28S ribosomal protein S16

Overview
Name28S ribosomal protein S16
Smed IDSMED30012660
Length (bp)619
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 28S ribosomal protein S16 (SMED30012660) t-SNE clustered cells

Violin plots show distribution of expression levels for 28S ribosomal protein S16 (SMED30012660) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 28S ribosomal protein S16 (SMED30012660) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 28S ribosomal protein S16 (SMED30012660) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012660

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012660h1SMcG0001309 SmedASXL_065393SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30012660h1SMcG0001309 dd_Smed_v4_1539_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012660h1SMcG0001309 dd_Smed_v4_1539_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012660h1SMcG0001309 dd_Smed_v4_1539_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012660h1SMcG0001309 dd_Smed_v4_1539_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012660h1SMcG0001309 dd_Smed_v4_1539_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 28S ribosomal protein S16 vs. Ensembl Human
Match: MRPS16 (mitochondrial ribosomal protein S16 [Source:HGNC Symbol;Acc:HGNC:14048])

HSP 1 Score: 85.1149 bits (209), Expect = 9.667e-21
Identity = 43/101 (42.57%), Postives = 63/101 (62.38%), Query Frame = 3
Query:  195 LKISLVLEGCVNRPFFTIHVKNTNEKCNAPG--VEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMRILREEA 491
            L I L L GC NRPF+ I     + KC   G  VEQ+GS+DPLPN++GE+LV +N++R  +WI  GA  +  + +LLG+ G  P+H     ++ R+ R+ A
Sbjct:   17 LTIRLALGGCTNRPFYRIVA--AHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRA 115          
BLAST of 28S ribosomal protein S16 vs. Ensembl Human
Match: MRPS16 (mitochondrial ribosomal protein S16 [Source:HGNC Symbol;Acc:HGNC:14048])

HSP 1 Score: 73.9442 bits (180), Expect = 8.200e-17
Identity = 37/79 (46.84%), Postives = 52/79 (65.82%), Query Frame = 3
Query:  195 LKISLVLEGCVNRPFFTIHVKNTNEKCNAPG--VEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGI 425
            L I L L GC NRPF+ I     + KC   G  VEQ+GS+DPLPN++GE+LV +N++R  +WI  GA  +  + +LLG+
Sbjct:   17 LTIRLALGGCTNRPFYRI--VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGL 93          
BLAST of 28S ribosomal protein S16 vs. Ensembl Celegans
Match: mrps-16 (Probable 28S ribosomal protein S16, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q10129])

HSP 1 Score: 71.633 bits (174), Expect = 6.459e-16
Identity = 35/93 (37.63%), Postives = 56/93 (60.22%), Query Frame = 3
Query:  201 ISLVLEGCVNRPFFTIHV---KNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQ-GAQPNLIVSQLLGIGGILPVHHRSYLHS 467
            I L L GC NRPF+ + V   +    +     +EQ+G++DPLPN   E+LV +N  R  YWI +  A  ++ V +LLG+ G+ P+H +S++ +
Sbjct:   15 IGLALFGCTNRPFYHVCVFPDRALGRRYEGNILEQVGTFDPLPNQKNEKLVALNFGRLKYWIGERNAHISVPVLELLGLSGLFPIHPKSFIRA 107          
BLAST of 28S ribosomal protein S16 vs. Ensembl Fly
Match: mRpS16 (gene:FBgn0033907 transcript:FBtr0087578)

HSP 1 Score: 97.8265 bits (242), Expect = 4.798e-26
Identity = 46/105 (43.81%), Postives = 65/105 (61.90%), Query Frame = 3
Query:  201 ISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMRILREEALKESGEEK 515
            I  V  GC NRPF+ I V    +  + P +EQ+GS+DPLPN   E+LV +N ER  YW+ +GA  +   ++LLGI G+LP+H R+Y+ + R  R  A  E+  EK
Sbjct:   20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHLSTPAAELLGIAGLLPIHPRTYMTAWRNRRTAAEAEASPEK 124          
BLAST of 28S ribosomal protein S16 vs. Ensembl Zebrafish
Match: mrps16 (mitochondrial ribosomal protein S16 [Source:ZFIN;Acc:ZDB-GENE-041010-123])

