Serine/threonine-protein phosphatase with EF-hands

Overview
NameSerine/threonine-protein phosphatase with EF-hands
Smed IDSMED30012659
Length (bp)1935
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase with EF-hands (SMED30012659) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase with EF-hands (SMED30012659) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase with EF-hands (SMED30012659) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase with EF-hands (SMED30012659) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012659

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30012659SMESG000003989.1 SmedASXL_010207SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30012659SMESG000003989.1 dd_Smed_v4_21185_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012659SMESG000003989.1 dd_Smed_v4_21185_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012659SMESG000003989.1 dd_Smed_v6_21185_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012659SMESG000003989.1 OX_Smed_1.0.07890ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30012659SMESG000003989.1 Contig3718newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30012659SMESG000003989.1 Contig3718uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30012659SMESG000057720.1 Contig3718newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30012659SMESG000057720.1 Contig3718uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF1 (protein phosphatase with EF-hand domain 1 [Source:HGNC Symbol;Acc:HGNC:9243])

HSP 1 Score: 395.201 bits (1014), Expect = 1.171e-128
Identity = 234/628 (37.26%), Postives = 356/628 (56.69%), Query Frame = 2
Query:  140 ATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIP-WADIDALDA--SHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEI--SPV-SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVL--------QYESDN-MNECEI--------------------NEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFR-------KNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETD----VPYLTMINNAEIQY-TNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQN-PLQDEELTQLWKNFDLNNDGWIDKEEFLK 1879
             +L+A L+IQ +YR Y+A+ +A++     I Q +EY++EQ Q+ +    S  L N    H   K +    N  L  ++     W  +D++D   S+NG +L++P+T   +  L+E +K     L    ++E+L   + VL+ +PN   I  SP   +TICGD+HG  DDL  IF KN LPS  NPY+FNGDFVDRG  S+E++ +L V FL  PN + LNRGNHED  MN RYGF KE+ +KYK   + ++++  E ++ LP+ T++ N + V+HGGIS  TDL ++  + R K KSVL         +++D+  N+  +                    +EW+Q++++LWSDPR  NGC  NT RGGGCYFGPDVT + L K  +K++IRSHECK  G++ CH+ KV+T+FSASNYYE GSN GA+  +      R  QY+  +   F+         E  +++ L   +  +++ L + F+  D  KSG +S+ QW   M  I+ ++LPWR L      ++LV  D    V Y++   N  I+    +  S+L E   R+ S++E +F+ +D+ +SG ++  EF    +  +   N  + D ++ +L    DLN DG ID  EFLK
Sbjct:   15 TSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLENYTHIH---KEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKE-QQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQPLRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLS-----SNLVNIDQNGNVEYMSSFQNIRIEKPVQEAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLK 633          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF1 (protein phosphatase with EF-hand domain 1 [Source:HGNC Symbol;Acc:HGNC:9243])

HSP 1 Score: 295.434 bits (755), Expect = 4.781e-91
Identity = 199/599 (33.22%), Postives = 311/599 (51.92%), Query Frame = 2
Query:  140 ATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIP-WADIDALDA--SHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEI--SPV-SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFR-------KNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETD----VPYLTMINNAEIQY-TNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQN-PLQDEELTQLWKNFDLNNDGWIDKEEFLK 1879
             +L+A L+IQ +YR Y+A+ +A++     I Q +EY++EQ Q+ +    S  L N    H   K +    N  L  ++     W  +D++D   S+NG +L++P+T   +  L+E +K     L    ++E+L   + VL+ +PN   I  SP   +TICGD+HG  DDL  IF KN LPS  NPY+FNGDFVDRG  S+E++ +L V FL  PN + LNRGNHED  MN RYGF KE+ +KYK   + ++++  E ++ LP+ T++ N + V+HGGIS  TDL ++  + R K KSVL   ++   + + +     +           G   N +        P   L              HE     W     ++V+T+FSASNYYE GSN GA+  +      R  QY+  +   F+         E  +++ L   +  +++ L + F+  D  KSG +S+ QW   M  I+ ++LPWR L      ++LV  D    V Y++   N  I+    +  S+L E   R+ S++E +F+ +D+ +SG ++  EF    +  +   N  + D ++ +L    DLN DG ID  EFLK
Sbjct:   15 TSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLENYTHIH---KEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKE-QQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKV-----------GVTFNAHGRIKTNGSPTEHLT------------EHE-----W-----EQVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQPLRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLS-----SNLVNIDQNGNVEYMSSFQNIRIEKPVQEAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLK 571          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 216.468 bits (550), Expect = 2.948e-60
Identity = 115/299 (38.46%), Postives = 182/299 (60.87%), Query Frame = 2
Query: 1025 ESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVD-------FRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINN-AEIQYTNKKI-SSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQN-PLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            E+  + +    EW+QV+++LWSDP    GCK NT RGGGCYFGPDVT Q L+K  M+ +IRSHECK  G+++CH  KVLT+FSASNYYE+GSN GA+  +  +    I QY++ +            + EE ++R L  +++   + LL +F++ D DK G+I++  W  A+ +++++ LPWR L+  L+ +S  +  + Y + + N A+ Q + + I SSL E   R  SN+E +F ++DS +SG ++  EF +  +  +   N  + D+ +  L ++ D N DG ID  EFL+  R+
Sbjct:  426 EAGELRKPTQEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYNMQFLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKVTHTLTMRQRISRVEESALRALREKLFAHSSDLLSEFKKHDADKVGLITLSDWAAAVESVLHLGLPWRMLRPQLVNSS-ADNMLEYKSWLKNLAKEQLSRENIQSSLLETLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMNIDITDDCICDLARSIDFNKDGHIDINEFLEAFRL 723          

HSP 2 Score: 209.149 bits (531), Expect = 1.319e-57
Identity = 116/321 (36.14%), Postives = 178/321 (55.45%), Query Frame = 2
Query:  131 NIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITL-HNNPERHFDVKCKFSKFN-DILPPDKQAIPWADIDALDA--SHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQV 1072
            N     KA  LIQ++YRRY A+ E +R+  W I Q +EY+ +Q+Q+ +    S  + H  P  H D       F  D    D +    +D ++++   S+ G +L +P+       LVE ++    +L  R ++ LL   +  L  LPN+  +S      IT+CGD+HG  DDL+ IF KN LPS    Y+FNGDFVDRG  SVE++ +L    L  P    LNRGNHEDH +N RYGF KE+ NKYK   + +++   + F  LPLAT++   + ++HGG+S  TDL ++  + R K  S ++ ++   +E ++ E ++ 
Sbjct:   15 NAERAFKAAALIQRWYRRYVARLEMRRRCTWSIFQSIEYAGQQDQVKLHDFFSYLMDHFIPSSHNDRDFLTRIFTEDRFAQDSEMKKCSDYESIEVPDSYTGPRLSFPLLPDHATALVEAFRL-KQQLHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDLHGQLDDLIFIFYKNGLPSPERSYVFNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGNHEDHMVNLRYGFTKEVMNKYKVHGKEILRTLQDVFCWLPLATLIDEKVLILHGGVSDITDLELLDKIERSKIVSTMRCKTRQKSEKQMEEKRRA 334          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 209.534 bits (532), Expect = 7.098e-59
Identity = 116/321 (36.14%), Postives = 178/321 (55.45%), Query Frame = 2
Query:  131 NIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITL-HNNPERHFDVKCKFSKFN-DILPPDKQAIPWADIDALDA--SHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQV 1072
            N     KA  LIQ++YRRY A+ E +R+  W I Q +EY+ +Q+Q+ +    S  + H  P  H D       F  D    D +    +D ++++   S+ G +L +P+       LVE ++    +L  R ++ LL   +  L  LPN+  +S      IT+CGD+HG  DDL+ IF KN LPS    Y+FNGDFVDRG  SVE++ +L    L  P    LNRGNHEDH +N RYGF KE+ NKYK   + +++   + F  LPLAT++   + ++HGG+S  TDL ++  + R K  S ++ ++   +E ++ E ++ 
Sbjct:   15 NAERAFKAAALIQRWYRRYVARLEMRRRCTWSIFQSIEYAGQQDQVKLHDFFSYLMDHFIPSSHNDRDFLTRIFTEDRFAQDSEMKKCSDYESIEVPDSYTGPRLSFPLLPDHATALVEAFRL-KQQLHARYVLNLLYETKKHLVQLPNINRVSTCYSEEITVCGDLHGQLDDLIFIFYKNGLPSPERSYVFNGDFVDRGKDSVEILMILFAFMLVYPKEFHLNRGNHEDHMVNLRYGFTKEVMNKYKVHGKEILRTLQDVFCWLPLATLIDEKVLILHGGVSDITDLELLDKIERSKIVSTMRCKTRQKSEKQMEEKRRA 334          

HSP 2 Score: 158.303 bits (399), Expect = 1.482e-40
Identity = 74/164 (45.12%), Postives = 107/164 (65.24%), Query Frame = 2
Query: 1025 ESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQE---GVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVIS 1495
            E+  + +    EW+QV+++LWSDP    GCK NT RGGGCYFGPDVT Q L+K  M+ +IRSHECK  G+++CH  KVLT+FSASNYYE+GSN GA+  +  +    I QY++ +    +  R+     EE ++R L  +++   + LL +F++ D DK G+ S
Sbjct:  426 EAGELRKPTQEEWRQVVDILWSDPMAQEGCKANTIRGGGCYFGPDVTQQLLQKYNMQFLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKVTHTLTMRQRISRVEESALRALREKLFAHSSDLLSEFKKHDADKVGLAS 589          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Match: PPP5C (protein phosphatase 5 catalytic subunit [Source:HGNC Symbol;Acc:HGNC:9322])

HSP 1 Score: 196.823 bits (499), Expect = 3.410e-55
Identity = 115/294 (39.12%), Postives = 166/294 (56.46%), Query Frame = 2
Query:  443 ITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEIS---PVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAF 1315
            +T   ++ L+++YK    KL  +   ++L++ + VL  L  + E +      IT+CGD HG F DL+ IF+ N LPS +NPY+FNGDFVDRGS SVEVI  L    L  P+   L RGNHE   MN  YGF  E+  KY   +  + +LF+E F  LPLA  +   + ++HGG+  +  + +  I + E+ +       D+   C         +LLWSDP+P NG  ++  RG  C FGPDVT  FLE+N +  IIRSHE K  G++  H  + +T+FSA NY +   N  ++
Sbjct:  185 VTISFMKELMQWYKD-QKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKY---TAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQ----PPDSGPMC---------DLLWSDPQPQNGRSISK-RGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASY 460          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 390.963 bits (1003), Expect = 1.330e-127
Identity = 228/650 (35.08%), Postives = 357/650 (54.92%), Query Frame = 2
Query:   59 MGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDA------------------LDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ------YESDNMNEC-EINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFA-IIDKSANVRITQY---KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLG---QNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            MGC  SS   + N + ++          T+K+ +LIQK+YRR  A+ EA+R+  W+I   +EY+ EQ+Q+ +    +  +    E +     +  + + ++         + +D+                  +D ++ G  L  P+    V  ++E +K  N  L  + ++ +L  A+ + + +P+V  IS      +TICGD+HG FDDL  I  KN  PS  NPY+FNGDFVDRG +S+EV+ VL    + +P +++LNRGNHEDH MN RYGF KEL+ KYK++S  + +L  + FS LP+AT++   +FVVHGGIS  T+++ +  + R +F+SVL+       ES+  N    ++EWKQ+L+++WSDP+   GC  N +RGGG YFG D+T  FLEK+  +L++RSHECK  G+++ H +  LT+FSASNYYE GSN GA+   I KS      QY   K+      R+     EE +V+ L  ++      L K+F   DI+KSG + I +W   +  I  ++LPW  L   +   S     V Y      A++  T+ +   + E   R  S +E +F  +D   SG ++  EF +  +   LG   + PLQ + ++Q+ ++ D N DG+ID  E L+  R+
Sbjct:    1 MGCGPSSG--RQNPSTEL----------TIKSAILIQKWYRRCEARLEARRRATWQIFTALEYAGEQDQLKLYDFFADVIRAMAEENGKGGVENGRNSPLMSALSHYAKPSLMDSEGETVKKMLEDTSPTNVDIDRNYKGPTLSLPLDKPQVAKMIEAFKV-NKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKSTLRERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGKYVMYKEDRRIAQVGGTHAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACE--VLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRL 635          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 389.808 bits (1000), Expect = 2.436e-126
Identity = 222/622 (35.69%), Postives = 347/622 (55.79%), Query Frame = 2
Query:  143 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDA------------------LDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ------YESDNMNEC-EINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFA-IIDKSANVRITQY---KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLG---QNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            T+K+ +LIQK+YRR  A+ EA+R+  W+I   +EY+ EQ+Q+ +    +  +    E +     +  + + ++         + +D+                  +D ++ G  L  P+    V  ++E +K  N  L  + ++ +L  A+ + + +P+V  IS      +TICGD+HG FDDL  I  KN  PS  NPY+FNGDFVDRG +S+EV+ VL    + +P +++LNRGNHEDH MN RYGF KEL+ KYK++S  + +L  + FS LP+AT++   +FVVHGGIS  T+++ +  + R +F+SVL+       ES+  N    ++EWKQ+L+++WSDP+   GC  N +RGGG YFG D+T  FLEK+  +L++RSHECK  G+++ H +  LT+FSASNYYE GSN GA+   I KS      QY   K+      R+     EE +V+ L  ++      L K+F   DI+KSG + I +W   +  I  ++LPW  L   +   S     V Y      A++  T+ +   + E   R  S +E +F  +D   SG ++  EF +  +   LG   + PLQ + ++Q+ ++ D N DG+ID  E L+  R+
Sbjct:   82 TIKSAILIQKWYRRCEARLEARRRATWQIFTALEYAGEQDQLKLYDFFADVIRAMAEENGKGGVENGRNSPLMSALSHYAKPSLMDSEGETVKKMLEDTSPTNVDIDRNYKGPTLSLPLDKPQVAKMIEAFKV-NKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKSTLRERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGKYVMYKEDRRIAQVGGTHAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACE--VLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRL 700          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pef-1 (Serine/threonine-protein phosphatase with EF-hands pef-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EBX9])

HSP 1 Score: 361.688 bits (927), Expect = 4.448e-117
Identity = 200/517 (38.68%), Postives = 301/517 (58.22%), Query Frame = 2
Query:  404 LDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ------YESDNMNEC-EINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFA-IIDKSANVRITQY---KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLG---QNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            +D ++ G  L  P+    V  ++E +K  N  L  + ++ +L  A+ + + +P+V  IS      +TICGD+HG FDDL  I  KN  PS  NPY+FNGDFVDRG +S+EV+ VL    + +P +++LNRGNHEDH MN RYGF KEL+ KYK++S  + +L  + FS LP+AT++   +FVVHGGIS  T+++ +  + R +F+SVL+       ES+  N    ++EWKQ+L+++WSDP+   GC  N +RGGG YFG D+T  FLEK+  +L++RSHECK  G+++ H +  LT+FSASNYYE GSN GA+   I KS      QY   K+      R+     EE +V+ L  ++      L K+F   DI+KSG + I +W   +  I  ++LPW  L   +   S     V Y      A++  T+ +   + E   R  S +E +F  +D   SG ++  EF +  +   LG   + PLQ + ++Q+ ++ D N DG+ID  E L+  R+
Sbjct:   52 IDRNYKGPTLSLPLDKPQVAKMIEAFKV-NKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKSTLRERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGKYVMYKEDRRIAQVGGTHAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACE--VLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRL 565          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: pph-5 (Serine/threonine-protein phosphatase 5 [Source:UniProtKB/Swiss-Prot;Acc:Q9NES8])

HSP 1 Score: 214.542 bits (545), Expect = 4.597e-62
Identity = 123/311 (39.55%), Postives = 181/311 (58.20%), Query Frame = 2
Query:  401 ALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEIS-PVS--ITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAII 1324
            A++ S++G +L+  IT + V  L++ +K+   KL  +   ++LL     ++ LP + EI+ P     TICGD+HG F DL  IF+ N  PS +NPYLFNGDFVDRGS SVE I  ++   L  PN  F++RGNHE   MN  YGF  E+  KY   ++ +  +FTETF  LPL  ++   +FV HGG+  +  + +  I + ++ +       D    C+         LLWSDP+P+NG +  + RG GC FGPDVT ++ E N ++ ++RSHE K  G++  H  +  T+FSA NY +  +N GAF  I
Sbjct:  171 AIEDSYDGPRLEDKITKEFVLQLIKTFKN-QQKLHKKYAFKMLLEFYNYVKSLPTMVEITVPTGKKFTICGDVHGQFYDLCNIFEINGYPSETNPYLFNGDFVDRGSFSVETIFTMIGFKLLYPNHFFMSRGNHESDVMNKMYGFEGEVKAKY---TQQMCDMFTETFCWLPLCHLINEKIFVCHGGLFKEDGVTLEDIRKTDRNRQ----PPDEGIMCD---------LLWSDPQPING-RSPSKRGVGCQFGPDVTSKWCETNGIEYVVRSHEVKPEGYEMHHNGQCFTVFSAPNYCDQMNNKGAFITI 463          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Match: C34D4.2 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:Q27475])

HSP 1 Score: 155.606 bits (392), Expect = 3.409e-42
Identity = 99/319 (31.03%), Postives = 166/319 (52.04%), Query Frame = 2
Query:  458 VRNLVEFYKS---GNNK--LSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFRKNEEE 1399
            ++NLVE  K    G+ +     ++LI+L  RA+ V     NV       + ICGD+HG ++DL+ + + N  P  +  YLF GD+VDRG  S+EVIS+L    + +P+ VFL RGNHE   +N +YGFF E   ++   S  L   F   F  +PL  V+ + +  +HGGIS   DL  +R L + +              C++ +   + +L W+DP         + RG G  FG +   +FL  + ++L++R+H+  M+G+++  + +++T+FSA +Y     N  A   +D+      T  +     D +K++E+
Sbjct:   25 LQNLVERLKGWTPGHCQKLFDEKELIQLCYRAREVFWK-NNVKLELKAPVKICGDLHGQYEDLLALLELNGWPPETK-YLFLGDYVDRGPFSIEVISLLFAYQVLHPDKVFLLRGNHESRPVNMQYGFFMECRKRF---SNALYDAFQLAFYCMPLCAVVSDKIICMHGGIS--EDLVDLRQLDKVE------------RPCDVPDIGVIADLTWADPDATIQMYAESQRGAGRVFGAEAVKKFLNTHHLELVVRAHQVVMDGYEFFADRQLVTIFSAPSYCGQMDNAAAVMTVDEELVCSFTVMRP----DLKKDKEK 320          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0473730)

