST of FERM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FRMD57.431e-6535.20FERM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
FRMD51.512e-6435.20FERM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
FRMD51.540e-6336.64FERM domain containing 5 [Source:HGNC Symbol;Acc:H... [more]
FRMD31.216e-5533.16FERM domain containing 3 [Source:HGNC Symbol;Acc:H... [more]
FRMD34.153e-5533.16FERM domain containing 3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frm-21.441e-3731.45FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-21.441e-3731.45FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-21.441e-3731.45FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-21.799e-3731.45FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-41.280e-3630.90FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG50224.346e-5837.18gene:FBgn0032225 transcript:FBtr0079999[more]
yrt2.583e-3830.54gene:FBgn0004049 transcript:FBtr0114375[more]
yrt4.860e-3830.72gene:FBgn0004049 transcript:FBtr0114376[more]
yrt4.951e-3830.72gene:FBgn0004049 transcript:FBtr0082793[more]
yrt5.452e-3830.72gene:FBgn0004049 transcript:FBtr0114374[more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frmd39.075e-6437.09FERM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
FRMD53.187e-6334.36si:ch211-69m14.1 [Source:ZFIN;Acc:ZDB-GENE-050419-... [more]
frmd54.913e-6032.68FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
frmd55.692e-6032.68FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
frmd52.183e-5932.68FERM domain containing 5 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mertk5.521e-6033.71MER proto-oncogene, tyrosine kinase [Source:Xenbas... [more]
mertk1.709e-5934.95MER proto-oncogene, tyrosine kinase [Source:Xenbas... [more]
frmd38.160e-5935.82FERM domain containing 3 [Source:NCBI gene;Acc:779... [more]
frmd32.087e-5835.73FERM domain containing 3 [Source:NCBI gene;Acc:779... [more]
frmd32.116e-5835.82FERM domain containing 3 [Source:NCBI gene;Acc:779... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Frmd52.219e-6434.92FERM domain containing 5 [Source:MGI Symbol;Acc:MG... [more]
Frmd53.930e-6434.92FERM domain containing 5 [Source:MGI Symbol;Acc:MG... [more]
Frmd51.043e-6236.34FERM domain containing 5 [Source:MGI Symbol;Acc:MG... [more]
Frmd54.014e-6236.34FERM domain containing 5 [Source:MGI Symbol;Acc:MG... [more]
Frmd35.918e-5732.97FERM domain containing 3 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of FERM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7Z6J6|FRMD5_HUMAN7.261e-6435.20FERM domain-containing protein 5 OS=Homo sapiens O... [more]
sp|Q6P5H6|FRMD5_MOUSE1.552e-6334.92FERM domain-containing protein 5 OS=Mus musculus O... [more]
sp|Q0P4Q4|FRMD3_XENTR1.121e-5735.82FERM domain-containing protein 3 OS=Xenopus tropic... [more]
sp|Q8BHD4|FRMD3_MOUSE1.809e-5532.97FERM domain-containing protein 3 OS=Mus musculus O... [more]
sp|Q5R803|FRMD3_PONAB1.207e-5433.42FERM domain-containing protein 3 OS=Pongo abelii O... [more]
back to top
BLAST of FERM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3U2V54.134e-10450.87Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068WUP13.003e-10048.30FERM domain containing protein 5 OS=Echinococcus g... [more]
A0A068Y1N29.452e-10048.30FERM domain containing protein 5 OS=Echinococcus m... [more]
A0A4E0RY781.740e-9945.48FERM domain-containing protein 5 OS=Fasciola hepat... [more]
A0A4S2MA581.125e-9847.62FERM domain-containing protein OS=Opisthorchis fel... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-69m14.12.665e-6330.93FERM domain containing 5 [Source:NCBI gene;Acc:103... [more]