HSP 1 Score: 81.2629 bits (199), Expect = 1.448e-19
Identity = 43/108 (39.81%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  201 ISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMR----ILREEALKESGEE 512
            I L L G  NRPF+ I         +   +EQ+GS+DPLPN + E+LV  N ER  +WIA GA     V++LLG+ G  P+H  +   + R      REE   +S EE
Sbjct:   19 IRLALGGATNRPFYRIVAAYNKRARDGKYLEQVGSYDPLPNVHNEKLVAFNYERIKHWIACGAHTTKPVAKLLGLAGFFPLHPMTITEAERRQKAASREEVKTDSQEE 126          
BLAST of 28S ribosomal protein S16 vs. Ensembl Zebrafish
Match: mrps16 (mitochondrial ribosomal protein S16 [Source:ZFIN;Acc:ZDB-GENE-041010-123])

HSP 1 Score: 81.2629 bits (199), Expect = 1.448e-19
Identity = 43/108 (39.81%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  201 ISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMR----ILREEALKESGEE 512
            I L L G  NRPF+ I         +   +EQ+GS+DPLPN + E+LV  N ER  +WIA GA     V++LLG+ G  P+H  +   + R      REE   +S EE
Sbjct:   19 IRLALGGATNRPFYRIVAAYNKRARDGKYLEQVGSYDPLPNVHNEKLVAFNYERIKHWIACGAHTTKPVAKLLGLAGFFPLHPMTITEAERRQKAASREEVKTDSQEE 126          
BLAST of 28S ribosomal protein S16 vs. Ensembl Zebrafish
Match: mrps16 (mitochondrial ribosomal protein S16 [Source:ZFIN;Acc:ZDB-GENE-041010-123])

HSP 1 Score: 81.2629 bits (199), Expect = 1.736e-19
Identity = 43/108 (39.81%), Postives = 58/108 (53.70%), Query Frame = 3
Query:  201 ISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMR----ILREEALKESGEE 512
            I L L G  NRPF+ I         +   +EQ+GS+DPLPN + E+LV  N ER  +WIA GA     V++LLG+ G  P+H  +   + R      REE   +S EE
Sbjct:   19 IRLALGGATNRPFYRIVAAYNKRARDGKYLEQVGSYDPLPNVHNEKLVAFNYERIKHWIACGAHTTKPVAKLLGLAGFFPLHPMTITEAERRQKAASREEVKTDSQEE 126          
BLAST of 28S ribosomal protein S16 vs. Ensembl Xenopus
Match: rpl37a (ribosomal protein L37a [Source:Xenbase;Acc:XB-GENE-5811555])

HSP 1 Score: 85.1149 bits (209), Expect = 9.088e-21
Identity = 41/108 (37.96%), Postives = 64/108 (59.26%), Query Frame = 3
Query:  201 ISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMRILREEALKESGEEKDVT 524
            I L L GC NRPF+ I   +     +   +EQ+G++DP+PN   E+LV +N+E+  YWI  GA     V++LLG+ G  P+H  +  ++ R+ RE+  K+S  E  +T
Sbjct:   16 IRLALAGCTNRPFYRIVAAHNKRARDGKYLEQLGTYDPMPNIYNEKLVSLNIEQIKYWIGCGAHTTKPVAKLLGLAGFFPLHPMTITNAERLKREKE-KQSNAEAPLT 122          
BLAST of 28S ribosomal protein S16 vs. Ensembl Xenopus
Match: rpl37a (ribosomal protein L37a [Source:Xenbase;Acc:XB-GENE-5811555])