HSP 1 Score: 356.295 bits (913), Expect = 1.279e-113
Identity = 216/624 (34.62%), Postives = 343/624 (54.97%), Query Frame = 2
Query:  131 NIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPE-----RHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVE-FYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVS------ITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEG----VDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTS------------LVETDVPYLTMINNAEIQ---YTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNP--LQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            ++  T++A + IQK+YRR++A+ E +R+  W+I Q +EY++EQ+Q  + K  +  + + P+       +      S  +D    D     + DI  ++A     K++ PI    +  L++ F K   N+L  + +  +L  A   L+ LPN   ISPVS      +T+CGD+HG  DDL+ +  KN LPS+SNPY+FNGDFVDRG + +EV+ +LL  +L  PNAVFLNRGNHED  MN+RYGF +E+ +KY    + ++    E +  LPL +VL + + +VHGG S  T L +I+ + R K+ S+L+    +    +  EW+Q+ +++WSDP+   GC  NT RG G +FGPDVT  FL+++ +  +IRSHECK NG ++ H++K++T+FSASNYY +GSN GA+  ++        QY S       + F++     E  +++ L   +   R+ L  +FR++D   SG ISI  W   M  +  + LPWR L+  L P +            L++TDV      +   +    Y NK             +++  +F+++D+  SG +T  EF   I +  +   P      E+ +  +  DLN DG +D  EFL+  R+
Sbjct:   17 DLETTIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD---KDDLVEEFGDI--VNA-----KIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPN---ISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANK-------------ASLVAIFNIIDADNSGEITLDEFETAI-DLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRL 613          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342946)

HSP 1 Score: 354.755 bits (909), Expect = 3.155e-113
Identity = 215/620 (34.68%), Postives = 340/620 (54.84%), Query Frame = 2
Query:  143 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPE-----RHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVE-FYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVS------ITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEG----VDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTS------------LVETDVPYLTMINNAEIQ---YTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNP--LQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
             ++A + IQK+YRR++A+ E +R+  W+I Q +EY++EQ+Q  + K  +  + + P+       +      S  +D    D     + DI  ++A     K++ PI    +  L++ F K   N+L  + +  +L  A   L+ LPN   ISPVS      +T+CGD+HG  DDL+ +  KN LPS+SNPY+FNGDFVDRG + +EV+ +LL  +L  PNAVFLNRGNHED  MN+RYGF +E+ +KY    + ++    E +  LPL +VL + + +VHGG S  T L +I+ + R K+ S+L+    +    +  EW+Q+ +++WSDP+   GC  NT RG G +FGPDVT  FL+++ +  +IRSHECK NG ++ H++K++T+FSASNYY +GSN GA+  ++        QY S       + F++     E  +++ L   +   R+ L  +FR++D   SG ISI  W   M  +  + LPWR L+  L P +            L++TDV      +   +    Y NK             +++  +F+++D+  SG +T  EF   I +  +   P      E+ +  +  DLN DG +D  EFL+  R+
Sbjct:    5 AIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD---KDDLVEEFGDI--VNA-----KIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPN---ISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANK-------------ASLVAIFNIIDADNSGEITLDEFETAI-DLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRL 597          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342949)

HSP 1 Score: 357.066 bits (915), Expect = 3.455e-113
Identity = 217/626 (34.66%), Postives = 343/626 (54.79%), Query Frame = 2
Query:  125 SSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPE-----RHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVE-FYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVS------ITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEG----VDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTS------------LVETDVPYLTMINNAEIQ---YTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNP--LQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            +S    T++A + IQK+YRR++A+ E +R+  W+I Q +EY++EQ+Q  + K  +  + + P+       +      S  +D    D     + DI  ++A     K++ PI    +  L++ F K   N+L  + +  +L  A   L+ LPN   ISPVS      +T+CGD+HG  DDL+ +  KN LPS+SNPY+FNGDFVDRG + +EV+ +LL  +L  PNAVFLNRGNHED  MN+RYGF +E+ +KY    + ++    E +  LPL +VL + + +VHGG S  T L +I+ + R K+ S+L+    +    +  EW+Q+ +++WSDP+   GC  NT RG G +FGPDVT  FL+++ +  +IRSHECK NG ++ H++K++T+FSASNYY +GSN GA+  ++        QY S       + F++     E  +++ L   +   R+ L  +FR++D   SG ISI  W   M  +  + LPWR L+  L P +            L++TDV      +   +    Y NK             +++  +F+++D+  SG +T  EF   I +  +   P      E+ +  +  DLN DG +D  EFL+  R+
Sbjct:   84 ASRAEKTIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD---KDDLVEEFGDI--VNA-----KIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPN---ISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANK-------------ASLVAIFNIIDADNSGEITLDEFETAI-DLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRL 682          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342947)

HSP 1 Score: 357.066 bits (915), Expect = 3.455e-113
Identity = 217/626 (34.66%), Postives = 343/626 (54.79%), Query Frame = 2
Query:  125 SSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPE-----RHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVE-FYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVS------ITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEG----VDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTS------------LVETDVPYLTMINNAEIQ---YTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNP--LQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            +S    T++A + IQK+YRR++A+ E +R+  W+I Q +EY++EQ+Q  + K  +  + + P+       +      S  +D    D     + DI  ++A     K++ PI    +  L++ F K   N+L  + +  +L  A   L+ LPN   ISPVS      +T+CGD+HG  DDL+ +  KN LPS+SNPY+FNGDFVDRG + +EV+ +LL  +L  PNAVFLNRGNHED  MN+RYGF +E+ +KY    + ++    E +  LPL +VL + + +VHGG S  T L +I+ + R K+ S+L+    +    +  EW+Q+ +++WSDP+   GC  NT RG G +FGPDVT  FL+++ +  +IRSHECK NG ++ H++K++T+FSASNYY +GSN GA+  ++        QY S       + F++     E  +++ L   +   R+ L  +FR++D   SG ISI  W   M  +  + LPWR L+  L P +            L++TDV      +   +    Y NK             +++  +F+++D+  SG +T  EF   I +  +   P      E+ +  +  DLN DG +D  EFL+  R+
Sbjct:   84 ASRAEKTIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD---KDDLVEEFGDI--VNA-----KIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPN---ISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANK-------------ASLVAIFNIIDADNSGEITLDEFETAI-DLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRL 682          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Match: rdgC (gene:FBgn0265959 transcript:FBtr0342948)

HSP 1 Score: 357.066 bits (915), Expect = 3.455e-113
Identity = 217/626 (34.66%), Postives = 343/626 (54.79%), Query Frame = 2
Query:  125 SSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPE-----RHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVE-FYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVS------ITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEG----VDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTS------------LVETDVPYLTMINNAEIQ---YTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNP--LQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            +S    T++A + IQK+YRR++A+ E +R+  W+I Q +EY++EQ+Q  + K  +  + + P+       +      S  +D    D     + DI  ++A     K++ PI    +  L++ F K   N+L  + +  +L  A   L+ LPN   ISPVS      +T+CGD+HG  DDL+ +  KN LPS+SNPY+FNGDFVDRG + +EV+ +LL  +L  PNAVFLNRGNHED  MN+RYGF +E+ +KY    + ++    E +  LPL +VL + + +VHGG S  T L +I+ + R K+ S+L+    +    +  EW+Q+ +++WSDP+   GC  NT RG G +FGPDVT  FL+++ +  +IRSHECK NG ++ H++K++T+FSASNYY +GSN GA+  ++        QY S       + F++     E  +++ L   +   R+ L  +FR++D   SG ISI  W   M  +  + LPWR L+  L P +            L++TDV      +   +    Y NK             +++  +F+++D+  SG +T  EF   I +  +   P      E+ +  +  DLN DG +D  EFL+  R+
Sbjct:   84 ASRAEKTIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD---KDDLVEEFGDI--VNA-----KIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPN---ISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANK-------------ASLVAIFNIIDADNSGEITLDEFETAI-DLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRL 682          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 231.106 bits (588), Expect = 5.625e-66
Identity = 130/331 (39.27%), Postives = 189/331 (57.10%), Query Frame = 2
Query:   59 MGCKLS---SNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFD----VKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ 1021
            MGC  S    N  + +  D  I  K SN   T+KA +LIQ++YRRY A  E +R+  W I Q +EY+ EQ+Q+ +    +  L N  + + +    +        D L  + + + +  I  +  S++G +L +P++      L+  +K     L  + +++LL   +  L+ +PNV  +S      ITICGD+HG  DDL+ IF KN LPS  NPY+FNGDFVDRG KS E+I +L    L  P+ + LNRGNHEDH MN RYGF +E+  KYK     +++L  + FSLLP+ATV+ N + +VHGGIS  TDL  +  + R K KS L+
Sbjct:    1 MGCGTSIAIENQTRPSETDGSI--KQSNPALTIKAAILIQRWYRRYVAHLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFTFMLDNFTQINGNGPDLISHLLDSVVDPLTEEVRQLKYEQI-MVPESYSGPRLSFPLSVTDTNALLSAFKE-EQTLHGKYVLQLLYETKKFLKQMPNVIYLSTSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSTEIIIILFAFVLLYPDHMHLNRGNHEDHIMNLRYGFTREVMQKYKTHGREILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALR 327          

HSP 2 Score: 199.519 bits (506), Expect = 1.514e-54
Identity = 101/288 (35.07%), Postives = 169/288 (58.68%), Query Frame = 2
Query: 1058 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGV-------DFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKIS-SLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEF--IQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            EW+QV+++LWSDP+  NGC  N++RGGGCYFGPDVT   L+K+ + L+IRSHECK  G++ CH  +V+T+FSASNYYE GSN GA+  +      R  QY+              R  E  ++R L  +++  R+ L+  F+++DI+ +G IS  +W   + +++ +DLPWR L+  L      + +V Y +   +         ++ +L E   R+ +++E +F+++D  +SG ++  EF +   + ++ LG   + D+ +  + ++ D N DG ID  EFL+  R+
Sbjct:  432 EWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYVKLGPELVPRFFQYQVSRSTRKLTLHQRVRVAEGSALRALKEKLYAHRSELMAAFQQYDINNTGRISTSEWAQVVESVLRLDLPWRTLRPRLARLG-TDGNVEYESCFEDISPGEPIPPVTPNLAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSSHLGV-AVNDQTIDDMARSIDFNKDGSIDFTEFLEAFRV 717          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 223.402 bits (568), Expect = 3.335e-63
Identity = 126/328 (38.41%), Postives = 185/328 (56.40%), Query Frame = 2
Query:   59 MGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFD----VKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ 1021
            MGC  +S   +N T     A         +KA +LIQ++YRRY A  E +R+  W I Q +EY+ EQ+Q+ +    +  L N  + + +    +        D L  + + + +  I  +  S++G +L +P++      L+  +K     L  + +++LL   +  L+ +PNV  +S      ITICGD+HG  DDL+ IF KN LPS  NPY+FNGDFVDRG KS E+I +L    L  P+ + LNRGNHEDH MN RYGF +E+  KYK     +++L  + FSLLP+ATV+ N + +VHGGIS  TDL  +  + R K KS L+
Sbjct:    1 MGCG-TSIAIENQTRPSETA---------IKAAILIQRWYRRYVAHLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFTFMLDNFTQINGNGPDLISHLLDSVVDPLTEEVRQLKYEQI-MVPESYSGPRLSFPLSVTDTNALLSAFKE-EQTLHGKYVLQLLYETKKFLKQMPNVIYLSTSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSTEIIIILFAFVLLYPDHMHLNRGNHEDHIMNLRYGFTREVMQKYKTHGREILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALR 316          

HSP 2 Score: 199.519 bits (506), Expect = 1.404e-54
Identity = 101/288 (35.07%), Postives = 169/288 (58.68%), Query Frame = 2
Query: 1058 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGV-------DFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKIS-SLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEF--IQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            EW+QV+++LWSDP+  NGC  N++RGGGCYFGPDVT   L+K+ + L+IRSHECK  G++ CH  +V+T+FSASNYYE GSN GA+  +      R  QY+              R  E  ++R L  +++  R+ L+  F+++DI+ +G IS  +W   + +++ +DLPWR L+  L      + +V Y +   +         ++ +L E   R+ +++E +F+++D  +SG ++  EF +   + ++ LG   + D+ +  + ++ D N DG ID  EFL+  R+
Sbjct:  421 EWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYVKLGPELVPRFFQYQVSRSTRKLTLHQRVRVAEGSALRALKEKLYAHRSELMAAFQQYDINNTGRISTSEWAQVVESVLRLDLPWRTLRPRLARLG-TDGNVEYESCFEDISPGEPIPPVTPNLAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSSHLGV-AVNDQTIDDMARSIDFNKDGSIDFTEFLEAFRV 706          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppef1 (protein phosphatase, EF-hand calcium binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-080303-27])

HSP 1 Score: 223.402 bits (568), Expect = 3.335e-63
Identity = 126/328 (38.41%), Postives = 185/328 (56.40%), Query Frame = 2
Query:   59 MGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFD----VKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ 1021
            MGC  +S   +N T     A         +KA +LIQ++YRRY A  E +R+  W I Q +EY+ EQ+Q+ +    +  L N  + + +    +        D L  + + + +  I  +  S++G +L +P++      L+  +K     L  + +++LL   +  L+ +PNV  +S      ITICGD+HG  DDL+ IF KN LPS  NPY+FNGDFVDRG KS E+I +L    L  P+ + LNRGNHEDH MN RYGF +E+  KYK     +++L  + FSLLP+ATV+ N + +VHGGIS  TDL  +  + R K KS L+
Sbjct:    1 MGCG-TSIAIENQTRPSETA---------IKAAILIQRWYRRYVAHLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFTFMLDNFTQINGNGPDLISHLLDSVVDPLTEEVRQLKYEQI-MVPESYSGPRLSFPLSVTDTNALLSAFKE-EQTLHGKYVLQLLYETKKFLKQMPNVIYLSTSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSTEIIIILFAFVLLYPDHMHLNRGNHEDHIMNLRYGFTREVMQKYKTHGREILQLLQDVFSLLPVATVIDNKVLIVHGGISDKTDLDFLSTVERHKVKSALR 316          

HSP 2 Score: 199.519 bits (506), Expect = 1.404e-54
Identity = 101/288 (35.07%), Postives = 169/288 (58.68%), Query Frame = 2
Query: 1058 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGV-------DFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKIS-SLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEF--IQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            EW+QV+++LWSDP+  NGC  N++RGGGCYFGPDVT   L+K+ + L+IRSHECK  G++ CH  +V+T+FSASNYYE GSN GA+  +      R  QY+              R  E  ++R L  +++  R+ L+  F+++DI+ +G IS  +W   + +++ +DLPWR L+  L      + +V Y +   +         ++ +L E   R+ +++E +F+++D  +SG ++  EF +   + ++ LG   + D+ +  + ++ D N DG ID  EFL+  R+
Sbjct:  421 EWQQVVDILWSDPKHQNGCSPNSFRGGGCYFGPDVTQTLLQKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYVKLGPELVPRFFQYQVSRSTRKLTLHQRVRVAEGSALRALKEKLYAHRSELMAAFQQYDINNTGRISTSEWAQVVESVLRLDLPWRTLRPRLARLG-TDGNVEYESCFEDISPGEPIPPVTPNLAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSSHLGV-AVNDQTIDDMARSIDFNKDGSIDFTEFLEAFRV 706          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 207.223 bits (526), Expect = 4.123e-59
Identity = 121/294 (41.16%), Postives = 172/294 (58.50%), Query Frame = 2
Query:  443 ITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEIS---PVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAF 1315
            +T K + +L++++K    KL  +   ++L++ + VL  LP++ EI+      ITICGD HG + DL+ IF+ N LPS +NPYLFNGDFVDRGS SVEVI  L    L  P    L RGNHE   MN  YGF  E+  KY   S  + KLF+E F  LPLA  + + + V+HGG+  +  + +  I + ++ +       D+   C         +LLWSDP+  NG  ++  RG  C FGPDVT +FLE+N ++ I+RSHE K  G++  H  K +T+FSA NY +   N GA+
Sbjct:  176 VTLKFMEDLMDWFKD-QKKLHRKCAYQILVQVKEVLTKLPSLVEITLKESEKITICGDTHGQYYDLLNIFELNSLPSPTNPYLFNGDFVDRGSFSVEVILTLFGFKLLYPEHFHLLRGNHETDNMNQMYGFEGEVKAKY---SSQMFKLFSEVFQWLPLAQCINDKVLVMHGGLFSEDGVTLDDIRKIDRNRQ----PPDSGPMC---------DLLWSDPQLQNGRSISK-RGVSCQFGPDVTERFLEQNKLEYIVRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAY 451          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Match: CU695117.1 (protein phosphatase with EF-hand domain 2a [Source:NCBI gene;Acc:100537120])