frmd39.771e-6338.08FERM domain containing 3 [Source:NCBI gene;Acc:103... [more]
si:ch211-69m14.11.006e-5836.36FERM domain containing 5 [Source:NCBI gene;Acc:103... [more]
frmd33.109e-4533.51FERM domain containing 3 [Source:NCBI gene;Acc:103... [more]
si:ch211-69m14.18.191e-4429.38FERM domain containing 5 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frmd35.727e-5635.12FERM domain containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
epb41l57.576e-3630.82erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l51.110e-3530.82erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l51.175e-3530.82erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
ENSPMAT00000001312.18.087e-3528.83pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 ... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FERM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO343915.160e-5336.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302249.725e-3529.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320452.945e-3429.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336261.081e-3130.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448231.888e-3029.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FERM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-69m14.14.688e-6129.79FERM domain containing 5 [Source:NCBI gene;Acc:101... [more]
frmd54.940e-6133.52FERM domain-containing protein 5 [Source:NCBI gene... [more]
si:ch211-69m14.11.861e-5930.55FERM domain containing 5 [Source:NCBI gene;Acc:101... [more]
frmd31.719e-5834.38FERM domain containing 3 [Source:NCBI gene;Acc:101... [more]
si:ch211-69m14.17.093e-4529.52FERM domain containing 5 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of FERM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062741.10.000e+098.42SMESG000062741.1[more]
SMESG000033159.12.290e-6836.90SMESG000033159.1[more]
SMESG000033159.14.235e-6836.90SMESG000033159.1[more]
SMESG000016667.12.079e-4793.90SMESG000016667.1[more]
SMESG000053535.12.597e-4483.16SMESG000053535.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012665 ID=SMED30012665|Name=FERM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2349bp
CTACCACAAACTGCGCTTTATGTGAAATTTGAAATTAGGTTTAATTTCTG
CATAATATGATAAATCAAATTAATTATTAAAAGTTAATGCTATTATTTGA
AGTATTTCAGAATTTGAAAATTAATTTTTAATAAATATTTATAGATAGAT
TGATGATTTATGAATAATTTTATAAAATTTACTCACGATCATAAAATGTT
AAAGCAAAAGTCTGAGCAGATATCAGATTTCACTTGTCGTGTTAAACAAT
TGAATGAAAATGAACCACCTTTAGAAATCAAAGTCTCACATGAAAATAGC
GGCCAGTGGTTATTAGATGAAGTTTGTGAACGTTTAGGAGACATACAAGA
AAAAGATTATTTCGGATTAAGATATTCTGACAAAGATAAACAAAGACAAT
GGATTGATTTATCGCGAAATGTTTACAATCAACTGAAAGACAAGCGAACA
ATTTCTTTCTGCACAGATTACACTCCTTCATTTATTGTCAGTTTTCGAAT
GAAACATTATCCAGCCTCACCAATTGAGGATTTGAGACAGGATCGAGCAT
GCTACTTTTTGTACTTACAATTGAGAAAAGATTTATATAGTGGTCGACTT
CTTGGAAGGAGTAATGATTTATACCAACTAGCAGCATATGCAGTGCAAAG
TGAAATTGGCGATTATGACTCTACAAGTGAAGATATGAGATCTTTGTCTA
ATCTCAAACTATTGCCTAACTTAAATTCCAAAACCGAAGCAAAAATAACT
GATATTCACAAAAATTTGTGTGGATTGACTCCGACCGAAGTTGAACAGAA
ATTTCTAGAAAAGGCATCACAATTAGACACATATGGAGTTGAGCCATTTT
ATGTCAAGGACCAAAAAGGCAACAACCTATATGTTGGCCTCACTCATGAA
GGGGTATCGACATTTCAAGGAAGTCGAAGAGCACATTTATTTAAATGGGC
CGATATTGCAAAGATCCATTTTCAAGGAAAACTGTTTATTATCCATGTTT
TTCTCGATGAAATATTCAATAACCAACAATCGAAAAAAAAGCATGTTTTG
GGATTCAAATGTGAAACAAATATTGCAGCATCTGCTTTGTGGAAATGGGC
TAATGATCGCATGTGCTTTTTCTCACTCAATCGATCAAGTGAAGCTAAGC
GTGTGAAATCGGGTGGTGGGATTTTCAAAAAAAGAAAAACTTTTAAATTT
GCTGGTCGTTGCCAGAAGGAAATTCAGCAAAGCACATCACTATTATCTAT
GAATAATCCTAGTTTAAATGGTCTTAATGGAATCGGTCGTCGAAATACAA
TTTTAAGAGACACAGTTCAAATAGAAGACATTGATGAAGAGAACAAAGCC
AAATATAATACTATGCCATCTCGCGAGCGTGGTACAATGTTAGGAACTCA
AGATACATTAGATAGTTTATTTATTCCTAATCATCATGGATCTGTCGATA
ATGCAGCATCTCATTCTCCATTCAATACACCAGTAGACTCTCCGAAATTA