HSP 1 Score: 85.1149 bits (209), Expect = 1.024e-20
Identity = 41/108 (37.96%), Postives = 64/108 (59.26%), Query Frame = 3
Query:  201 ISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMRILREEALKESGEEKDVT 524
            I L L GC NRPF+ I   +     +   +EQ+G++DP+PN   E+LV +N+E+  YWI  GA     V++LLG+ G  P+H  +  ++ R+ RE+  K+S  E  +T
Sbjct:   19 IRLALAGCTNRPFYRIVAAHNKRARDGKYLEQLGTYDPMPNIYNEKLVSLNIEQIKYWIGCGAHTTKPVAKLLGLAGFFPLHPMTITNAERLKREKE-KQSNAEAPLT 125          
BLAST of 28S ribosomal protein S16 vs. Ensembl Mouse
Match: Mrps16 (mitochondrial ribosomal protein S16 [Source:MGI Symbol;Acc:MGI:1913492])

HSP 1 Score: 82.0333 bits (201), Expect = 1.165e-19
Identity = 40/86 (46.51%), Postives = 56/86 (65.12%), Query Frame = 3
Query:  195 LKISLVLEGCVNRPFFTIHVKNTNEKCNAPG--VEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVH 446
            L I L L GC NRPF+ I     + KC   G  VEQ+GS+DPLPN++GE+LV +N++R  +WI  GA  +  + +LLG+ G  P+H
Sbjct:   17 LTIRLALGGCTNRPFYRI--VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLSGFFPLH 100          
BLAST of 28S ribosomal protein S16 vs. UniProt/SwissProt
Match: sp|Q9V6Y3|RT16_DROME (Probable 28S ribosomal protein S16, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mRpS16 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 4.809e-25
Identity = 46/105 (43.81%), Postives = 65/105 (61.90%), Query Frame = 3
Query:  201 ISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMRILREEALKESGEEK 515
            I  V  GC NRPF+ I V    +  + P +EQ+GS+DPLPN   E+LV +N ER  YW+ +GA  +   ++LLGI G+LP+H R+Y+ + R  R  A  E+  EK
Sbjct:   20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHLSTPAAELLGIAGLLPIHPRTYMTAWRNRRTAAEAEASPEK 124          
BLAST of 28S ribosomal protein S16 vs. UniProt/SwissProt
Match: sp|P82915|RT16_BOVIN (28S ribosomal protein S16, mitochondrial OS=Bos taurus OX=9913 GN=MRPS16 PE=1 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 4.409e-20
Identity = 43/101 (42.57%), Postives = 63/101 (62.38%), Query Frame = 3
Query:  195 LKISLVLEGCVNRPFFTIHVKNTNEKCNAPG--VEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMRILREEA 491
            L I L L GC NRPF+ I     + KC   G  VEQ+GS+DP+PN++GE+LV +N++R  +WI  GA  +  V +LLG+ G  P+H     ++ R+ R+ A
Sbjct:   17 LTIRLALGGCTNRPFYRIVA--AHNKCPRDGRFVEQLGSYDPMPNSHGEKLVALNLDRIRHWIGCGAHLSKPVEKLLGLSGFFPLHPMVITNAERLRRKRA 115          
BLAST of 28S ribosomal protein S16 vs. UniProt/SwissProt
Match: sp|Q9Y3D3|RT16_HUMAN (28S ribosomal protein S16, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS16 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.643e-20
Identity = 43/101 (42.57%), Postives = 63/101 (62.38%), Query Frame = 3
Query:  195 LKISLVLEGCVNRPFFTIHVKNTNEKCNAPG--VEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMRILREEA 491
            L I L L GC NRPF+ I     + KC   G  VEQ+GS+DPLPN++GE+LV +N++R  +WI  GA  +  + +LLG+ G  P+H     ++ R+ R+ A
Sbjct:   17 LTIRLALGGCTNRPFYRIVA--AHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRA 115          
BLAST of 28S ribosomal protein S16 vs. UniProt/SwissProt
Match: sp|Q5REY4|RT16_PONAB (28S ribosomal protein S16, mitochondrial OS=Pongo abelii OX=9601 GN=MRPS16 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.614e-19
Identity = 43/101 (42.57%), Postives = 63/101 (62.38%), Query Frame = 3
Query:  195 LKISLVLEGCVNRPFFTIHVKNTNEKCNAPG--VEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMRILREEA 491
            L I L L GC NRPF+ I     + KC   G  VEQ+GS+DPLPN++GE+LV +N++R  +WI  GA  +  + +LLG+ G  P+H     ++ R+ R+ A
Sbjct:   17 LTIRLALGGCTNRPFYRIVA--AHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKLA 115          
BLAST of 28S ribosomal protein S16 vs. UniProt/SwissProt
Match: sp|Q9CPX7|RT16_MOUSE (28S ribosomal protein S16, mitochondrial OS=Mus musculus OX=10090 GN=Mrps16 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 8.152e-19
Identity = 40/86 (46.51%), Postives = 56/86 (65.12%), Query Frame = 3
Query:  195 LKISLVLEGCVNRPFFTIHVKNTNEKCNAPG--VEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVH 446