HSP 1 Score: 201.445 bits (511), Expect = 3.839e-55
Identity = 106/289 (36.68%), Postives = 176/289 (60.90%), Query Frame = 2
Query: 1055 NEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKS---QEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKI--SSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQ-NTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            +EWKQ+L+LLWSDP   +GC  N  RGGGCY+GP++T  FL ++ ++LIIRSHECK +G+++CH  KV+TLFSASNYYE+GSN GAF  +         QY++     G+ F +N    E  +++ L  +++  ++ LL  F+E D + +G+IS+  W  A+  ++++DLPWR L   L+ +S     + Y     +  ++  N ++   S+ E   R  S +E +F ++D+  SG ++F +F + ++  +   +  + DE + +L  + D NNDG ID +EF++  R+
Sbjct:  386 DEWKQILDLLWSDPMSQDGCVPNEVRGGGCYWGPNITEDFLNRHNLQLIIRSHECKQDGYEFCHNRKVVTLFSASNYYEIGSNRGAFVRLGPDLMPYFIQYQATSMTRGLSFPQNVKRTEHTALKVLREKLFAHKSDLLSAFQELDKENTGLISLSDWARAVERVLHLDLPWRILHPQLV-SSTTNGMLNYHGWFCDLALKKPNSEVIEQSMLETLYRHRSTLETIFRIVDTDNSGLISFEDFRQTLKLLSAYLKMEISDEVINELVVSMDTNNDGSIDIDEFMEAFRL 673          

HSP 2 Score: 190.66 bits (483), Expect = 2.739e-51
Identity = 111/297 (37.37%), Postives = 171/297 (57.58%), Query Frame = 2
Query:  200 EAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHN----NPERHF-------DVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNEC 1048
            E +R+  W I Q +EY++ Q+QI +   L   + N    + ER+        +  C+ +++       ++   + +ID  D  ++G +L +P+      +LVE +K+   +L +R +++LLL    +LR LPN+  +S      ITICGD+HG  +DL+ IF KN +PS   PY+FNGD+VDRG  S+EV+ +L    L  P  V+LNRGNHEDH +N RYGF KE+  KYK   + ++KL  + FS LPL TV+   + +VHGGIS  T+LA+I  + R ++ S L+        C
Sbjct:    2 EMRRRYTWNIFQSMEYADLQDQIKLYNFLGYLVDNFTPSSSERNLISHIFRENEVCRDAEW-------ERYFNYTNIDVPDI-YSGPRLTFPLDMDQAADLVEAFKN-KQQLHSRYVLQLLLETWKLLRVLPNINRVSTCHSKEITICGDLHGQLEDLLLIFYKNGMPSMEKPYVFNGDYVDRGKDSMEVLLILFAFLLVYPGDVYLNRGNHEDHIINLRYGFTKEVLGKYKLHGKRILKLLQKIFSWLPLVTVIDQRVLIVHGGISDSTNLALIARVDRHRYVSALRPPRKTTPSC 289          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 206.068 bits (523), Expect = 2.222e-58
Identity = 120/300 (40.00%), Postives = 172/300 (57.33%), Query Frame = 2
Query:  443 ITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEIS---PVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKS 1333
            +T   +  L++FYK    KL  + + ++L++ + +L  LP++ EIS      +T+CGD HG F DL+ IF  N LPS +NPY+FNGDFVDRGS SVEVI  L    L  P    L RGNHE   MN  YGF  E+  KY   S  + +LF+E F  LPLA  +   + ++HGG+  +  + + +I   E+ +       D+   C         +LLWSDP+P +G + ++ RG  C FGPDVT +FLE+N +  IIRSHE K  G++  H    +T+FSA NY +   N GA+  ++ S
Sbjct:  198 VTIDFMLELMQFYKD-QKKLHRKCVYQMLVQVKDILSKLPSLVEISLEKSQQVTVCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKY---SAQMFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQIRSIERNRQ----PPDSGPMC---------DLLWSDPQPQDG-RSSSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNGS 479          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: PPEF2 (protein phosphatase, EF-hand calcium binding domain 2 [Source:NCBI gene;Acc:100496073])

HSP 1 Score: 210.305 bits (534), Expect = 2.249e-58
Identity = 115/301 (38.21%), Postives = 183/301 (60.80%), Query Frame = 2
Query: 1025 ESDNMNECEIN--EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQE---GVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEI-QYTNKKI-SSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQN-PLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            ES  M+EC+I+  E KQ++++LWSDP P +GCK NT RGGGCYFGPDVT + L+K+ ++++IRSHECK  G+++CH  KVLT+FSASNYYE+GSN GAF  +         QY++      +  R+     EE ++R L  +++  ++ L+  FR +D +++G I++  W   + +++N+ LPWR L+  LI +S  E  + Y    +   + Q   + +  SL E   R  S++E +F ++DS  SG ++F EF    +  +   N  + DE + ++ ++ D N DG ID  EFL+  R+
Sbjct:  394 ESGEMHECDIDDEEKKQIVDILWSDPIPQDGCKSNTVRGGGCYFGPDVTEKILQKHGLQMLIRSHECKQEGYEFCHSGKVLTIFSASNYYEVGSNKGAFVKLGPDLVPHFVQYQASRLTNNLTLRQRVSTVEESALRALREKLFAHKSDLMNAFRNYDNNQTGYINLSDWAIVLESVLNLGLPWRMLRPQLIHSS-PEGLLRYREWFDELSVCQPIQEHLHDSLLEALYRNRSDLETIFRIIDSDSSGLISFEEFQHTWKLLSSHLNIEVSDEAICKMARSIDFNKDGNIDINEFLEAFRL 693          

HSP 2 Score: 198.364 bits (503), Expect = 3.462e-54
Identity = 113/284 (39.79%), Postives = 163/284 (57.39%), Query Frame = 2
Query:  200 EAKRKMIWKIHQLVEYSNEQNQILMQKLLSI-----TLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDALDA--SHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ 1021
            E +R+  W I Q +EY+ EQ+QI +    ++     T  N+ ER F  +  F++  +    D +   + D + ++   S+ G  L +PI       LVE +K  N +L +R ++ LL   +  L+ LPN+  IS      ITICGD+HG  DDL  IF KN LPS   PY+FNGDFVDRG +S+E++ +L    L  P  V LNRGNHED+ +N RYGF KE+  KYK   + ++K+    FS LPLAT++   + V HGG+S  TDL ++  + R KF S L+
Sbjct:    3 EVRRRCTWSIFQSIEYTGEQDQIKLYDFFNLLMDHFTPDNSKERDFICRI-FTEEENF--KDTELEKYCDYETIEVPESYTGPHLSFPIKPTHATALVEAFKQ-NQQLHSRYVLHLLHETKKYLKQLPNIKRISTSYGKEITICGDLHGRLDDLFLIFYKNGLPSPEKPYIFNGDFVDRGKQSIEILMILFAFQLVYPKVVHLNRGNHEDYIVNLRYGFTKEVMKKYKVHGKKILKMLQSVFSWLPLATLIDQKVLVTHGGVSDTTDLEILSKIERHKFASTLR 282          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: usp43 (ubiquitin specific peptidase 43 [Source:Xenbase;Acc:XB-GENE-940625])

HSP 1 Score: 201.445 bits (511), Expect = 1.955e-55
Identity = 108/288 (37.50%), Postives = 173/288 (60.07%), Query Frame = 2
Query: 1058 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQY---KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKIS-SLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEF--IQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            EWKQV+++LWSDPR  NGC  N++RGGGCYFGP+VT + L K   K++IRSHECK  G++ CH  KV+T+FSASNYY+ GSN GA+  +      R   Y   K    +   +     E+ ++R L  +I+  R+ L+  F+  D  ++G ISI +W +A+  ++++DLPWR L+  LI  +  +  V YL+   + +I+   K++  +L E   R+ +++E +F+++D  +SG ++  EF +   + ++ L  N + D  +  L  + D N DG ID  EFL+  R+
Sbjct:  367 EWKQVVDILWSDPRNQNGCTPNSFRGGGCYFGPNVTKKLLAKYNFKMLIRSHECKQEGYELCHNGKVVTIFSASNYYDEGSNRGAYLKLSPDLTPRFVPYQVSKCTRKLTLHQRVSAVEDTALRALREKIYAHRSELINAFKLCDPKETGKISISEWASAVEAVLHLDLPWRTLRPRLIKLT-SDGSVDYLSSFEDLQIEQPIKEVQPNLVETIYRYKADLEIIFNIIDKDHSGLISVEEFRQTWKLFSSHLHIN-IDDSAIDDLAHSIDTNKDGSIDFNEFLEAFRV 652          

HSP 2 Score: 170.244 bits (430), Expect = 1.770e-44
Identity = 103/308 (33.44%), Postives = 157/308 (50.97%), Query Frame = 2
Query:  143 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDV-KCKFSKFNDILPPDKQAIPWADIDALDA--SHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNEC 1048
             +KA +LIQ++YR Y A+ E +R+    I Q +EY+ EQ Q+ +    +  +      HF   K +       +   K+   + D + ++   S+ G ++ +P+T      L+  +K G  +L  R +++L    +  L+ LPN+  +S      ITICGD+HG  DDL+ IF KN LPST N YLFNGD VDRG  S+E++ +L    L  PN V +NRGNHED  MN                            S LPLAT++ + + ++HGGI   TDL  +  + R K+KS L+    +  +C
Sbjct:   18 AIKAAILIQRWYRFYTARLEMRRRYTLNIFQSIEYAEEQAQLQLSNFFTFMMD-----HFAHWKGQGPDLISDISNSKEGHKFIDYEKIEVPNSYGGPRITFPLTVSDTNALLRAFKQGQ-QLHARYVLQLFHETKKFLKQLPNIVHLSTSYSKEITICGDLHGKLDDLLLIFYKNGLPSTENHYLFNGDLVDRGKNSIEILVLLFTFLLMYPNNVHINRGNHEDPIMN---------------------------LSRLPLATIVDSKVLILHGGIGDKTDLDFLSSIDRFKYKSALRTPKTDSEKC 292          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 186.808 bits (473), Expect = 1.312e-51
Identity = 108/257 (42.02%), Postives = 149/257 (57.98%), Query Frame = 2
Query:  566 VYEIS-PVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKS 1333
            VY++   +S+ +CGD HG F DL+ IF  N LPS +NPY+FNGDFVDRGS SVEVI  L    L  P    L RGNHE   MN  YGF  E+  KY   S  + +LF+E F  LPLA  +   + ++HGG+  +  + + +I   E+ +       D+   C+         LLWSDP+P +G + ++ RG  C FGPDVT +FLE+N +  IIRSHE K  G++  H    +T+FSA NY +   N GA+  ++ S
Sbjct:  204 VYQVRFCLSLYMCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKY---SAQMFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQIRSIERNRQ----PPDSGPMCD---------LLWSDPQPQDG-RSSSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNGS 443          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:NCBI gene;Acc:493275])

HSP 1 Score: 185.652 bits (470), Expect = 6.856e-51
Identity = 113/300 (37.67%), Postives = 166/300 (55.33%), Query Frame = 2
Query:  443 ITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEIS---PVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKS 1333
            +T   +  L++FYK    KL  + + ++L++ + +L  LP++ EIS      +T+CGD HG F DL+ IF  N LPS +NPY+FNGDFVDRGS SVEVI  L    L  P    L RGNHE   MN  YGF  E+  KY   S  + +LF+E F  LPLA  +   + ++HGG+  +  + + +I      +S+ +      +   +     +   ++SD R       ++ RG  C FGPDVT +FLE+N +  IIRSHE K  G++  H    +T+FSA NY +   N GA+  ++ S
Sbjct:  198 VTIDFMLELMQFYKD-QKKLHRKCVYQMLVQVKDILSKLPSLVEISLEKSQQVTVCGDTHGQFYDLMNIFHLNGLPSENNPYIFNGDFVDRGSFSVEVIVTLFGFKLLYPAHFHLLRGNHETDTMNQMYGFEGEVKAKY---SAQMFQLFSEVFQWLPLAMCVNQRVLIMHGGLFSEDGVTLDQI------RSIERNRQPPDSGVTLVLLLLLSFPIFSDGRS------SSKRGVSCQFGPDVTRRFLEENGLDYIIRSHEVKPEGYEVSHNGLCVTVFSAPNYCDQMGNKGAYIHLNGS 481          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef1 (protein phosphatase with EF hand calcium-binding domain 1 [Source:MGI Symbol;Acc:MGI:1097157])

HSP 1 Score: 374.015 bits (959), Expect = 1.105e-120
Identity = 230/622 (36.98%), Postives = 348/622 (55.95%), Query Frame = 2
Query:  143 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDAL---DASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVL-------QYESDNMNECEIN--------------------EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEG-----VDFRKNEEES--VRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKI-SSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEF--IQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLK 1879
             +KA L+IQ +YRRYRA+   ++     I Q +EYS+EQ Q+ +    S  L N  + + +     ++  D    + Q     D   L     S++G +L++P+T   +  L++ +K     L    ++E+L  A+ VL+ +PN   +       ITICGD+HG  DDL+ IF KN LPS +NPY+FNGDFVDRG+ S+E++ +LLVCFL  P+ + LNRGNHED  MN RYGF KE+  KYK     ++++  E ++ LP+ T++ N + V+HGGIS  TDL  +  L+R K KSVL       Q   +  N+   N                    EW+Q++++LWSDPR   GC  NT RGGGCYFGPDVT + L KN +K++IRSHECK +G++  H+ KV+T+FSASNYYE GSN GA+  +      +  QY+         +  R N  ES   + L  ++  ++  L+  F   D  +SG IS+ +W  +M  I+ ++LPWR L  +L+ T      V Y++  ++  I+   K + S+L E   R+ S+++ +F+++DS  SG ++  EF     + N     + + D ++ +L    D N DG ID  EFLK
Sbjct:   16 VIKAALVIQNWYRRYRARLRVRQHYALAIFQSIEYSDEQGQMQLSSFFSFMLENYTKTNNEDSALVTRIFDNTRRESQIKDRDDFLGLIEVPDSYDGPRLQFPLTFTDIHILLQAFKQ-QQILHAHYVLEVLFEARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIGTIIDNEILVIHGGISESTDLNTLHQLQRNKMKSVLMPPVLGNQETGEKRNKSASNYVEPRKVEPDKTPSEDLTKQEWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHECKPDGYEVSHDGKVITVFSASNYYEEGSNRGAYIRLSYGTMPQFFQYQVTSTSCLNPLHQRMNAMESSAFKILKEKMISRKTDLINAFELRDHSRSGRISLAEWAFSMENILGLNLPWRSLSSHLV-TIDSSGSVDYMSSFDDIRIEKPTKDMKSNLTETMYRYRSDLKIIFNIIDSDQSGLISMDEFRTMWKLFNAHYKAH-IDDSQIDELASIVDFNKDGNIDFNEFLK 634          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef2 (protein phosphatase, EF hand calcium-binding domain 2 [Source:MGI Symbol;Acc:MGI:1342304])

HSP 1 Score: 217.238 bits (552), Expect = 9.917e-61
Identity = 115/291 (39.52%), Postives = 182/291 (62.54%), Query Frame = 2
Query: 1058 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVD-------FRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINN-AEIQYTNKKI-SSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAE----FIQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            EWKQV+++LWSDP    GCK N  RGGGCYFGPDVT + +EK  ++L+IRSHECK  G+++CH  KVLT+FSASNYYE+GSN GA+  +  +    I QY++ +            + EE ++R L  +++   + LL +FR+ D D+SGVI++  W TA+ +++++ LPWR L+  L+ +S  +  + Y + +++ A+ Q + + I SSL E   R  SN+E +F ++DS +SG ++  EF +    F  + ++    + D+ +  L ++ D N DG ID  EFL+  R+
Sbjct:  441 EWKQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKATHRLTMRQRISRVEESALRALRQKLFAHSSDLLVEFRKRDPDESGVITLSDWATAVESVLHLGLPWRMLRPQLVNSS-ADNVLEYRSWLDSLAKEQLSRENIQSSLLEKLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMSID---ITDDGICDLARSIDFNKDGHIDINEFLEAFRL 727          

HSP 2 Score: 207.994 bits (528), Expect = 2.408e-57
Identity = 118/316 (37.34%), Postives = 174/316 (55.06%), Query Frame = 2
Query:  131 NIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITL-HNNPERHFDVKCKFSKFND-ILPPDKQAIPWADIDALDA--SHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVL----QYESDNMNE 1045
            N     KA  LIQ++YRRY A+ E +R+  W I Q +EY+ +Q+Q+ + +  S  + H  P  H +       F +     D +     D ++++   S+ G +L +P+       LVE ++    +L  R ++ LL   +  L  LPN+  +S      +T+CGD+HG  DDL+ IF KN LPS    Y+FNGDFVDRG  SVEV+ VL    L  P    LNRGNHEDH +N RYGF KE+ +KYK   + +++   + F  LPLAT++   + V+HGG+S  TDL ++  L R K  S +    + ES+N  E
Sbjct:   15 NAEKAFKAAALIQRWYRRYMARLEMRRRCTWNIFQSIEYAGQQDQVKLHEFFSYLVDHFTPSSHHERDFLNRMFTEERFAQDVETEEGGDFESIEVPDSYTGPRLSFPLLPDHATALVEAFRL-RQQLHARYVLNLLYETRKHLAQLPNINRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLATLVDEKVLVLHGGVSDKTDLELLAKLDRHKIVSTMRCKTRKESENREE 329          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppef2 (protein phosphatase, EF hand calcium-binding domain 2 [Source:MGI Symbol;Acc:MGI:1342304])

HSP 1 Score: 217.238 bits (552), Expect = 9.917e-61
Identity = 115/291 (39.52%), Postives = 182/291 (62.54%), Query Frame = 2
Query: 1058 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVD-------FRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINN-AEIQYTNKKI-SSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAE----FIQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            EWKQV+++LWSDP    GCK N  RGGGCYFGPDVT + +EK  ++L+IRSHECK  G+++CH  KVLT+FSASNYYE+GSN GA+  +  +    I QY++ +            + EE ++R L  +++   + LL +FR+ D D+SGVI++  W TA+ +++++ LPWR L+  L+ +S  +  + Y + +++ A+ Q + + I SSL E   R  SN+E +F ++DS +SG ++  EF +    F  + ++    + D+ +  L ++ D N DG ID  EFL+  R+
Sbjct:  441 EWKQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQYQANKATHRLTMRQRISRVEESALRALRQKLFAHSSDLLVEFRKRDPDESGVITLSDWATAVESVLHLGLPWRMLRPQLVNSS-ADNVLEYRSWLDSLAKEQLSRENIQSSLLEKLYRNRSNLETIFRIIDSDHSGFISLDEFRQTWKLFSSHMSID---ITDDGICDLARSIDFNKDGHIDINEFLEAFRL 727          