GTCGAACGAAAACACACTGAATCCCAACGCAACCCGTCTTTAGATCATAT
TATTGAAGAACCATGTATTCAGGAACATTCAAAATTGGTTGCGGATGATC
GAAAGAGTGTACACAGTATAATGTCATCTCGAGCATCGAGCTCTGGGACA
CTTTATGACCTGGTTGATGGTAACAGTCTTCAGTCAAAACTGTCAAGCAG
TCACGGTGATATCGCTAATGCATTAGAACAATTGCAAATCGCTGTTACCG
ATGCTGTTGATCAAAGAGTTGCTAAACGAAGTCGATTTCATTTCTATCTC
ACCCAATTTCTTTGTCTTGGGTGTTTATTGACTATCGGATTGCTTTTGAT
CGTTATGATTATCATTTTAATAATGGTGCTAGGCCTACATTATCGCACGG
ATTCAGGTATGTATGATTATTCCAAATTTCTCACAGATATTGTCACTAAT
CCCCGAGAAGCAGTTCATTTAATTTCTTCTGAACAGTTGTCAAAAGTTGC
TCGTAATAGTTATTCATCTTTCTACAGATATATTATGTCGTCCAGCAATA
ATAGTAATAATATTCATAATATTAATAATAATGATACAGACTTATAATAA
TAATAATAATAATTAAAAAAATGTTTAAAAATACTATGACCTTGAAAAGT
AAATGATGGGTCATGGTCTTTGTATCAATGACATTGACAAATATGATGAC
TTATCGAATGACCTTGAAAATAAATGATGAGTCATACTTTGACATTGAAA
ATTAAAAAATGACTCTTCGAATGACCTTGAAAAATAAATGGTGACTTAGC
GAATGACCTTGAAAAATCATGATGGGTCATCCAATGACCTTGAATGAGT
back to top

protein sequence of SMED30012665-orf-1

>SMED30012665-orf-1 ID=SMED30012665-orf-1|Name=SMED30012665-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=646bp
MNNFIKFTHDHKMLKQKSEQISDFTCRVKQLNENEPPLEIKVSHENSGQW
LLDEVCERLGDIQEKDYFGLRYSDKDKQRQWIDLSRNVYNQLKDKRTISF
CTDYTPSFIVSFRMKHYPASPIEDLRQDRACYFLYLQLRKDLYSGRLLGR
SNDLYQLAAYAVQSEIGDYDSTSEDMRSLSNLKLLPNLNSKTEAKITDIH
KNLCGLTPTEVEQKFLEKASQLDTYGVEPFYVKDQKGNNLYVGLTHEGVS
TFQGSRRAHLFKWADIAKIHFQGKLFIIHVFLDEIFNNQQSKKKHVLGFK
CETNIAASALWKWANDRMCFFSLNRSSEAKRVKSGGGIFKKRKTFKFAGR
CQKEIQQSTSLLSMNNPSLNGLNGIGRRNTILRDTVQIEDIDEENKAKYN
TMPSRERGTMLGTQDTLDSLFIPNHHGSVDNAASHSPFNTPVDSPKLVER
KHTESQRNPSLDHIIEEPCIQEHSKLVADDRKSVHSIMSSRASSSGTLYD
LVDGNSLQSKLSSSHGDIANALEQLQIAVTDAVDQRVAKRSRFHFYLTQF
LCLGCLLTIGLLLIVMIIILIMVLGLHYRTDSGMYDYSKFLTDIVTNPRE
AVHLISSEQLSKVARNSYSSFYRYIMSSSNNSNNIHNINNNDTDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR035963FERM_2
IPR019749Band_41_domain
IPR018980FERM_PH-like_C
IPR011993PH-like_dom_sf
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR019748FERM_central
IPR018979FERM_N
IPR000299FERM_domain
IPR029071Ubiquitin-like_domsf
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 14..34
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 22..102
e-value: 3.3E-18
score: 67.2
NoneNo IPR availablePANTHERPTHR232804.1 G PROTEINcoord: 14..521
NoneNo IPR availablePANTHERPTHR23280:SF32FERM DOMAIN (PROTEIN4.1-EZRIN-RADIXIN-MOESIN) FAMILYcoord: 14..521
NoneNo IPR availableCDDcd17102FERM_F1_FRMD3coord: 24..117
e-value: 2.34087E-21
score: 86.5278
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 223..365
NoneNo IPR availableTMHMMTMhelixcoord: 556..578
IPR019749Band 4.1 domainPRINTSPR00935BAND41coord: 136..149
score: 37.65
coord: 60..72
score: 40.71
coord: 149..169
score: 40.08
coord: 210..226
score: 35.66
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 20..230
e-value: 1.0E-43
score: 161.2
IPR018980FERM, C-terminal PH-like domainSMARTSM01196FERM_C_3coord: 234..329
e-value: 1.3E-14
score: 64.6
IPR018980FERM, C-terminal PH-like domainPFAMPF09380FERM_Ccoord: 234..327
e-value: 6.5E-14
score: 52.1
IPR014352FERM/acyl-CoA-binding protein superfamilyGENE3DG3DSA:1.20.80.10coord: 116..224
e-value: 6.5E-27
score: 96.1
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 225..323
e-value: 5.4E-21
score: 76.7
IPR018979FERM, N-terminalPFAMPF09379FERM_Ncoord: 38..93
e-value: 2.0E-11
score: 43.6
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 123..230
e-value: 1.3E-15
score: 57.8
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 130..222
e-value: 3.01323E-22
score: 89.613
IPR000299FERM domainPROSITEPS50057FERM_3coord: 24..325
score: 62.012
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 23..118
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 123..225