            L I L L GC NRPF+ I     + KC   G  VEQ+GS+DPLPN++GE+LV +N++R  +WI  GA  +  + +LLG+ G  P+H
Sbjct:   17 LTIRLALGGCTNRPFYRI--VAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLSGFFPLH 100          
BLAST of 28S ribosomal protein S16 vs. TrEMBL
Match: D3PJD7 (Probable 28S ribosomal protein S16, mitochondrial OS=Lepeophtheirus salmonis OX=72036 GN=RT16 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.267e-37
Identity = 62/119 (52.10%), Postives = 86/119 (72.27%), Query Frame = 3
Query:  120 ASLWVHAPRH-GRKIAKIVPVKPNIKLKISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMR 473
            +  W+H P++   KI  + P+K   K++I+LV  GC NRPFFTI VK   ++    G EQIGSWDP+PN  GEQL+GI+++R LYW+A+GA+P   VS++LG+GGILP+H RSYL + R
Sbjct:   32 SDWWIHKPKNENYKIKAMYPIKQPKKMRIALVRSGCSNRPFFTIQVKWNIDETKVEGFEQIGSWDPMPNNCGEQLIGIDIKRLLYWLAKGAEPTKFVSEILGLGGILPIHPRSYLKAFR 150          
BLAST of 28S ribosomal protein S16 vs. TrEMBL
Match: G4LV29 (28S ribosomal protein S16, mitochondrial,putative OS=Schistosoma mansoni OX=6183 GN=Smp_066480 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 9.251e-36
Identity = 71/145 (48.97%), Postives = 96/145 (66.21%), Query Frame = 3
Query:  120 ASLWVHAPR-HGRKIAKIVPVKPNIKLKISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYL--HSMRILRE---EALKESGEEK---DVTL 527
            ++ W H P   GR++ K+ PV+   KL+I+LV EGC NRPFFTI +K+   +    G+EQ+GSWDPLPN +GEQL+ +N ER  YWI  GA+P + V++LLG+ G LPVH RSYL  H  RI      E LK+  +E+   D+TL
Sbjct:   57 STWWPHQPLVPGRRVVKLYPVRFRNKLRIALVREGCSNRPFFTIQIKSNLAESKKIGIEQVGSWDPLPNIHGEQLIALNFERISYWIGMGAEPTVRVAELLGLCGFLPVHPRSYLMAHRARIAMAKYLERLKQKQDEQVTDDITL 201          
BLAST of 28S ribosomal protein S16 vs. TrEMBL
Match: A0A504Y769 (Putative 28S ribosomal protein S16 mitochondrial OS=Fasciola gigantica OX=46835 GN=FGIG_01502 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 9.277e-36
Identity = 60/117 (51.28%), Postives = 85/117 (72.65%), Query Frame = 3
Query:  129 WVHAPRH-GRKIAKIVPVKPNIKLKISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPN-ANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMR 473
            W H PR  GR+IA++ PV+   + +I LV EGC NRPFFTI +K++  +    G+EQ+GSWDP PN  +GEQLV +N++R  YW+A+ A+P+  V++LLG+ G+LPVH RSYL + R
Sbjct:   51 WTHVPRQPGRRIARMYPVRSRHRPRIVLVREGCTNRPFFTIQIKSSLSEAKQQGIEQVGSWDPFPNKTHGEQLVALNLDRIFYWLARKAEPSTRVAELLGLAGVLPVHPRSYLVAHR 167          
BLAST of 28S ribosomal protein S16 vs. TrEMBL
Match: A0A4E0RHC6 (Putative 28S ribosomal protein S16 mitochondrial OS=Fasciola hepatica OX=6192 GN=D915_003561 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.000e-35
Identity = 60/117 (51.28%), Postives = 85/117 (72.65%), Query Frame = 3
Query:  129 WVHAPRH-GRKIAKIVPVKPNIKLKISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPN-ANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMR 473
            W H PR  GR+IA++ PV+   + +I LV EGC NRPFFTI +K++  +    G+EQ+GSWDP PN  +GEQLV +N++R  YW+A+ A+P+  V++LLG+ G+LPVH RSYL + R
Sbjct:   51 WTHVPRQPGRRIARMYPVQSRHRPRIVLVREGCTNRPFFTIQIKSSLSETKQQGIEQVGSWDPFPNKTHGEQLVALNLDRIFYWLARKAEPSTRVAELLGLAGVLPVHPRSYLVAHR 167          
BLAST of 28S ribosomal protein S16 vs. TrEMBL
Match: A0A183K522 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS10093 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.649e-35
Identity = 64/136 (47.06%), Postives = 92/136 (67.65%), Query Frame = 3
Query:  120 ASLWVHAPR-HGRKIAKIVPVKPNIKLKISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYL--HSMRILREEALKESGEEKD 518
            ++ W H P   GR++ K+ PV+   KL+I+LV EGC NRPFFTI +K+   +    G+EQ+GSWDPLPN +GEQL+ +N ER  YWI  GA+P + V++LLG+ G LP+H RSYL  H  RI   + L+   ++++
Sbjct:   11 STWWPHQPLIPGRRVVKLYPVRFRNKLRIALVREGCSNRPFFTIQIKSNLAESKKNGIEQVGSWDPLPNIHGEQLIALNFERISYWIGMGAEPTVRVAELLGLCGFLPIHPRSYLMAHRARIAMMKYLERQKQKQN 146          
BLAST of 28S ribosomal protein S16 vs. Ensembl Cavefish
Match: mrps16 (mitochondrial ribosomal protein S16 [Source:NCBI gene;Acc:103029495])