HSP 2 Score: 207.994 bits (528), Expect = 2.408e-57
Identity = 118/316 (37.34%), Postives = 174/316 (55.06%), Query Frame = 2
Query:  131 NIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITL-HNNPERHFDVKCKFSKFND-ILPPDKQAIPWADIDALDA--SHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVL----QYESDNMNE 1045
            N     KA  LIQ++YRRY A+ E +R+  W I Q +EY+ +Q+Q+ + +  S  + H  P  H +       F +     D +     D ++++   S+ G +L +P+       LVE ++    +L  R ++ LL   +  L  LPN+  +S      +T+CGD+HG  DDL+ IF KN LPS    Y+FNGDFVDRG  SVEV+ VL    L  P    LNRGNHEDH +N RYGF KE+ +KYK   + +++   + F  LPLAT++   + V+HGG+S  TDL ++  L R K  S +    + ES+N  E
Sbjct:   15 NAEKAFKAAALIQRWYRRYMARLEMRRRCTWNIFQSIEYAGQQDQVKLHEFFSYLVDHFTPSSHHERDFLNRMFTEERFAQDVETEEGGDFESIEVPDSYTGPRLSFPLLPDHATALVEAFRL-RQQLHARYVLNLLYETRKHLAQLPNINRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLATLVDEKVLVLHGGVSDKTDLELLAKLDRHKIVSTMRCKTRKESENREE 329          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppp5c (protein phosphatase 5, catalytic subunit [Source:MGI Symbol;Acc:MGI:102666])

HSP 1 Score: 196.438 bits (498), Expect = 5.287e-55
Identity = 115/294 (39.12%), Postives = 167/294 (56.80%), Query Frame = 2
Query:  443 ITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEIS---PVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAF 1315
            +T   +++L+++YK    KL  +   ++L++ + VL  L  + E +      IT+CGD HG F DL+ IF+ N LPS +NPY+FNGDFVDRGS SVEVI  L    L  P+   L RGNHE   MN  YGF  E+  KY   +  + +LF+E F  LPLA  +   + ++HGG+  +  + +  I + E+ +       D+   C         +LLWSDP+P NG  ++  RG  C FGPDVT  FLE+N +  IIRSHE K  G++  H  + +T+FSA NY +   N  ++
Sbjct:  186 VTITFMKDLMQWYKD-QKKLHRKCAYQILVQVKEVLCKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKY---TAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQ----PPDSGPMC---------DLLWSDPQPQNGRSVSK-RGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASY 461          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Match: Ppp5c (protein phosphatase 5, catalytic subunit [Source:MGI Symbol;Acc:MGI:102666])

HSP 1 Score: 187.963 bits (476), Expect = 3.372e-52
Identity = 104/242 (42.98%), Postives = 141/242 (58.26%), Query Frame = 2
Query:  590 ITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAF 1315
            IT+CGD HG F DL+ IF+ N LPS +NPY+FNGDFVDRGS SVEVI  L    L  P+   L RGNHE   MN  YGF  E+  KY   +  + +LF+E F  LPLA  +   + ++HGG+  +  + +  I + E+ +       D+   C         +LLWSDP+P NG  ++  RG  C FGPDVT  FLE+N +  IIRSHE K  G++  H  + +T+FSA NY +   N  ++
Sbjct:  214 ITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKY---TAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDGVTLDDIRKIERNRQ----PPDSGPMC---------DLLWSDPQPQNGRSVSK-RGVSCQFGPDVTKAFLEENQLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASY 438          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|Q3SWT6|PPE1_RAT (Serine/threonine-protein phosphatase with EF-hands 1 OS=Rattus norvegicus OX=10116 GN=Ppef1 PE=2 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 2.911e-131
Identity = 228/611 (37.32%), Postives = 347/611 (56.79%), Query Frame = 2
Query:  143 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSK-FNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEIN------------------EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDF-----RKNEEE--SVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISS-LGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEF--IQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLK 1879
             ++A L+IQ +YRRYRA+  A++     I Q +EY++EQ Q+ +    S  L N    H +     S+ F +     K    +  +  +  S++G +L++P+T   +  L++ +K     L    ++E+L  A+ +L+ +PN   I       ITICGD+HG  DDL+ IF KN LPS  NPY+FNGDFVDRG+ S+E++ +LLV FL  P  + LNRGNHED  MN RYGF KE+  KYK   + ++++  E ++ LP+ T++ N + V+HGGIS  TDL +++ L+R K KSVL        EC I                   EW+Q+++LLWSDPR   GC  NT RGGGCYFGPDVT + L KN +K++IRSHECK +G++ CH+ KV+T+FSASNYYE GSN GA+  +    + +  QY+            R N  E  + R L   +  ++  L+  F   D  ++G IS+ QW  +M +I+ ++LPWR L  +L+ T      V Y++  ++  I+   K + S L E   R+ S+++ +F+++D+  SG ++  EF     + N     + + D ++ +L    D N DG ID  EFL+
Sbjct:   16 VVRAALIIQNWYRRYRARLSARQHYALAIFQSIEYADEQGQMQLSSFFSFMLENYTNTHKEDSALVSRLFENTRLESKDREEYVGLIDVPDSYDGPRLQFPLTFTDINLLLQAFKQ-QQTLHAHYVLEVLFEARKILKQMPNFTRIQTFPAKEITICGDLHGKLDDLMLIFYKNGLPSEKNPYVFNGDFVDRGNNSMEILMILLVSFLVYPTDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGKKILQVLEELYTWLPIGTIIDNEILVIHGGISESTDLNILQQLQRNKMKSVLMPPMSTNQECNIKKNKAGPSEQSASEQLTKLEWEQIIDLLWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLNKNQLKMVIRSHECKPDGYEICHDGKVITVFSASNYYEEGSNRGAYIRLSYGTSPQFFQYQVTSTSCLNPLYQRVNAMEFSAFRILKERMIARKTDLINAFELRDHSRTGKISLAQWAFSMESILGLNLPWRSLSSHLVSTD-SSGSVDYMSSFDDIHIEKPMKDMKSDLIETMYRYRSDLKIIFNIIDTDQSGLISMDEFRTMWKLFNAHYKVH-IDDSQIDELASTMDSNKDGNIDFNEFLR 623          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|O14829|PPE1_HUMAN (Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens OX=9606 GN=PPEF1 PE=1 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 5.624e-128
Identity = 234/628 (37.26%), Postives = 356/628 (56.69%), Query Frame = 2
Query:  140 ATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIP-WADIDALDA--SHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEI--SPV-SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVL--------QYESDN-MNECEI--------------------NEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFR-------KNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETD----VPYLTMINNAEIQY-TNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQN-PLQDEELTQLWKNFDLNNDGWIDKEEFLK 1879
             +L+A L+IQ +YR Y+A+ +A++     I Q +EY++EQ Q+ +    S  L N    H   K +    N  L  ++     W  +D++D   S+NG +L++P+T   +  L+E +K     L    ++E+L   + VL+ +PN   I  SP   +TICGD+HG  DDL  IF KN LPS  NPY+FNGDFVDRG  S+E++ +L V FL  PN + LNRGNHED  MN RYGF KE+ +KYK   + ++++  E ++ LP+ T++ N + V+HGGIS  TDL ++  + R K KSVL         +++D+  N+  +                    +EW+Q++++LWSDPR  NGC  NT RGGGCYFGPDVT + L K  +K++IRSHECK  G++ CH+ KV+T+FSASNYYE GSN GA+  +      R  QY+  +   F+         E  +++ L   +  +++ L + F+  D  KSG +S+ QW   M  I+ ++LPWR L      ++LV  D    V Y++   N  I+    +  S+L E   R+ S++E +F+ +D+ +SG ++  EF    +  +   N  + D ++ +L    DLN DG ID  EFLK
Sbjct:   15 TSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEYADEQGQMQLSTFFSFMLENYTHIH---KEELELRNQSLESEQDMRDRWDYVDSIDVPDSYNGPRLQFPLTCTDIDLLLEAFKE-QQILHAHYVLEVLFETKKVLKQMPNFTHIQTSPSKEVTICGDLHGKLDDLFLIFYKNGLPSERNPYVFNGDFVDRGKNSIEILMILCVSFLVYPNDLHLNRGNHEDFMMNLRYGFTKEILHKYKLHGKRILQILEEFYAWLPIGTIVDNEILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDPRGKNGCFPNTCRGGGCYFGPDVTSKILNKYQLKMLIRSHECKPEGYEICHDGKVVTIFSASNYYEEGSNRGAYIKLCSGTTPRFFQYQVTKATCFQPLRQRVDTMENSAIKILRERVISRKSDLTRAFQLQDHRKSGKLSVSQWAFCMENILGLNLPWRSLS-----SNLVNIDQNGNVEYMSSFQNIRIEKPVQEAHSTLVETLYRYRSDLEIIFNAIDTDHSGLISVEEFRAMWKLFSSHYNVHIDDSQVNKLANIMDLNKDGSIDFNEFLK 633          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|G5EBX9|PPE_CAEEL (Serine/threonine-protein phosphatase with EF-hands pef-1 OS=Caenorhabditis elegans OX=6239 GN=pef-1 PE=1 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 3.099e-125
Identity = 222/622 (35.69%), Postives = 347/622 (55.79%), Query Frame = 2
Query:  143 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDA------------------LDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ------YESDNMNEC-EINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFA-IIDKSANVRITQY---KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLG---QNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            T+K+ +LIQK+YRR  A+ EA+R+  W+I   +EY+ EQ+Q+ +    +  +    E +     +  + + ++         + +D+                  +D ++ G  L  P+    V  ++E +K  N  L  + ++ +L  A+ + + +P+V  IS      +TICGD+HG FDDL  I  KN  PS  NPY+FNGDFVDRG +S+EV+ VL    + +P +++LNRGNHEDH MN RYGF KEL+ KYK++S  + +L  + FS LP+AT++   +FVVHGGIS  T+++ +  + R +F+SVL+       ES+  N    ++EWKQ+L+++WSDP+   GC  N +RGGG YFG D+T  FLEK+  +L++RSHECK  G+++ H +  LT+FSASNYYE GSN GA+   I KS      QY   K+      R+     EE +V+ L  ++      L K+F   DI+KSG + I +W   +  I  ++LPW  L   +   S     V Y      A++  T+ +   + E   R  S +E +F  +D   SG ++  EF +  +   LG   + PLQ + ++Q+ ++ D N DG+ID  E L+  R+
Sbjct:   82 TIKSAILIQKWYRRCEARLEARRRATWQIFTALEYAGEQDQLKLYDFFADVIRAMAEENGKGGVENGRNSPLMSALSHYAKPSLMDSEGETVKKMLEDTSPTNVDIDRNYKGPTLSLPLDKPQVAKMIEAFKV-NKVLHPKYVLMILHEARKIFKAMPSVSRISTSISNQVTICGDLHGKFDDLCIILYKNGYPSVDNPYIFNGDFVDRGGQSIEVLCVLFALVIVDPMSIYLNRGNHEDHIMNLRYGFIKELSTKYKDLSTPITRLLEDVFSWLPIATIIDRDIFVVHGGISDQTEVSKLDKIPRHRFQSVLRPPVNKGMESEKENSAVNVDEWKQMLDIMWSDPKQNKGCWPNVFRGGGSYFGADITASFLEKHGFRLLVRSHECKFEGYEFSHNNTCLTVFSASNYYETGSNRGAYVKFIGKSKQPHFVQYMASKTHRKSTLRERLGVVEESAVKELKEKLSSFHTDLQKEFEIMDIEKSGKLPILKWSDCVERITGLNLPWIALAPKVATLSEDGKYVMYKEDRRIAQVGGTHAQEKDIVESLYRHKSTLETLFRFMDKDNSGQVSMKEFIDACE--VLGKYTKRPLQTDYISQIAESIDFNKDGFIDLNELLEAFRL 700          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|O35655|PPE1_MOUSE (Serine/threonine-protein phosphatase with EF-hands 1 OS=Mus musculus OX=10090 GN=Ppef1 PE=2 SV=2)

HSP 1 Score: 374.015 bits (959), Expect = 7.729e-120
Identity = 230/622 (36.98%), Postives = 348/622 (55.95%), Query Frame = 2
Query:  143 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDAL---DASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVL-------QYESDNMNECEIN--------------------EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEG-----VDFRKNEEES--VRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKI-SSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEF--IQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLK 1879
             +KA L+IQ +YRRYRA+   ++     I Q +EYS+EQ Q+ +    S  L N  + + +     ++  D    + Q     D   L     S++G +L++P+T   +  L++ +K     L    ++E+L  A+ VL+ +PN   +       ITICGD+HG  DDL+ IF KN LPS +NPY+FNGDFVDRG+ S+E++ +LLVCFL  P+ + LNRGNHED  MN RYGF KE+  KYK     ++++  E ++ LP+ T++ N + V+HGGIS  TDL  +  L+R K KSVL       Q   +  N+   N                    EW+Q++++LWSDPR   GC  NT RGGGCYFGPDVT + L KN +K++IRSHECK +G++  H+ KV+T+FSASNYYE GSN GA+  +      +  QY+         +  R N  ES   + L  ++  ++  L+  F   D  +SG IS+ +W  +M  I+ ++LPWR L  +L+ T      V Y++  ++  I+   K + S+L E   R+ S+++ +F+++DS  SG ++  EF     + N     + + D ++ +L    D N DG ID  EFLK
Sbjct:   16 VIKAALVIQNWYRRYRARLRVRQHYALAIFQSIEYSDEQGQMQLSSFFSFMLENYTKTNNEDSALVTRIFDNTRRESQIKDRDDFLGLIEVPDSYDGPRLQFPLTFTDIHILLQAFKQ-QQILHAHYVLEVLFEARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIGTIIDNEILVIHGGISESTDLNTLHQLQRNKMKSVLMPPVLGNQETGEKRNKSASNYVEPRKVEPDKTPSEDLTKQEWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHECKPDGYEVSHDGKVITVFSASNYYEEGSNRGAYIRLSYGTMPQFFQYQVTSTSCLNPLHQRMNAMESSAFKILKEKMISRKTDLINAFELRDHSRSGRISLAEWAFSMENILGLNLPWRSLSSHLV-TIDSSGSVDYMSSFDDIRIEKPTKDMKSNLTETMYRYRSDLKIIFNIIDSDQSGLISMDEFRTMWKLFNAHYKAH-IDDSQIDELASIVDFNKDGNIDFNEFLK 634          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Match: sp|P40421|RDGC_DROME (Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster OX=7227 GN=rdgC PE=2 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 3.163e-112
Identity = 215/620 (34.68%), Postives = 340/620 (54.84%), Query Frame = 2
Query:  143 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPE-----RHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVE-FYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVS------ITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEG----VDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTS------------LVETDVPYLTMINNAEIQ---YTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNP--LQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
             ++A + IQK+YRR++A+ E +R+  W+I Q +EY++EQ+Q  + K  +  + + P+       +      S  +D    D     + DI  ++A     K++ PI    +  L++ F K   N+L  + +  +L  A   L+ LPN   ISPVS      +T+CGD+HG  DDL+ +  KN LPS+SNPY+FNGDFVDRG + +EV+ +LL  +L  PNAVFLNRGNHED  MN+RYGF +E+ +KY    + ++    E +  LPL +VL + + +VHGG S  T L +I+ + R K+ S+L+    +    +  EW+Q+ +++WSDP+   GC  NT RG G +FGPDVT  FL+++ +  +IRSHECK NG ++ H++K++T+FSASNYY +GSN GA+  ++        QY S       + F++     E  +++ L   +   R+ L  +FR++D   SG ISI  W   M  +  + LPWR L+  L P +            L++TDV      +   +    Y NK             +++  +F+++D+  SG +T  EF   I +  +   P      E+ +  +  DLN DG +D  EFL+  R+
Sbjct:    5 AIRAAIFIQKWYRRHQARREMQRRCNWQIFQNLEYASEQDQAELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDD---KDDLVEEFGDI--VNA-----KIELPIRKNHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPN---ISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQRMGIVESSALKELAVRMRDHRDELEDEFRKYDPKDSGYISISHWCKVMENVTKLGLPWRLLRDKLAPGTDSQKVNYNRTLDLLDTDVILEAEADGMSVMDALYANK-------------ASLVAIFNIIDADNSGEITLDEFETAI-DLLVAHMPGAYSKAEMLEKCRMMDLNGDGKVDLNEFLEAFRL 597          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A267DFW7 (Serine/threonine-protein phosphatase with EF-hands OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022204g1 PE=3 SV=1)

HSP 1 Score: 442.58 bits (1137), Expect = 5.746e-143
Identity = 241/626 (38.50%), Postives = 361/626 (57.67%), Query Frame = 2
Query:  143 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDA-------------------------LDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYE-SDNMN-ECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQE------GVDFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQY-----TNKKIS-SLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQN-PLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            ++K+ LLIQK+YRRY+A+ EA+R+  W I+Q +EYS+E +Q+ +    S  +     +  D K         L P     P  +  A                         ++ S+ G  L +P+++  V+ L++ ++ G  +L +R L++LL  A+++L+  PNVY+ S      +T+ GD+HG  DDL+ IF KN LP  +NPY+FNGDFVDRG+ SVE  ++L  C L  P+AVF+NRGNHEDH MN RYGF KE+  KYK  +  +++LF +TFS LPLAT + + + V HGGIS   D+  ++ L R ++ S L+   SDN N + +  EW+QVL+LLWSDP+P  GC  NT+RGGGCYFGP++T  FL K+   L++RSHECK +GW++CH   VLTLFSASNYYE GSN GA+A  D      I QY + +      G      EE +++ L +++   +  L   F+ FD DK+G I +  W  AM   + + LPWR L+ +L   +  +  + Y+T  +   IQ        K+++ SL E   +    +E +F ++D   SG ++  EF E  +  T      + + E+  + ++ DLN+DG+ID  EFL+  RI
Sbjct:   89 SIKSALLIQKWYRRYKARLEARRRTTWMIYQSIEYSSEASQLHLYNFFSDMM-----QLADGKQPQQPQQQHLSPAGSGDPANNRFAERLRQKSLEEEDQELLELTSYEGIQVEKSYRGPHLSFPLSASHVQVLIDSFRQGT-QLHSRYLLQLLHEARLLLKTKPNVYQASTSISRQVTVVGDLHGKLDDLLVIFYKNGLPDVTNPYVFNGDFVDRGANSVETAALLFACLLVWPSAVFINRGNHEDHLMNCRYGFIKEVQAKYKTPANKIVRLFGDTFSWLPLATNIDDKILVTHGGISDKVDMERVQKLDRHQYLSALKPPVSDNENAKVDYKEWRQVLDLLWSDPKPQAGCAPNTFRGGGCYFGPNITEAFLRKHKFSLLVRSHECKPDGWEFCHGGAVLTLFSASNYYEDGSNKGAYAKFDAEGKPHIVQYMASKARKLPVGRRLSTVEEGALKDLRAKVIASKTELTAAFQRFDPDKTGSIRLADWCEAMEQTLRLGLPWRTLRPHLAQLA-KDGRLLYMTSFDCVSIQTKLGASAGKEVAGSLTEAVYKNKEELETIFRIMDKDNSGQISLDEFQESCRVLTQATGRQMTEAEVGDMARSMDLNSDGYIDFNEFLEAFRI 707          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A1I8F2Q4 (Serine/threonine-protein phosphatase with EF-hands OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 439.884 bits (1130), Expect = 1.767e-142
Identity = 241/614 (39.25%), Postives = 366/614 (59.61%), Query Frame = 2
Query:  143 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQI-LMQ----------KLLSITLHNNPERH-FDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVC-FLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYE-SDNMN-ECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQE------GVDFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQY-----TNKKIS-SLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQN-PLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            ++K+ LLIQK+YRRY+A+ EA+R+  W I+Q +EYS+E +Q+ L+Q          + LS     +P  + F  + +     +      +   +  I  ++ S+ G  L +P+++  V+ L++ ++ G  +L +R L++LL  A+++L+  PNVY+ S      +T+ GD+HG  DDL+ IF KN LP  +NPY+FNGDFVDRG+ SVE  ++L  C  L  P+AVF+NRGNHEDH MN RYGF KE+  KYK  +  +++LF +TFS LPLAT + + + V HGGIS   D+  ++ L R ++ S L+   SDN N + +  EW+QVL+LLWSDP+P  GC  NT+RGGGCYFGP++T  FL K+   L++RSHECK +GW++CH   VLTLFSASNYYE GSN GA+A  D      I QY + +      G      EE +++ L +++   +  L   F+ FD DK+G I +  W  AM   + + LPWR L+ +L   +  +  + Y+T  +   IQ        K+++ SL E   +    +E +F ++D   SG ++  EF E  +  T      + + E+  + ++ DLN+DG+ID  EFL+  RI
Sbjct:   56 SIKSALLIQKWYRRYKARLEARRRTTWMIYQSIEYSSEASQLHLLQTESSPQQPQQQHLSPAGSGDPANNRFAERLRQKSLEEEDQELLELTSYEGIQ-VEKSYRGPHLSFPLSASHVQVLIDSFRQGT-QLHSRYLLQLLHEARLLLKTKPNVYQASTSISRQVTVVGDLHGKLDDLLVIFYKNGLPDVTNPYVFNGDFVDRGANSVETAALLFACCLLVWPSAVFINRGNHEDHLMNCRYGFIKEVQAKYKTPANKIVRLFGDTFSWLPLATNIDDKILVTHGGISDKVDMERVQKLDRHQYLSALKPPVSDNENAKVDYKEWRQVLDLLWSDPKPQAGCAPNTFRGGGCYFGPNITEAFLRKHKFSLLVRSHECKPDGWEFCHGGAVLTLFSASNYYEDGSNKGAYAKFDAEGKPHIVQYMASKARKLPVGRRLSTVEEGALKDLRAKVIASKTELTAAFQRFDPDKTGSIRLADWCEAMEQTLRLGLPWRTLRPHLAQLA-KDGRLLYMTSFDCVSIQTKLGASAGKEVAGSLTEAVYKNKEELETIFRIMDKDNSGQISLDEFQESCRVLTQATGRQMTEAEVGDMARSMDLNSDGYIDFNEFLEAFRI 666          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A369SL60 (Serine/threonine-protein phosphatase with EF-hands OS=Trichoplax sp. H2 OX=287889 GN=TrispH2_001103 PE=3 SV=1)

HSP 1 Score: 433.721 bits (1114), Expect = 2.939e-140
Identity = 245/625 (39.20%), Postives = 374/625 (59.84%), Query Frame = 2
Query:  119 CKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILM---------QKLLSITLHNNPERHFDVKCKFSKF-NDILPPDKQAIPWADIDA--LDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVS---ITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQY----ESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQ-----EGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNK-KISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTL-----GQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            CK ++I  T+K+ +LIQ ++RRY+A+ EA+++  W I Q +E++ EQ+Q+ +         Q  +S     N  R   +    +   N  L  + Q +   D D+  ++ ++ G  +  PIT   V+ L+E + S +  L  + L+E+L  A+  L+ +PNV + S VS   ITICGD+HG  DDL+ IF KN LPS  NPY+FNGDFVDRG KSVE+  +LL  FL  PN  ++NRGNHEDH MN RYGF KE+ +KYK  +  ++K+F + FS LPLAT++ N +FV HGGIS  TD+  + ++ R K+ SVL+     E D   + ++ EW+QVL++LWSDP+  NGCK N YRGGG YFGPDVT  FL K+   LIIRSHECK+ GW+Y H DKVLT+FSASNYY  GSN GA+  ++    +   Q+ S      + +  R+     EE ++R + S+    R +L  +F+  D +++G I+I QW+  +  ++ ++LPWR++K  ++  +  +  V Y +  +   +Q   K K  ++ E   +  +++E +F ++D   SG ++  EF    Q++ L      ++ +  E++  L K+ D NNDG ID  EFL+  R+
Sbjct:   36 CKDTSI--TVKSAILIQNWFRRYKARLEARKRCTWSIFQQIEFAGEQDQLKLYNFFNGMIDQVKISNANITNGRRSSSIANVLAPISNSYLEEEAQLVQATDPDSVIINKAYQGPHINMPITLDQVKELIEAF-SQDKILHAKYLLEILHEARRTLKLMPNVSQASTVSAKRITICGDLHGKIDDLLLIFYKNGLPSYDNPYIFNGDFVDRGEKSVEIAILLLCFFLLYPNETYINRGNHEDHIMNIRYGFLKEVISKYKRNASKVVKMFEDVFSWLPLATIIDNKIFVTHGGISDQTDVHYLNVIDRHKYISVLRPSLLDEEDGEEKIDLTEWRQVLDVLWSDPKNANGCKPNEYRGGGSYFGPDVTRNFLSKHNFNLIIRSHECKIEGWEYMHYDKVLTVFSASNYYSPGSNKGAYLKLNDKHEIECLQFMSDTNYGNKNLSMREKMGIIEESALREIQSKFHSHRMALEAEFKAIDTEETGCITIDQWIRCLVNVLELELPWRRIKHQIVNIT-ADGMVQYHSCFDKFSLQSALKSKGPTVTETLYKHKNSLETIFRIIDKDNSGLISMEEF----QDSCLLLDDHVKSFMSKEDIHNLAKSIDFNNDGHIDFNEFLEAFRL 652          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A0A2T7PP07 (Serine/threonine-protein phosphatase with EF-hands OS=Pomacea canaliculata OX=400727 GN=C0Q70_06422 PE=3 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 2.269e-139
Identity = 247/625 (39.52%), Postives = 369/625 (59.04%), Query Frame = 2
Query:  146 LKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLL-SITLHNNPERHFDVKC--KFSK------------FNDILPPDKQAIPWADIDALD--ASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ---------YESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFA-IIDKSANVRITQY----KSQEGVDFR----KNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEI-QYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAE----FIQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            +KA LLIQ++YRRY A+ E +R+  W I Q +EY+ EQ+QI +     S+  H + +    V+    FS+             +++   DK+ +   D D++   +S+ G  + +PIT   V  L++ +K+    L  + L++LL   + VLR   N+   +      +T+CGD+HG  DDL  IF KN LPS  NPY+FNGDFVDRG+ S+EV  +L  CFL +PN V+LNRGNHEDH MN RYGF KE+  KYKE +  +I +F + FS LPLATV+ + + VVHGGIS DTDL  ++ + R KF SVL+          +   +   EI EWKQ+L++LWSDP+ + G   N++RGGGCYFGPDVT   L+ + + L+IRSHECK +G++Y H+++VLT+FSASNYYE GSN GA+  I+D   N  I QY     S+  + F     K E  ++  L       +  L K+F++FD +  G+IS   W +AM  ++ MD+PWR ++  L+ T+  E  V Y +  ++    ++ ++ I S+ E   R    +E +F + D   SG ++  EF E     +++ T+   PL + +++ + ++ DLNNDG ID  EFL+  RI
Sbjct:    1 MKAALLIQRWYRRYMARLEIRRRTTWNIFQSIEYAGEQDQIKLYNFFNSMMTHFSVDNANQVRIIKAFSEEQRRSLSAGTIMSDEMEAEDKELMNSIDPDSISVSSSYKGPHVTFPITQNSVFALLQAFKT-KQVLHVKYLLQLLHECRRVLRQRGNINRATTAIAHQLTVCGDLHGKLDDLYMIFHKNGLPSVDNPYVFNGDFVDRGNHSIEVAIILFACFLCSPNEVYLNRGNHEDHMMNLRYGFIKEIMRKYKEHATKVIMMFEDVFSWLPLATVIDDKILVVHGGISDDTDLEFLQTVDRHKFVSVLRPPGSMKMTTVDIQQLEMNEIQEWKQMLDILWSDPKNIKGAAPNSFRGGGCYFGPDVTKDVLDAHNLTLLIRSHECKPDGFEYTHDNRVLTIFSASNYYEEGSNKGAYVKILDNDLNPHIVQYVAGSTSRRKITFTQRIGKLESSALHSLRERFLACKPLLTKEFQKFDQENKGLISPVDWCSAMEAVIGMDVPWRLMRSRLVQTA-PEGLVIYQSTFHDLTFDRHQDETIMSVTETLYRHKDILETIFRIFDKDNSGFISMAEFEEACSILMRHATI---PLLESQISDVARSLDLNNDGHIDFNEFLEAFRI 620          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Match: A7RNB7 (Serine/threonine-protein phosphatase with EF-hands OS=Nematostella vectensis OX=45351 GN=v1g239552 PE=3 SV=1)

HSP 1 Score: 430.254 bits (1105), Expect = 6.293e-139
Identity = 249/652 (38.19%), Postives = 376/652 (57.67%), Query Frame = 2
Query:   59 MGCKLSSNLFK--NNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQI-LMQKLLSITLHNNPERHFDVKCKFSKFNDILPPD--------------KQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLR-AQVVLRDLPNVYEIS---PVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYES---DNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQY---KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKW---YLIPTSLVETDVPYLTMINNAEIQ-YTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQ------NTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            MGC  S + +K  +   + +   KS      L++ +LIQ ++RRYRA+ EA+R+  WKI Q +EYS EQ+Q+ L      +  H  P+     +       D L  +              + A   +DI  ++ ++ G  +K PIT   VRN++E  K   NKL +   + L+LR A+   R LPNV  ++      +TICGD+HG  DDL  IF KN LPS  NPY+FNGD VDRG +S+E+  +L    +  PN V++NRGNHEDH MN RYGF KE+ +KYK+ +  +I+LF + F  LPLAT++ N +FV HGGIS  TDL +I  + R K+ SVL+  +   DN +   + EW+QVL+LLWSDP+P  GCK NT+RGGGCYFGPDVT Q L K+  +L++RSHECK  G++Y H  KV+T+FSASNYYE GSN GA+  I         QY   ++++ +  ++     EE ++R L  +++  +++L++ F + D   +G ++  QW  A+ + +++D+PW  L+    Y+ P   V+    Y + +    I+  T K   S+ E   R  SN+E +F ++D   SGH++  EF    +       T + ++ +QD     L ++ D++ DG+ID  EFL+  R+
Sbjct:    1 MGCGTSVDAYKEYDGHKNSLSLSKSEK---ALRSAVLIQNWFRRYRARLEARRRCTWKIFQSIEYSGEQDQLKLFNFFTDMLTHVQPDNTGASRANI--IEDTLSRNGSASSTSSKSSTTLEAATDPSDI-KVEPTYTGHVVKLPITLMSVRNIIEQCKL--NKLVHAKYVLLILREARERFRALPNVIRVTTRIAKQMTICGDLHGKLDDLFMIFHKNGLPSPENPYIFNGDLVDRGPRSIEICIILFAFTILYPNGVYINRGNHEDHIMNLRYGFVKEVMDKYKDHASKIIRLFEDIFGWLPLATIVNNKIFVAHGGISNITDLDIIERIDRHKYVSVLKPPNIVKDNPSLSSLKEWRQVLDLLWSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRSHECKYEGYEYMHNKKVITIFSASNYYEQGSNRGAYMKIGPDMTPYFVQYQVSRTKKHLTLKQRVGIVEESAIRELKEKLYANKSALMEAFTKRDEQHTGYLTCSQWAAAIESTLHLDVPWNMLRHQLAYVAPDGKVD----YRSCLEQYAIEGKTKKNGPSITEALYRNRSNLETIFRLMDKDNSGHVSMEEFQASCRLLNQHSETEIPEDSIQD-----LARSIDMDKDGYIDFNEFLEAFRL 635          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppef1 (serine/threonine-protein phosphatase with EF-hands 1 [Source:NCBI gene;Acc:103021363])

HSP 1 Score: 229.95 bits (585), Expect = 1.531e-65
Identity = 126/328 (38.41%), Postives = 190/328 (57.93%), Query Frame = 2
Query:   59 MGCKLSSNLFKNNTNDDM-IACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFND-ILPPDKQAIPWADID--ALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ 1021
            MGC  S  +       ++ ++ +  +   T+KA +LIQ++YRRY A+ E +R+  W I Q +EY+ EQ+Q+ +    S  L N  + + +     S   D  + P    +  +  +   +  S++G +L +P++      L+  +K     L  + +++LL   Q  L+ +PNV  +S      ITICGD+HG  DDL+ IF KN LPS  NPY+FNGDFVDRG KS+E+I +L    L  P+ + LNRGNHEDH MN RYGF KE+  KYK     +++L  + FSLLP+AT++ N + +VHGGIS  TDL  +  + R+K KS L+
Sbjct:    1 MGCGTSVAIENQGRPSEVDVSARLPSPALTMKAAILIQRWYRRYVARLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFSFMLDNFTQLNGNGPDLISHLLDSAVDPVVDEVRQSKYEQIVVPESYSGPRLSFPLSVTDTNVLLSAFKE-QQTLHAKYVLQLLHETQKFLKQMPNVIYLSSSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSIEIIIILFAFLLLYPDHMHLNRGNHEDHIMNLRYGFTKEVMQKYKTHGREILQLLQDVFSLLPIATIIDNKVLIVHGGISDKTDLEFLASVERQKVKSALR 327          

HSP 2 Score: 203.371 bits (516), Expect = 5.917e-56
Identity = 102/288 (35.42%), Postives = 175/288 (60.76%), Query Frame = 2
Query: 1058 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQY---KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKIS-SLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEF--IQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            EW+Q++++LWSDP+  NGC  N++RGGGCYFGPDVT   L+K+ + L+IRSHECK  G++ CH  +V+T+FSASNYYE GSN GA+  +      R  QY   +S   +  ++     E  +++ L  +++  R+ L+  F+++DI+ +G ISI +W   + T++ +DLPWR L+  L+  +  + +V Y +   N        +++ +  E   R+ +++E +F+++D  +SG ++  EF +   + +  LG + + D+ +  + +N D N DG ID  EFL+  R+
Sbjct:  431 EWRQIVDVLWSDPKIQNGCSPNSFRGGGCYFGPDVTQNLLKKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYIKLGPELIPRFFQYQVSRSTRKLTLQQRVSVAESSALKALQEKLFTHRSELMAFFQQYDINNTGRISINEWAQVLDTVLRLDLPWRTLRPRLVRLA-SDGNVEYESCFENISAGQPLPQVTPNFAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSAHLGVD-VDDQAIVDMARNIDFNKDGSIDFNEFLEAFRV 716          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppef1 (serine/threonine-protein phosphatase with EF-hands 1 [Source:NCBI gene;Acc:103021363])

HSP 1 Score: 224.942 bits (572), Expect = 7.000e-64
Identity = 121/300 (40.33%), Postives = 178/300 (59.33%), Query Frame = 2
Query:  140 ATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFND-ILPPDKQAIPWADID--ALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ 1021
              +KA +LIQ++YRRY A+ E +R+  W I Q +EY+ EQ+Q+ +    S  L N  + + +     S   D  + P    +  +  +   +  S++G +L +P++      L+  +K     L  + +++LL   Q  L+ +PNV  +S      ITICGD+HG  DDL+ IF KN LPS  NPY+FNGDFVDRG KS+E+I +L    L  P+ + LNRGNHEDH MN RYGF KE+  KYK     +++L  + FSLLP+AT++ N + +VHGGIS  TDL  +  + R+K KS L+
Sbjct:   18 VAMKAAILIQRWYRRYVARLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFSFMLDNFTQLNGNGPDLISHLLDSAVDPVVDEVRQSKYEQIVVPESYSGPRLSFPLSVTDTNVLLSAFKE-QQTLHAKYVLQLLHETQKFLKQMPNVIYLSSSYAKEITICGDLHGRLDDLLLIFYKNGLPSAENPYIFNGDFVDRGKKSIEIIIILFAFLLLYPDHMHLNRGNHEDHIMNLRYGFTKEVMQKYKTHGREILQLLQDVFSLLPIATIIDNKVLIVHGGISDKTDLEFLASVERQKVKSALR 316          