HSP 1 Score: 82.4185 bits (202), Expect = 6.097e-20
Identity = 38/97 (39.18%), Postives = 54/97 (55.67%), Query Frame = 3
Query:  201 ISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRSYLHSMRILREEA 491
            I L L G  NRPF+ I         +   +EQ+GS+DPLPN   E+LV  N +R  YW+  GA P   V++LLG+ G  P+H  +   + R ++ EA
Sbjct:   19 IRLALGGATNRPFYRIVAAYNKRSRDGKYIEQLGSYDPLPNIYNEKLVSFNFDRIKYWMGCGAHPTKPVAKLLGLAGFFPLHPMTITEAERRIKSEA 115          
BLAST of 28S ribosomal protein S16 vs. Ensembl Yeast
Match: MRPS16 (Mitochondrial ribosomal protein of the small subunit [Source:SGD;Acc:S000005934])

HSP 1 Score: 47.7506 bits (112), Expect = 5.785e-8
Identity = 29/91 (31.87%), Postives = 48/91 (52.75%), Query Frame = 3
Query:  195 LKISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPN-ANGEQL---------VGINMERFLYWIAQGAQPNLIVSQLLGIGGIL 437
            ++I L   G  N P + I V N+ +  +A  +E +G++ P+P+     +L         V ++ +R  YWI  GAQP+  V++LL   GIL
Sbjct:    6 VRIRLARFGRKNSPVYNIVVANSRKARDAKPIEVLGTYVPVPSPVTKRELKRGVVPIKDVKLDFDRTKYWIGVGAQPSETVTKLLRKAGIL 96          
BLAST of 28S ribosomal protein S16 vs. Ensembl Nematostella
Match: EDO38894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBM0])