HSP 2 Score: 202.986 bits (515), Expect = 6.780e-56
Identity = 102/288 (35.42%), Postives = 175/288 (60.76%), Query Frame = 2
Query: 1058 EWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQY---KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKIS-SLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEF--IQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            EW+Q++++LWSDP+  NGC  N++RGGGCYFGPDVT   L+K+ + L+IRSHECK  G++ CH  +V+T+FSASNYYE GSN GA+  +      R  QY   +S   +  ++     E  +++ L  +++  R+ L+  F+++DI+ +G ISI +W   + T++ +DLPWR L+  L+  +  + +V Y +   N        +++ +  E   R+ +++E +F+++D  +SG ++  EF +   + +  LG + + D+ +  + +N D N DG ID  EFL+  R+
Sbjct:  420 EWRQIVDVLWSDPKIQNGCSPNSFRGGGCYFGPDVTQNLLKKHGLCLLIRSHECKQEGYELCHNGQVITIFSASNYYEEGSNRGAYIKLGPELIPRFFQYQVSRSTRKLTLQQRVSVAESSALKALQEKLFTHRSELMAFFQQYDINNTGRISINEWAQVLDTVLRLDLPWRTLRPRLVRLA-SDGNVEYESCFENISAGQPLPQVTPNFAETLYRYRTDLEIIFNIIDKDHSGQISIEEFRQTWKLFSAHLGVD-VDDQAIVDMARNIDFNKDGSIDFNEFLEAFRV 705          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ENSAMXT00000016118.2 (pep primary_assembly:Astyanax_mexicanus-2.0:14:38271079:38284894:-1 gene:ENSAMXG00000015666.2 transcript:ENSAMXT00000016118.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.779 bits (556), Expect = 1.281e-61
Identity = 123/301 (40.86%), Postives = 180/301 (59.80%), Query Frame = 2
Query:  146 LKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITL-HNNP---ERHFDVKCKFSKFNDILPPDKQAIPWADIDALDAS--HNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ 1021
            ++A LLIQ++YR+Y A+ E +R+  W I Q +EYS EQ+QI +       + H  P   ER  ++     + +++   D +  P+    ++D    + G  L +P+T  I+  LVE +K     L  R +++LL     +LR LPN+ E+S      ITICGD+HG  +DL+ +F KN LPS   PY+FNGDFVDRG  S+E++ +L    L  PN V LNRGNHEDH +N RYGF KE+  KY+   + ++KL  + FS LPLATV+   + ++HGGIS  TDL +I  L R ++ S L+
Sbjct:    1 MRAALLIQRWYRQYVARLEMRRRCTWNIFQSIEYSGEQDQIKLYNFFGFLMDHFTPASSER--NLISHIFRESEVFQ-DAEWEPYFCYKSIDVPDMYTGPHLTFPLTVNIITELVEAFKH-KQHLHARYVLQLLGETWRLLRILPNINEVSTFHSKEITICGDLHGQLEDLLLVFYKNGLPSVETPYVFNGDFVDRGKDSIEILLILFAFQLVYPNDVHLNRGNHEDHIVNLRYGFTKEVLGKYRVHGKKILKLLQKIFSWLPLATVIDQKVLILHGGISDTTDLKLIAKLERNRYVSALR 297          

HSP 2 Score: 206.838 bits (525), Expect = 2.358e-57
Identity = 101/299 (33.78%), Postives = 175/299 (58.53%), Query Frame = 2
Query: 1025 ESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGV-------DFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDS--RFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQ-NTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            +S  + E +  EWKQ++++LWSDP   +GC  N  RGGGCY+GPD+T   L ++ ++L+IRSHECK +G+++CH  +VLT+FSASNYYE+GSN GA+  +    N  + QY++              + E  ++R L  +++  ++ L   + EFD + +GVIS+  W  A  T++ + LPWR L+  L+  S  +  + Y        +   N +++  G +++  R  SN+E +F ++D+ +SG ++F EF +  +  ++  +  + D+ ++ L  + D N DG ID  EF++  R+
Sbjct:  392 DSGEVLETDAEEWKQIVDMLWSDPMSQDGCIPNEVRGGGCYWGPDITEDVLNRHNLRLLIRSHECKQDGYEFCHNRRVLTIFSASNYYEVGSNRGAYIRLGPDLNPHVVQYQASRSTRELTLRQSVGRTERSALRALREQVFAHKSDLTSAYEEFDPEHTGVISMKHWAVATETVLQLGLPWRVLREQLVGDSTQDGIINYNDWFRELALMDPNTELAHTGLLETMYRHHSNLETIFRIIDTDHSGLISFEEFRQTWKLLSSHLKMEISDKAISDLALSIDFNKDGSIDINEFMEAFRL 690          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:103034548])

HSP 1 Score: 207.223 bits (526), Expect = 3.139e-59
Identity = 117/294 (39.80%), Postives = 174/294 (59.18%), Query Frame = 2
Query:  443 ITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEIS---PVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAF 1315
            +T K ++ +++++K    KL  +   ++L++ + VL  LP++ EI+      ITICGD HG + DL+ IF+ N LPS +NPYLFNGDFVDRGS S+EVI  L    L  P+   L RGNHE   MN  YGF  E+  KY   +  + +LF+E F  LPLA  + + + V+HGG+  +  + +  + + ++ +       D+   C         +LLWSDP+P NG  ++  RG  C FGPDVT +FLE+N ++ I+RSHE K  G++  H  K +T+FSA NY +   N GA+
Sbjct:  179 VTLKFMKEMMDWFKD-QKKLHRKCAYQMLVQVKEVLSKLPSLVEITLKETEKITICGDTHGQYYDLLNIFELNGLPSPTNPYLFNGDFVDRGSFSMEVILTLFGFKLLYPDHFHLLRGNHETDNMNQMYGFEGEVKAKY---TAQMFQLFSEVFQWLPLAQCINSKVLVMHGGLFSEDGVTLDDLRKIDRNRQ----PPDSGPMC---------DLLWSDPQPQNGRSISK-RGVSCQFGPDVTQRFLEQNKLQYIVRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAY 454          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Match: PPEF2 (protein phosphatase with EF-hand domain 2 [Source:HGNC Symbol;Acc:HGNC:9244])

HSP 1 Score: 209.149 bits (531), Expect = 7.285e-58
Identity = 127/338 (37.57%), Postives = 195/338 (57.69%), Query Frame = 2
Query:   59 MGCKLS-SNLFKNNTNDD--MIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHN----NPERHF-------DVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ 1021
            MGC ++    F    + D  +I+ + S +   ++A +LIQ++YR+Y A+ E +R+  W I Q +EY+ +Q+QI +   L   + N    + ER+        +  C+  ++      D + I   DI      ++G +L +P+ +    +LVE ++S   +L +R +++LL     +LR LPN+  IS      ITICGD+HG  +DL+ IF KN +PS    Y+FNGDFVDRG  S+E++ +L    L  P  V LNRGNHEDH +N RYGF KE+  KYK   + ++KL  + FS LPLATV+   + +VHGGIS  TDLA++  + R K+ S L+
Sbjct:    1 MGCGVTKGGEFHKRYDKDGNIISVRISAVTKAIRAAVLIQRWYRQYVARMELRRRYTWNIFQSIEYAGQQDQIKLYNFLGYLVDNFTPSSNERNLISHIFRENEVCRDIEWERFF--DYRHIEVPDI------YSGPRLTFPLNADQAADLVEAFRS-KQQLHSRYVLQLLGETWKLLRVLPNINRISTCHSKEITICGDLHGQLEDLLLIFYKNGMPSMEKAYVFNGDFVDRGKDSIEILLILFAFLLVYPGEVHLNRGNHEDHIINLRYGFTKEVLGKYKMHGKRILKLLQKIFSWLPLATVIDQKVLIVHGGISDTTDLALVARVDRHKYVSSLR 329          

HSP 2 Score: 201.83 bits (512), Expect = 2.919e-55
Identity = 108/290 (37.24%), Postives = 175/290 (60.34%), Query Frame = 2
Query: 1055 NEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGV-------DFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRFD--SNVEEMFHVLDSKYSGHLTFPEFAEF--IQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            NEWKQ+L+LLWSDP   +GC  N  RGGGCY+GP+VT +FL K+ M+LIIRSHECK +G+++CH  KVLT+FSASNYYE+GSN GAF  +         QY++             R+ E  +++ L  +++  ++ L+  F++ D + +G+IS+  W +AMS ++++DLPWR L+  LI T+  +  + Y     N  I+  + +      +D+ +   S +E +F ++D+  SG ++F +F +   + N  L +  + +E +  L  + D N DG ID +EF++  R+
Sbjct:  440 NEWKQILDLLWSDPMIPDGCVPNEVRGGGCYWGPNVTEEFLNKHSMQLIIRSHECKQDGYEFCHNRKVLTIFSASNYYEVGSNRGAFVRLGPDLVPYFIQYQANSMTREMSVRQSLRRTEHSALKVLREQLFAHKSDLMSAFQQHDKENTGLISLSDWGSAMSQVLHLDLPWRMLRSQLI-TTTTDDMLDYHNWFRNLAIKEKSYEHIEQTLLDTLYKHRSTLETIFRIVDTDNSGFISFEDFRQTWKLLNAYL-KMEISEESINDLVVSIDTNKDGNIDIDEFMESFRL 727          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 196.823 bits (499), Expect = 2.129e-56
Identity = 114/296 (38.51%), Postives = 174/296 (58.78%), Query Frame = 2
Query:  443 ITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVS-----ITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAF 1315
            +T   ++ L+E++K    KL  +   ++LL+ +  L+ LP++ E++        IT+CGDIHG + DL+ IF+ N LPS +NPY+FNGDFVDRGS SVEVI VL    L  P+   L RGNHE   MN  YGF  E+  KY   +  +   F+E F  LPLA  + + + ++HGG+  +  + +  I + ++ +       D+   C         +LLWSDP+P  G  ++  RG  C FGPDV+  F+E+N ++LIIRSHE K +G++  H+ + +T+FSA NY +   N G++
Sbjct:  146 VTITFMKELIEWFKD-QKKLHRKYAYQILLQVKQSLQKLPSLVEVTIKDEQGDMITVCGDIHGQYFDLLHIFELNGLPSETNPYVFNGDFVDRGSWSVEVILVLFGFKLLYPDHFHLMRGNHETDNMNQMYGFEGEVKAKY---TAQMFDFFSEVFQWLPLAMCINSRVLIMHGGLFSEDGVTLDDIRKIDRNRQ----PPDSGPMC---------DLLWSDPQPQPGRSVSK-RGVSCQFGPDVSRAFMEQNNLELIIRSHE-KPDGYEVAHDGRCVTVFSAPNYCDQMGNKGSY 422          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 149.828 bits (377), Expect = 8.442e-41
Identity = 95/281 (33.81%), Postives = 151/281 (53.74%), Query Frame = 2
Query:  491 NNKLSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKS 1333
            N +L+  ++  L L+++ +    P + E+    + ICGDIHG + DL+ +F+    P  SN YLF GD+VDRG +S+E I +LL   ++ P   FL RGNHE   +N  YGF+ E   +Y   +  L K FT+ F+ LP+A ++   +F  HGG+S   DL  +  +RR             M   ++ +   + +LLWSDP           RG    FG +V  +FL K+ + LI R+H+   +G+++  + +++TLFSA NY     N GA   +D++
Sbjct:    9 NVQLTEGEIRGLCLKSREIFLSQPILLELE-APLKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHEAS-INRIYGFYDECKRRY---NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLS--PDLQSMEQIRR------------IMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDET 269          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 1.354e-36
Identity = 89/257 (34.63%), Postives = 136/257 (52.92%), Query Frame = 2
Query:  602 GDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDP-RPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQE 1369
            GDIHG + DL+ +F+    P  +N YLF GD+VDRG +S+E I +LL   ++ P   FL RGNHE   +N  YGF+ E   ++   +  L K FT+ F+ LP+A ++   +F  HGG+S   DL  +  +RR    + +    D    C+         LLWSDP + + G   N  RG    FG DV  +FL ++ + LI R+H+   +G+++  + +++TLFSA NY     N G    +D++        K  E
Sbjct:    1 GDIHGQYTDLLRLFEYGGFPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRF---NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLS--PDLQSMEQIRRIMRPTDVPDTGDAGLLCD---------LLWSDPDKDVQGWGEND-RGVSFTFGGDVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSE 241          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 116.701 bits (291), Expect = 4.866e-30
Identity = 76/226 (33.63%), Postives = 120/226 (53.10%), Query Frame = 2
Query:  500 LSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDP-RPLNGCKMNTYRGGGCYFGPDVTLQF 1174
            ++  ++  L ++++ +    P + E+    + ICGDIHG + DL+ +F+    P  SN YLF GD+VDRG +S+E I +LL   ++ P   FL RGNHE   +N  YGF+ E   ++   +  L K FT+ F+ LP+A ++   +F  HGG+S   DL  +  +RR             M   ++ +   + +LLWSDP + + G   N  RG    FG DV  +F
Sbjct:   16 MTEAEVRGLCIKSREIFLSQPILLELE-APLKICGDIHGQYTDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRF---NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLS--PDLQSMEQIRR------------IMRPTDVPDTGLLCDLLWSDPDKDVQGWGEND-RGVSFTFGADVVSKF 221          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 116.701 bits (291), Expect = 5.509e-28
Identity = 82/258 (31.78%), Postives = 124/258 (48.06%), Query Frame = 2
Query:  584 VSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDT-DLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNG--------CKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK------VLTLFSASNYYELGSNYGA 1312
              +T+CGDIHG F DL+ +F+    P+ +  YLF GD+VDRG  S+E +  L    +  P  +FL RGNHE   +   + F +E   KY   +E +     + F  LPLA ++      VHGG+S +  +L  IR L R K               E   +  + +LLWSDP    G        C  NT RG   ++       FL+ N +  +IR+HE +  G+    + +      ++T+FSA NY ++ +N  A
Sbjct:   66 APVTVCGDIHGQFFDLMKLFEVGGSPANTR-YLFLGDYVDRGYFSIECVLYLWALKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKY---TETVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEVHNLEDIRKLDRFK---------------EPPAFGPMCDLLWSDPSEDFGNEKTQEYFCH-NTVRGCSYFYSYPAVCDFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAA 303          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPT1 (Protein serine/threonine phosphatase; regulates Hsp90 chaperone by affecting its ATPase and cochaperone binding activities; has similarity to human phosphatase PP5; present in both the nucleus and cytoplasm; expressed during logarithmic growth [Source:SGD;Acc:S000003355])

HSP 1 Score: 171.014 bits (432), Expect = 8.902e-47
Identity = 100/276 (36.23%), Postives = 149/276 (53.99%), Query Frame = 2
Query:  500 LSNRDLIELLLRAQVVLRDLPNVYEI----SP-VSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGA 1312
            L  + +  ++  A  + R  P++ E+    +P V I++CGD HG F D++ +F+K       + YLFNGDFVDRGS S EV  +     + +PN  FLNRGNHE   MN  YGF  E   KY   S+ +  +F ++F  LPLAT++ N   V+HGG+  D    +        FK++ ++     +          + LLW+DP+  NG    + RG G  FGPD+T +FL  N ++ I RSHE +M G  +  + K++T+FSA NY +   N G 
Sbjct:  209 LPKKYVAAIISHADTLFRQEPSMVELENNSTPDVKISVCGDTHGQFYDVLNLFRKFGKVGPKHTYLFNGDFVDRGSWSCEVALLFYCLKILHPNNFFLNRGNHESDNMNKIYGFEDECKYKY---SQRIFNMFAQSFESLPLATLINNDYLVMHGGLPSDPSATL------SDFKNIDRFAQPPRDGA-------FMELLWADPQEANGMGP-SQRGLGHAFGPDITDRFLRNNKLRKIFRSHELRMGGVQFEQKGKLMTVFSAPNYCDSQGNLGG 467          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH21 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph22p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; forms nuclear foci upon DNA replication stress; PPH21 has a paralog, PPH22, that arose from the whole genome duplication [Source:SGD;Acc:S000002292])

HSP 1 Score: 162.54 bits (410), Expect = 5.182e-45
Identity = 103/286 (36.01%), Postives = 152/286 (53.15%), Query Frame = 2
Query:  500 LSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQY 1357
            LS  D+  L   A  VL+   NV  I+ V +TICGD+HG F DL+ +F K   P     YLF GD+VDRG  SVE +S L+   ++ P+ + + RGNHE   +   YGF+ E   KY   S  + K+FT+ F   P+  ++ N +F +HGG+S      MI  + + +  + +Q         E+     + +LLWSDP    G  ++  RG G  FG DV+ QF   N + LI R+H+  M G+ + H+  V+T+FSA NY     N  A   +D++ N +  QY
Sbjct:   83 LSEDDVARLCKMAVDVLQFEENVKPIN-VPVTICGDVHGQFHDLLELF-KIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYG--SANVWKMFTDLFDYFPITALVDNKIFCLHGGLS-----PMIETIDQVRELNRIQ---------EVPHEGPMCDLLWSDPDDRGGWGISP-RGAGFTFGQDVSEQFNHTNDLSLIARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQY 349          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH22 (Catalytic subunit of protein phosphatase 2A (PP2A); functionally redundant with Pph21p; methylated at C terminus; forms alternate complexes with several regulatory subunits; involved in signal transduction and regulation of mitosis; protein abundance increases in response to DNA replication stress; dephosphorylates Tel1p/Mec1p-phosphorylated Cdc13p to promote telomerase release from telomeres at G2/M; PPH22 has a paralog, PPH21, that arose from the whole genome duplication [Source:SGD;Acc:S000002347])

HSP 1 Score: 162.155 bits (409), Expect = 8.646e-45
Identity = 102/286 (35.66%), Postives = 152/286 (53.15%), Query Frame = 2
Query:  500 LSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQY 1357
            LS  D+  L   A  VL+   NV  I+ V +TICGD+HG F DL+ +F K   P     YLF GD+VDRG  SVE +S L+   ++ P+ + + RGNHE   +   YGF+ E   KY   S  + K+FT+ F   P+  ++ N +F +HGG+S      MI  + + +  + +Q         E+     + +LLWSDP    G  ++  RG G  FG D++ QF   N + LI R+H+  M G+ + H+  V+T+FSA NY     N  A   +D++ N +  QY
Sbjct:   91 LSEDDVARLCKMAVDVLQFEENVKPIN-VPVTICGDVHGQFHDLLELF-KIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYG--SANVWKMFTDLFDYFPVTALVDNKIFCLHGGLS-----PMIETIDQVRDLNRIQ---------EVPHEGPMCDLLWSDPDDRGGWGISP-RGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYSWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQY 357          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 158.303 bits (399), Expect = 5.062e-44
Identity = 100/271 (36.90%), Postives = 151/271 (55.72%), Query Frame = 2
Query:  524 LLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDP-RPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKS 1333
            L  +A+ +    P + E+    I ICGDIHG + DL+ +F+    P  SN YLF GD+VDRG +S+E I +LL   ++ P   F+ RGNHE   +N  YGF+ E   +Y   +  L K FT+ F+ LP+A ++   +F +HGG+S   DL  +  +RR             M   +I +   + +LLWSDP + + G   N  RG    FGPDV  +FL+K  M+LI R+H+   +G+++  + +++TLFSA NY     N GA   +D+S
Sbjct:   37 LCSKARSIFIKQPILLELE-APIKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRY---NIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLS--PDLNSMEQIRRV------------MRPTDIPDVGLLCDLLWSDPDKDIVGWSEND-RGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDES 287          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Match: PPH3 (Catalytic subunit of protein phosphatase PP4 complex; Pph3p and Psy2p form active complex, Psy4p may provide substrate specificity; regulates recovery from the DNA damage checkpoint, the gene conversion- and single-strand annealing-mediated pathways of meiotic double-strand break repair and efficient Non-Homologous End-Joining (NHEJ) pathway; involved in activation of Gln3p to alleviate nitrogen catabolite repression; Pph3p and Psy2p localize to foci on meiotic chromosomes [Source:SGD;Acc:S000002482])

HSP 1 Score: 147.517 bits (371), Expect = 3.164e-40
Identity = 98/284 (34.51%), Postives = 150/284 (52.82%), Query Frame = 2
Query:  515 LIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLD-TDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKS 1363
            +  L L +Q +L +  NV ++    +TICGDIHG   DL+T+F+K+     +  Y+F GDFVDRG  S+E   +LL   L+ P+ + L RGNHE   +   YGF+ E+  KY   +  + +   E F  L L  ++ NS+F VHGG+S D T +  IR + R++               E+     + +LLWSDP  ++   ++  RG G  FG     QFLEKN ++LI R+H+  M G+    +  ++T++SA NY     N  A   ID   N   T +++
Sbjct:   22 VFRLCLNSQELLMNEGNVTQVD-TPVTICGDIHGQLHDLLTLFEKSGGVEKTR-YIFLGDFVDRGFYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKVYGFYDEVVRKYGNSN--VWRYCCEVFDYLSLGAIINNSIFCVHGGLSPDMTTVDEIRTIDRKQ---------------EVPHEGAMCDLLWSDPEDVDTWSLSP-RGAGFLFGKREVDQFLEKNNVELIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVLKIDDDLNREYTIFEA 285          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO47034 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RNB7])

HSP 1 Score: 430.254 bits (1105), Expect = 8.702e-143
Identity = 249/652 (38.19%), Postives = 376/652 (57.67%), Query Frame = 2
Query:   59 MGCKLSSNLFK--NNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQI-LMQKLLSITLHNNPERHFDVKCKFSKFNDILPPD--------------KQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLR-AQVVLRDLPNVYEIS---PVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYES---DNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQY---KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKW---YLIPTSLVETDVPYLTMINNAEIQ-YTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQ------NTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            MGC  S + +K  +   + +   KS      L++ +LIQ ++RRYRA+ EA+R+  WKI Q +EYS EQ+Q+ L      +  H  P+     +       D L  +              + A   +DI  ++ ++ G  +K PIT   VRN++E  K   NKL +   + L+LR A+   R LPNV  ++      +TICGD+HG  DDL  IF KN LPS  NPY+FNGD VDRG +S+E+  +L    +  PN V++NRGNHEDH MN RYGF KE+ +KYK+ +  +I+LF + F  LPLAT++ N +FV HGGIS  TDL +I  + R K+ SVL+  +   DN +   + EW+QVL+LLWSDP+P  GCK NT+RGGGCYFGPDVT Q L K+  +L++RSHECK  G++Y H  KV+T+FSASNYYE GSN GA+  I         QY   ++++ +  ++     EE ++R L  +++  +++L++ F + D   +G ++  QW  A+ + +++D+PW  L+    Y+ P   V+    Y + +    I+  T K   S+ E   R  SN+E +F ++D   SGH++  EF    +       T + ++ +QD     L ++ D++ DG+ID  EFL+  R+
Sbjct:    1 MGCGTSVDAYKEYDGHKNSLSLSKSEK---ALRSAVLIQNWFRRYRARLEARRRCTWKIFQSIEYSGEQDQLKLFNFFTDMLTHVQPDNTGASRANI--IEDTLSRNGSASSTSSKSSTTLEAATDPSDI-KVEPTYTGHVVKLPITLMSVRNIIEQCKL--NKLVHAKYVLLILREARERFRALPNVIRVTTRIAKQMTICGDLHGKLDDLFMIFHKNGLPSPENPYIFNGDLVDRGPRSIEICIILFAFTILYPNGVYINRGNHEDHIMNLRYGFVKEVMDKYKDHASKIIRLFEDIFGWLPLATIVNNKIFVAHGGISNITDLDIIERIDRHKYVSVLKPPNIVKDNPSLSSLKEWRQVLDLLWSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRSHECKYEGYEYMHNKKVITIFSASNYYEQGSNRGAYMKIGPDMTPYFVQYQVSRTKKHLTLKQRVGIVEESAIRELKEKLYANKSALMEAFTKRDEQHTGYLTCSQWAAAIESTLHLDVPWNMLRHQLAYVAPDGKVD----YRSCLEQYAIEGKTKKNGPSITEALYRNRSNLETIFRLMDKDNSGHVSMEEFQASCRLLNQHSETEIPEDSIQD-----LARSIDMDKDGYIDFNEFLEAFRL 635          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 161.384 bits (407), Expect = 9.061e-45
Identity = 101/305 (33.11%), Postives = 155/305 (50.82%), Query Frame = 2
Query:  497 KLSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTD-LAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFRKNEEESVR 1408
            +L+   +  L  +A+ +L    NV E+    +T+CGD+HG F DL+ +F+       +N YLF GD+VDRG  SVE +++L+   ++ P+ + + RGNHE   +   YGF+ E   KY   S  + K FT+ F  LPL  ++ N +F +HGG+S   D L  IR L R +               E+     + +LLWSDP    G  ++  RG G  FG D++  F   N + LI R+H+  M G+++CH+  V+T+FSA NY     N  A   +D +      Q+        R+ E    R
Sbjct:   23 QLTEAQVKTLCEKAKEILSKESNVQEVK-CPVTVCGDVHGQFHDLMELFRIGGKSPDTN-YLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGNAS--VWKYFTDLFDYLPLTALVDNQIFCLHGGLSPSIDTLDHIRALDRIQ---------------EVPHEGPMCDLLWSDPDDRGGWGISP-RGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDALKYSFLQFDPAP----RRGEPHVTR 303          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 160.614 bits (405), Expect = 3.486e-44
Identity = 104/297 (35.02%), Postives = 163/297 (54.88%), Query Frame = 2
Query:  455 IVRNLVEFYKS--GNN-KLSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDP-RPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKS 1333
            I+  L+E   S  G N +L+  ++  L L+++ +    P + E+    + ICGDIHG + DL+ +F+    P  SN YLF GD+VDRG +S+E I +LL   ++ P   FL RGNHE   +N  YGF+ E   +Y   +  L K FT+ F+ LP+A +L   +F  HGG+S   DL  +  +RR             M   ++ +   + +LLWSDP + + G   N  RG    FGPD+  +FL K+ + LI R+H+   +G+++  + +++TLFSA NY     N GA   +D++
Sbjct:   12 IISRLLEVRGSRPGKNVQLTEAEIRGLCLKSREIFLSQPILLELE-APLKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY---NIKLWKTFTDCFNCLPVAAILDEKIFCCHGGLS--PDLQSMEQIRR------------IMRPTDVPDQGLLCDLLWSDPDKDVQGWGEND-RGVSFTFGPDIVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDET 288          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 148.288 bits (373), Expect = 5.134e-40
Identity = 99/291 (34.02%), Postives = 154/291 (52.92%), Query Frame = 2
Query:  500 LSNRDLIELLLRAQVVLRDLPNVYEI-SPVSITICGDIHGNFDDLVTIFQKNC-LPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLD-TDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKS 1363
            ++ +++ +L  +A+ +L +  NV  + SPV  T+CGDIHG F DL  +F+    +P T+  YLF GDFVDRG  SVE   +LL   ++ P+ + L RGNHE   +   YGF+ E   KY  I+  + +   E F  L L+ ++ N +F VHGG+S   + L  IR + R++               E+     + +LLWSDP  + G  ++  RG G  FG DV  Q+   N + LI R+H+  M G+ +   + VLT++SA NY     N  A   +D+      T +++
Sbjct:   20 ITEKEVKQLCAKAREILVEESNVQRVDSPV--TVCGDIHGQFYDLKELFKVGGDVPDTN--YLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKYGSIT--VWRYCAEIFDYLSLSAIIDNRVFCVHGGLSPSISTLDQIRSIDRKQ---------------EVPHDGPMCDLLWSDPEDIQGWGVSP-RGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLKREFTIFEA 288          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 122.479 bits (306), Expect = 7.869e-30
Identity = 87/272 (31.99%), Postives = 132/272 (48.53%), Query Frame = 2
Query:  536 AQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCK-------MNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDK------VLTLFSASNYYELGSNYGA 1312
               +LR    + E+    IT+CGDIHG F DLV +F+    P+T+  YLF GD+VDRG  S+E +  L        N +FL RGNHE   +   + F  E   KY   SE +     E+F  LPLA ++      VHGG+S +    +  + + ++FK             E   +  + +LLWSDP    G +        NT RG   ++    T +FL+ N +  IIR+HE +  G+    + +      ++T+FSA NY ++ +N  A
Sbjct:   46 GTAILRKEKTMLEVD-APITVCGDIHGQFYDLVKLFEVGGSPATTR-YLFLGDYVDRGYFSIECVLYLWTLKCLYTNTLFLLRGNHECRHLTEYFTFKTECKIKY---SEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIH-TLDDVKKLDRFK-------------EPPAFGPMCDLLWSDPLEDYGNEKTSEHFSHNTVRGCSYFYSYPATCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAA 298          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ppef1 (protein phosphatase with EF-hand domain 1 [Source:NCBI gene;Acc:101174574])

HSP 1 Score: 213.772 bits (543), Expect = 1.195e-59
Identity = 134/353 (37.96%), Postives = 202/353 (57.22%), Query Frame = 2
Query:   59 MGCKLS----SNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPP------DKQAIPWADID------ALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINE 1060
            MGC  S    + L K  T++   A ++ ++  T+KA +LIQ++YRRY A+ E +R+  W I Q +EY+ EQ+Q+ +    S  L N           F++ +   P       D    PW D +       +  S+ G ++ +P+       L+  +K     L  R +++LL  A+ +L+ +PN+  +S      ITICGD+HG+ DDL+ IF KN LPS   PY+FNGDFVDRG KSVEV+ +L   FL  P+ + LNRGNHED  MN RYGF KE+  KYK     +++LF + FSLLP+ATV+   + +VHGGIS  TDL ++  ++R K KS L++   ++ + +I +
Sbjct:    1 MGCGTSVATETQLKKLETDE---AGRTPSLALTIKAAVLIQRWYRRYMARLEMRRRYTWNIFQSIEYAGEQDQLQLSSFFSFMLDN-----------FTQLSGNGPDLITQLLDPVVDPWLDREICYNLVPVPDSYTGPRISFPLGVSDTNTLLSAFKE-QQILHARYVLQLLYEAKKLLKQMPNINHLSTSYTKDITICGDLHGHLDDLLLIFYKNGLPSAETPYVFNGDFVDRGKKSVEVVIMLFAYFLLYPDYMHLNRGNHEDPIMNLRYGFTKEVMQKYKIHGREILQLFQDVFSLLPIATVIDGKVLIVHGGISDQTDLNLLSSIKRHKVKSALRFPRYSLEKLDIGQ 338          

HSP 2 Score: 202.216 bits (513), Expect = 1.639e-55
Identity = 102/289 (35.29%), Postives = 169/289 (58.48%), Query Frame = 2
Query: 1055 NEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQE-------GVDFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKIS-SLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEF--IQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
             EWKQ++++LWSDP+   GC  N +RGGGCYFGPDVT + L ++ ++++IRSHECK  G++ CH  KV+T+FSASNYYE GSN GA+  + +    R  QY+              R  E  ++R L  +++  R+ L+  F+++D D +G +S+ +W   +  ++ +DLPWR L+ +L   +  +  V Y +   + E   T  K++ +L E   R+ +++E +F+++D  +SG ++  EF     + +  LG   + D  +  L ++ D N DG ID  EFL+  R+
Sbjct:  439 QEWKQIVDILWSDPKTQEGCSPNLFRGGGCYFGPDVTQKLLLQHGLQMLIRSHECKQEGYEICHGGKVITIFSASNYYEEGSNRGAYIKLGRELVPRFYQYQVSRITRKLTLTQRIRAAEGSALRALKEKLFAHRSELVGSFQQYDPDNTGTVSVCEWAQVLECVLRLDLPWRTLRPHLARLA-SDGSVEYQSCFEDMEPGATLPKVTPNLAETLFRYRTDIEIIFNIIDKDHSGLISIEEFRHTWRLFSAHLGVA-IDDRAIDDLARSIDFNKDGSIDFTEFLEAFRV 725          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: PPEF2 (serine/threonine-protein phosphatase with EF-hands 2 [Source:NCBI gene;Acc:101170112])

HSP 1 Score: 211.075 bits (536), Expect = 7.429e-59
Identity = 130/335 (38.81%), Postives = 195/335 (58.21%), Query Frame = 2
Query:   59 MGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITL-HNNP---ER-------HFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEIS---PVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ 1021
            MGC +     K++  +   +  S   V  ++A LLIQ++YR+Y A+ E +R+  W I Q +EY+ EQ+QI +       + H  P   ER       H +  C+ +++       ++   + DI+  D S+ G  L +P+T   V  LVE +K    +L  R ++++L     +LR LPN+  +S      ITICGD+HG  +DL+ IF KN LPS+  PY+FNGDFVDRG  S+E++ +L    L  PN + LNRGNHEDH +N RYGF KE+  KY+   + ++KL  + FS LPLATV+ + + VVHGGIS  TDL ++  + R ++ SVL+
Sbjct:    1 MGCGMG----KSSLQEKKCSRVSIYSVPAIRAALLIQRWYRQYVARLEMRRRCTWNIFQSIEYAGEQDQIKLYSFFGFLMDHFTPASSERNLISHIFHENEICRDTEW-------ERYFCYKDIEVPD-SYTGPHLTFPMTFCGVSKLVEAFKH-KQQLHARYVLQILGETWRLLRILPNINYVSVSQTKEITICGDLHGQLEDLLLIFYKNGLPSSEKPYIFNGDFVDRGKSSLEILLILFGFLLVYPNDLHLNRGNHEDHIVNLRYGFTKEILGKYRVHGKKILKLLQKIFSWLPLATVINDKVLVVHGGISNSTDLCVVSRVDRHRYVSVLR 322          

HSP 2 Score: 196.823 bits (499), Expect = 9.499e-54
Identity = 100/289 (34.60%), Postives = 174/289 (60.21%), Query Frame = 2
Query: 1055 NEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEG---VDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRF--DSNVEEMFHVLDSKYSGHLTFPEFAEFIQ-NTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            ++WKQ++NLLWSDP P NGC  N  RGGGCY+GPDVT + L ++ ++L+IRSHECK +G+++CH  +VLT+FSASNYYE+GSN GA+  +       + QY++      +  R++    E  ++R L  +++  ++ L++ ++EFD  ++G IS+  W +A  +++ + LPWR L+  L+  +     V Y   I    I     ++S    +++ +   SN+E +F ++D+ +SG ++  EF +  +  ++  +  + D+ +  L  + D N DG ID  EF++  R+
Sbjct:  423 HDWKQIVNLLWSDPMPQNGCISNEVRGGGCYWGPDVTEEVLGRHNLQLLIRSHECKQDGYEFCHNRRVLTIFSASNYYEVGSNRGAYIRMGADLVPHLIQYQASRTCRELTLRQSVGWTERSALRALREQLFVHKSDLIRAYQEFDPHQTGKISMRHWASATESVLKLGLPWRVLRSQLVSRTHYGM-VDYQQWIKELSITEPKLEVSDTSILETMYKNHSNLETIFRIIDTDHSGLISLEEFRQTWKLLSSHLKMEISDKAIADLAHSIDFNKDGSIDINEFMEAFRL 710          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ppp5c (protein phosphatase 5 catalytic subunit [Source:NCBI gene;Acc:101158545])