HSP 1 Score: 87.8113 bits (216), Expect = 1.557e-22
Identity = 39/87 (44.83%), Postives = 56/87 (64.37%), Query Frame = 3
Query:  195 LKISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVHHRS 455
            + + L L GC NRPFF +   +  +  N    EQIG++DPLPN   E+L+ +N++R  YW++ GA+P   V+ LLG+ GILPVH  S
Sbjct:    6 VALRLALYGCKNRPFFYLVASHRKKARNRGYFEQIGTYDPLPNDRNEKLISLNVDRIKYWLSVGAEPTRPVAMLLGLAGILPVHPHS 92          
BLAST of 28S ribosomal protein S16 vs. Ensembl Medaka
Match: mrps16 (mitochondrial ribosomal protein S16 [Source:NCBI gene;Acc:101161772])

HSP 1 Score: 73.559 bits (179), Expect = 1.340e-16
Identity = 32/84 (38.10%), Postives = 48/84 (57.14%), Query Frame = 3
Query:  195 LKISLVLEGCVNRPFFTIHVKNTNEKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQLLGIGGILPVH 446
            ++++L      NRPF+ I         +   +EQ+G++DPLPN   E+LV  N +R  YWI  GA P   V++LLG+ G  P+H
Sbjct:   19 IRLALAGHKQANRPFYRIVAAYNKRARDNKYLEQLGTYDPLPNIYNEKLVSFNFDRIKYWIGCGAHPTKPVAKLLGLAGFFPLH 102          
The following BLAST results are available for this feature:
BLAST of 28S ribosomal protein S16 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MRPS169.667e-2142.57mitochondrial ribosomal protein S16 [Source:HGNC S... [more]
MRPS168.200e-1746.84mitochondrial ribosomal protein S16 [Source:HGNC S... [more]
back to top
BLAST of 28S ribosomal protein S16 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps-166.459e-1637.63Probable 28S ribosomal protein S16, mitochondrial ... [more]
back to top
BLAST of 28S ribosomal protein S16 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mRpS164.798e-2643.81gene:FBgn0033907 transcript:FBtr0087578[more]
back to top
BLAST of 28S ribosomal protein S16 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mrps161.448e-1939.81mitochondrial ribosomal protein S16 [Source:ZFIN;A... [more]
mrps161.448e-1939.81mitochondrial ribosomal protein S16 [Source:ZFIN;A... [more]
mrps161.736e-1939.81mitochondrial ribosomal protein S16 [Source:ZFIN;A... [more]
back to top
BLAST of 28S ribosomal protein S16 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl37a9.088e-2137.96ribosomal protein L37a [Source:Xenbase;Acc:XB-GENE... [more]
rpl37a1.024e-2037.96ribosomal protein L37a [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of 28S ribosomal protein S16 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mrps161.165e-1946.51mitochondrial ribosomal protein S16 [Source:MGI Sy... [more]
back to top
BLAST of 28S ribosomal protein S16 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9V6Y3|RT16_DROME4.809e-2543.81Probable 28S ribosomal protein S16, mitochondrial ... [more]
sp|P82915|RT16_BOVIN4.409e-2042.5728S ribosomal protein S16, mitochondrial OS=Bos ta... [more]
sp|Q9Y3D3|RT16_HUMAN4.643e-2042.5728S ribosomal protein S16, mitochondrial OS=Homo s... [more]
sp|Q5REY4|RT16_PONAB1.614e-1942.5728S ribosomal protein S16, mitochondrial OS=Pongo ... [more]
sp|Q9CPX7|RT16_MOUSE8.152e-1946.5128S ribosomal protein S16, mitochondrial OS=Mus mu... [more]
back to top
BLAST of 28S ribosomal protein S16 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D3PJD71.267e-3752.10Probable 28S ribosomal protein S16, mitochondrial ... [more]
G4LV299.251e-3648.9728S ribosomal protein S16, mitochondrial,putative ... [more]
A0A504Y7699.277e-3651.28Putative 28S ribosomal protein S16 mitochondrial O... [more]
A0A4E0RHC61.000e-3551.28Putative 28S ribosomal protein S16 mitochondrial O... [more]
A0A183K5221.649e-3547.06Uncharacterized protein OS=Schistosoma curassoni O... [more]
back to top
BLAST of 28S ribosomal protein S16 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps166.097e-2039.18mitochondrial ribosomal protein S16 [Source:NCBI g... [more]
back to top
BLAST of 28S ribosomal protein S16 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 28S ribosomal protein S16 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MRPS165.785e-831.87Mitochondrial ribosomal protein of the small subun... [more]
back to top
BLAST of 28S ribosomal protein S16 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO388941.557e-2244.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 28S ribosomal protein S16 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps161.340e-1638.10mitochondrial ribosomal protein S16 [Source:NCBI g... [more]
back to top
BLAST of 28S ribosomal protein S16 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012660 ID=SMED30012660|Name=28S ribosomal protein S16|organism=Schmidtea mediterranea sexual|type=transcript|length=619bp
ATTTTACTTCATTTTAGTAATAGTTATAAACTGTAAAAATTTTATATATT
GAATTCACCATAATCTGTTATTGATTTTATTATATATTTTTGTAATAATA
TACTTCATTTATTTTTATGGCCTCTTTATGGGTTCATGCACCTAGACATG
GAAGGAAAATAGCAAAGATAGTTCCAGTTAAACCCAATATTAAACTTAAA
ATTTCGTTAGTACTTGAAGGTTGTGTTAATAGGCCATTTTTCACAATTCA
TGTGAAAAATACAAATGAAAAATGCAATGCACCAGGTGTTGAGCAGATTG
GCAGTTGGGACCCATTGCCTAATGCGAATGGTGAACAATTGGTAGGAATA
AATATGGAGCGTTTTTTGTACTGGATCGCACAAGGAGCCCAACCAAATCT
TATTGTTTCTCAGCTCTTGGGGATTGGTGGAATTTTGCCTGTTCATCATC
GAAGTTATTTGCATTCCATGCGAATATTACGTGAAGAAGCTTTGAAAGAA
AGTGGTGAAGAAAAAGATGTCACATTGCTTCGCAGAAAACCAAAAGGTGA
ATTCGGTTTAGGTTTCAAACTAGAACGTAAAGAGAACGCAGATTGAATAA
ATTGAATTATTCTTTTTTT
back to top

protein sequence of SMED30012660-orf-1

>SMED30012660-orf-1 ID=SMED30012660-orf-1|Name=SMED30012660-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=160bp
MASLWVHAPRHGRKIAKIVPVKPNIKLKISLVLEGCVNRPFFTIHVKNTN
EKCNAPGVEQIGSWDPLPNANGEQLVGINMERFLYWIAQGAQPNLIVSQL
LGIGGILPVHHRSYLHSMRILREEALKESGEEKDVTLLRRKPKGEFGLGF
KLERKENAD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000307Ribosomal_S16
IPR023803Ribosomal_S16_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023803Ribosomal protein S16 domain superfamilyGENE3DG3DSA:3.30.1320.10coord: 14..139
e-value: 1.5E-26
score: 94.5
IPR023803Ribosomal protein S16 domain superfamilySUPERFAMILYSSF54565Ribosomal protein S16coord: 27..124
IPR000307Ribosomal protein S16TIGRFAMTIGR00002TIGR00002coord: 27..105
e-value: 6.7E-14
score: 49.6
IPR000307Ribosomal protein S16PFAMPF00886Ribosomal_S16coord: 35..93
e-value: 6.6E-15
score: 54.9
IPR000307Ribosomal protein S16PANTHERPTHR1291930S RIBOSOMAL PROTEIN S16coord: 21..131
NoneNo IPR availablePANTHERPTHR12919:SF2728S RIBOSOMAL PROTEIN S16, MITOCHONDRIALcoord: 21..131