HSP 1 Score: 205.297 bits (521), Expect = 1.634e-58
Identity = 119/294 (40.48%), Postives = 171/294 (58.16%), Query Frame = 2
Query:  443 ITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEIS---PVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAF 1315
            +T   + +++E++K    KL  +   ++L++ + VL  LP++ EI+      +TICGD HG + DL+ IF+ N LPS +NPYLFNGDFVDRGS S+EVI  L    L  P+   L RGNHE   MN  YGF  E+  KY   +  + +LF+E F  LPLA  + + + V+HGG+  +  + +  I + ++ +       D+   C         +LLWSDP+P NG  ++  RG  C FGPDVT  FLEKN +  IIRSHE K  G++  H  K +T+FSA NY +   N GA+
Sbjct:  178 VTVSFMTDMMEWFKE-QKKLHRKCAYQILVQVKDVLSKLPSLVEITLKETDKLTICGDTHGQYYDLLNIFKLNGLPSDANPYLFNGDFVDRGSFSLEVILTLFGFKLLYPDNFHLLRGNHETDNMNQMYGFEGEVKAKY---TAQMFQLFSEVFQWLPLAQCINSKVLVMHGGLFSEDGVTLDDIRKIDRNRQ----PPDSGPMC---------DLLWSDPQPQNGRSVSK-RGVSCQFGPDVTESFLEKNKLDYIIRSHEVKAEGYEVTHSGKCITVFSAPNYCDQMGNKGAY 453          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ENSORLT00000036394.1 (serine/threonine-protein phosphatase with EF-hands 2-like [Source:NCBI gene;Acc:101171918])

HSP 1 Score: 206.838 bits (525), Expect = 3.255e-57
Identity = 126/331 (38.07%), Postives = 194/331 (58.61%), Query Frame = 2
Query:   59 MGCKLS-SNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHN----NPERHFDVKCKFSKFNDILPPDK--QAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ 1021
            MGC +S SN F  ++               ++A +LIQ++YR+Y A+ E +R+  W I Q +EYS EQ QI +   L   + N    + ER  ++     + NDI    +  +   + +I+  +  ++G  L +P+T +    L++ +++   +L +R +++LLL    +LR LPN+  IS      +TICGD+HG  +DL+ IF KN +PS   PY+FNGDFVDRG  S+E++ +L    L  P+ V+LNRGNHEDH +N RYGF KE+  KY+   + ++KL  + FS LPLATV+   + V+HGGIS  TDLA++  L R  + S L+
Sbjct:    1 MGCGVSKSNQFHKHSR------------KAIRAAVLIQRWYRQYVARTEMRRRYTWNIFQSIEYSGEQAQIKLYNFLGYLMDNFTPSSSER--NLISHIFRENDICRDAEWERYFCYKNIEVPEV-YSGPHLTFPLTLEQAIGLLDAFRN-KKQLHSRYVLQLLLETWRLLRMLPNINRISTCHSKEVTICGDLHGQLEDLLLIFYKNGMPSLEKPYVFNGDFVDRGKDSIEILLILFSFLLIYPSDVYLNRGNHEDHIINLRYGFTKEVLTKYRVHGKRILKLLQKIFSWLPLATVIDQKVLVLHGGISDTTDLAVLAKLDRHSYVSALR 315          

HSP 2 Score: 203.371 bits (516), Expect = 6.495e-56
Identity = 106/298 (35.57%), Postives = 173/298 (58.05%), Query Frame = 2
Query: 1028 SDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGV-------DFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKI--SSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLG-QNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            SDN NE    EW+Q+L+LLWSDP   NGCK N  RGGGCY+GPD+T  FL ++ M+LIIRSHECK  G+++CH  +VLTLFSASNYY++GSN GA+  +       + QY++              + E  +++ L  +++  ++ L+  FR FD + +G++S+  W  A+ ++M+++LPWR L+  L+     +  + Y    +   I+  N      +L E   R  S +E +F ++D+  SG ++  +F +  +  ++  +  + DE ++ L    D N DG ID +EF++  R+
Sbjct:  413 SDNSNE----EWRQILDLLWSDPMTQNGCKPNEVRGGGCYWGPDITEDFLNRHNMQLIIRSHECKQEGYEFCHNRRVLTLFSASNYYDVGSNRGAYVKMGPDLEPYVIQYQASSMTRELTAKQSIGRTERSALKVLREQLFAHKSDLICAFRGFDTENAGLVSLSDWACAVESVMHLNLPWRMLRCQLVTCKGSDGMIDYNAWFHELAIKGPNTDHIEQTLLETLYRHRSTLETIFRIVDTDNSGFISMEDFRQTWKLLSVYLKMEITDEAISDLAVTIDSNQDGSIDIDEFMEAFRL 706          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Match: ENSORLT00000000429.2 (serine/threonine-protein phosphatase with EF-hands 2-like [Source:NCBI gene;Acc:101171918])

HSP 1 Score: 203.371 bits (516), Expect = 3.043e-56
Identity = 106/298 (35.57%), Postives = 173/298 (58.05%), Query Frame = 2
Query: 1028 SDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGV-------DFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKI--SSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLG-QNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            SDN NE    EW+Q+L+LLWSDP   NGCK N  RGGGCY+GPD+T  FL ++ M+LIIRSHECK  G+++CH  +VLTLFSASNYY++GSN GA+  +       + QY++              + E  +++ L  +++  ++ L+  FR FD + +G++S+  W  A+ ++M+++LPWR L+  L+     +  + Y    +   I+  N      +L E   R  S +E +F ++D+  SG ++  +F +  +  ++  +  + DE ++ L    D N DG ID +EF++  R+
Sbjct:  376 SDNSNE----EWRQILDLLWSDPMTQNGCKPNEVRGGGCYWGPDITEDFLNRHNMQLIIRSHECKQEGYEFCHNRRVLTLFSASNYYDVGSNRGAYVKMGPDLEPYVIQYQASSMTRELTAKQSIGRTERSALKVLREQLFAHKSDLICAFRGFDTENAGLVSLSDWACAVESVMHLNLPWRMLRCQLVTCKGSDGMIDYNAWFHELAIKGPNTDHIEQTLLETLYRHRSTLETIFRIVDTDNSGFISMEDFRQTWKLLSVYLKMEITDEAISDLAVTIDSNQDGSIDIDEFMEAFRL 669          

HSP 2 Score: 183.341 bits (464), Expect = 4.523e-49
Identity = 110/281 (39.15%), Postives = 168/281 (59.79%), Query Frame = 2
Query:  206 KRKMIWKIHQLVEYSNEQNQILMQKLLSITLHN----NPERHFDVKCKFSKFNDILPPDK--QAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQ 1021
            +R+  W I Q +EYS EQ QI +   L   + N    + ER  ++     + NDI    +  +   + +I+  +  ++G  L +P+T +    L++ +++   +L +R +++LLL    +LR LPN+  IS      +TICGD+HG  +DL+ IF KN +PS   PY+FNGDFVDRG  S+E++ +L    L  P+ V+LNRGNHEDH +N RYGF KE+  KY+   + ++KL  + FS LPLATV+   + V+HGGIS  TDLA++  L R  + S L+
Sbjct:    2 RRRYTWNIFQSIEYSGEQAQIKLYNFLGYLMDNFTPSSSER--NLISHIFRENDICRDAEWERYFCYKNIEVPEV-YSGPHLTFPLTLEQAIGLLDAFRN-KKQLHSRYVLQLLLETWRLLRMLPNINRISTCHSKEVTICGDLHGQLEDLLLIFYKNGMPSLEKPYVFNGDFVDRGKDSIEILLILFSFLLIYPSDVYLNRGNHEDHIINLRYGFTKEVLTKYRVHGKRILKLLQKIFSWLPLATVIDQKVLVLHGGISDTTDLAVLAKLDRHSYVSALR 278          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000003989.1 (SMESG000003989.1)

HSP 1 Score: 1169.84 bits (3025), Expect = 0.000e+0
Identity = 574/628 (91.40%), Postives = 574/628 (91.40%), Query Frame = 2
Query:   26 AYFEPKVWRPVMGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDK----SGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARIYL 1897
            AYFEPKVWRPVMGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKY                                                  KFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDK    SGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARIYL
Sbjct:   59 AYFEPKVWRPVMGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKY--------------------------------------------------KFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSDKYSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARIYL 636          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000003989.1 (SMESG000003989.1)

HSP 1 Score: 941.414 bits (2432), Expect = 0.000e+0
Identity = 480/627 (76.56%), Postives = 492/627 (78.47%), Query Frame = 2
Query:   26 AYFEPKVWRPVMGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFRKNEEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNA---EIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARIYL 1897
            AYFEPKVWRPVMGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKY                                                  KFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAI                                                  IDKS  + I Q+ +         + W  + +  +      + +    M+++    EIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARIYL
Sbjct:   59 AYFEPKVWRPVMGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKY--------------------------------------------------KFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAI--------------------------------------------------IDKSANVRITQYKSQEGVDFRSYIHW-SMGYCYVDDHEYGSPLETAQMVSHPYQPEIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARIYL 584          

HSP 2 Score: 79.337 bits (194), Expect = 3.080e-15
Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 1
Query: 1483 RSYIHWSMGYCYVDDHEYGSPLETAQMVSHPYQP 1584
            RSYIHWSMGYCYVDDHEYGSPLETAQMVSHPYQP
Sbjct:  461 RSYIHWSMGYCYVDDHEYGSPLETAQMVSHPYQP 494          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000042202.1 (SMESG000042202.1)

HSP 1 Score: 445.662 bits (1145), Expect = 5.940e-149
Identity = 258/615 (41.95%), Postives = 368/615 (59.84%), Query Frame = 2
Query:  131 NIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQK----LLSITLHNNPERHFDVKCKFSKFNDILPP--------DKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNM-NECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQY----KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRF---DSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNP-LQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            N    +KA +LIQ +YRRYRAK EAKR+  W I+Q +EYS EQ+Q+ +Q     LLS+T +   E   +V    SK + +           D Q +   +   ++ ++ G KL +P++   V  L+E ++     L  R L+ELL   + +L+  PNV + S      +TICGD+HG  DDLVTIF KN  P TSNPY+ NGDFVDRGS SVE+ ++L   FL  P +VFLNRGNHEDH MN RYGF KE+  KYK  +  +++ F + FS LPL T++ NS+ V HGGIS   +L +I  L R KF SVLQ   +++ NE +  EW Q+L+LLWSDPR   GC +N YRGGGCYFGPD+T   L+K  + L+IRSHECK++G+++CHE+KV+TLFSASNYY+ GSN GAF  ID   N +  QY    K+Q+ +   ++    EE ++R L  +I   +N L ++F + D++  GVI + +W T M  ++ + LPWR L+ +L+  S  E  V Y ++    ++   NK +   G +         N+E +F ++D   SGH++  EF +  +      N  + +E +  L K  D+N DG ID  EFL+  RI
Sbjct:   18 NSPKAIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLT-NKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRK-EQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLS-KEGKVEYSSIFEAQQVD--NKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRI 627          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000042202.1 (SMESG000042202.1)

HSP 1 Score: 446.047 bits (1146), Expect = 1.129e-148
Identity = 257/611 (42.06%), Postives = 368/611 (60.23%), Query Frame = 2
Query:  143 TLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQK----LLSITLHNNPERHFDVKCKFSKFNDILPP--------DKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNM-NECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQY----KSQEGVDFRKN----EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRF---DSNVEEMFHVLDSKYSGHLTFPEFAEFIQNTTLGQNP-LQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            ++KA +LIQ +YRRYRAK EAKR+  W I+Q +EYS EQ+Q+ +Q     LLS+T +   E   +V    SK + +           D Q +   +   ++ ++ G KL +P++   V  L+E ++     L  R L+ELL   + +L+  PNV + S      +TICGD+HG  DDLVTIF KN  P TSNPY+ NGDFVDRGS SVE+ ++L   FL  P +VFLNRGNHEDH MN RYGF KE+  KYK  +  +++ F + FS LPL T++ NS+ V HGGIS   +L +I  L R KF SVLQ   +++ NE +  EW Q+L+LLWSDPR   GC +N YRGGGCYFGPD+T   L+K  + L+IRSHECK++G+++CHE+KV+TLFSASNYY+ GSN GAF  ID   N +  QY    K+Q+ +   ++    EE ++R L  +I   +N L ++F + D++  GVI + +W T M  ++ + LPWR L+ +L+  S  E  V Y ++    ++   NK +   G +         N+E +F ++D   SGH++  EF +  +      N  + +E +  L K  D+N DG ID  EFL+  RI
Sbjct:   48 SIKAAILIQNWYRRYRAKLEAKRRYTWMIYQSIEYSGEQDQLKLQSFFNDLLSLT-NKGQECDSEVIEALSKTHVLKTAPTVSDEDRDLQYLTKIEQIVVEPTYKGAKLTFPLSINQVTALIESFRK-EQILHARYLLELLDHTRNLLKTKPNVSQASTSISKRVTICGDLHGQLDDLVTIFYKNKFPDTSNPYIINGDFVDRGSHSVEIAAILFSFFLLYPQSVFLNRGNHEDHVMNYRYGFVKEIQIKYKSNANKIVRFFADIFSWLPLMTIIDNSILVCHGGISAMLNLDVIEKLDRHKFLSVLQAPVEDIKNENKEEEWMQILDLLWSDPRSKPGCSVNQYRGGGCYFGPDITNDILKKYNLSLLIRSHECKIDGYEWCHENKVVTLFSASNYYKQGSNKGAFLRIDNEHNKQFFQYTTHKKNQKHLTLIQSVNQIEESALRDLKGKILAFKNELAEEFIQKDVNNRGVIELQEWCTVMENVLKLPLPWRTLRPHLVKLS-KEGKVEYSSIFEAQQVD--NKFLMIAGTMTEELYKNKENLETIFRIMDKDNSGHISLSEFRDACKLLHRHTNRNVSEEAIEDLAKCLDINKDGQIDFNEFLEAFRI 653          
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Match: SMESG000076282.1 (SMESG000076282.1)

HSP 1 Score: 423.32 bits (1087), Expect = 2.513e-140
Identity = 238/630 (37.78%), Postives = 366/630 (58.10%), Query Frame = 2
Query:   59 MGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAKRKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDILPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNK--LSNRDLIELLLRAQVVLRDLPNVYEISPV---SITICGDIHGNFDDLVTIFQKNCLPSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFMNSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGISLDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLNGCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKVLTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFRKN----------EEESVRCLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQLKWYL---IPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRFDSNVEEMFHVLDSKYSGHLTFPEFAEFIQN-TTLGQNPLQDEELTQLWKNFDLNNDGWIDKEEFLKIARI 1891
            MGC+ S    K N    ++  + +  +  +K+V+ IQK+YR Y+A+ EA+RK  W I+Q +EYS EQ+Q+ +       ++   +++      F+K  +     K++  + +   L+  ++G  +++P+T  ++ +L+  +   NN+  L    L ELL++ + +L+  PN+ E        ITICGD+HG   DL+ IF++N  P  SNPY+FNGDF+DRG  SVE+  +L    +  P  VFLNRGNHED  MN RYGF KE+  KYK  +  +I LF + F  LPLAT++ N +F+ HGGIS    L  ++ + R K+ S L   SD  +E +  EW QVL++LWSDP+P  GC+ N +RGGGCYFGPD+T QFLEK   +L+IRSHECK  G+++CH+D+VLT+FSASNYY+ GSN GAF  + KS   +I  + +++  +F+K+          EE ++R L ++I   R+ L+ +F   D D SG+I    W   M+ ++ +DLPWR L+  L    P+  +     +  +      Q    KIS   EI  ++   +E +F +LDS  SG ++  EF E  +   +  +  +  E +  L ++ D+N DG ID  EFL+  RI
Sbjct:    1 MGCQQSD--LKKNGIASVLLREDNEDLKMMKSVIAIQKWYRGYQARLEARRKCSWMIYQSIEYSGEQDQLKLHNFFLDLMNLMGQQNLSSDSLFTKALNKSTSIKRSSEYENDIPLETDYSGPIIQFPLTLTVITSLINAF---NNEQILHGHYLFELLVQTRGILKTKPNISETDLSIFKHITICGDLHGQLQDLIYIFEENRYPDPSNPYVFNGDFIDRGKHSVEIAVILFSFLILYPGCVFLNRGNHEDKIMNLRYGFIKEVQTKYKAHANSIINLFADIFRWLPLATIISNKIFICHGGISNRIQLETLKNIDRSKYISALNCPSD--SELDQAEWLQVLDILWSDPKPQKGCRQNLFRGGGCYFGPDITHQFLEKYKFRLLIRSHECKPLGYEWCHKDEVLTIFSASNYYDTGSNKGAFVKLTKSLEPKIISFNAKK--EFQKHILINEGIHAIEESALRELRTKILTNRSQLMSEFLACDGDNSGLIECQHWCNIMAAVLQLDLPWRTLRNQLAVVTPSGAINYSSTFELLSRMDSKQNHMNKISVSDEI-YKYRDTLETVFRILDSDNSGRISIDEFKEGCKILKSHSKANMTPEAMEDLARSIDINKDGSIDLNEFLEAFRI 620          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPEF11.171e-12837.26protein phosphatase with EF-hand domain 1 [Source:... [more]
PPEF14.781e-9133.22protein phosphatase with EF-hand domain 1 [Source:... [more]
PPEF22.948e-6038.46protein phosphatase with EF-hand domain 2 [Source:... [more]
PPEF27.098e-5936.14protein phosphatase with EF-hand domain 2 [Source:... [more]
PPP5C3.410e-5539.12protein phosphatase 5 catalytic subunit [Source:HG... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pef-11.330e-12735.08Serine/threonine-protein phosphatase with EF-hands... [more]
pef-12.436e-12635.69Serine/threonine-protein phosphatase with EF-hands... [more]
pef-14.448e-11738.68Serine/threonine-protein phosphatase with EF-hands... [more]
pph-54.597e-6239.55Serine/threonine-protein phosphatase 5 [Source:Un... [more]
C34D4.23.409e-4231.03Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdgC1.279e-11334.62gene:FBgn0265959 transcript:FBtr0473730[more]
rdgC3.155e-11334.68gene:FBgn0265959 transcript:FBtr0342946[more]
rdgC3.455e-11334.66gene:FBgn0265959 transcript:FBtr0342949[more]
rdgC3.455e-11334.66gene:FBgn0265959 transcript:FBtr0342947[more]
rdgC3.455e-11334.66gene:FBgn0265959 transcript:FBtr0342948[more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppef15.625e-6639.27protein phosphatase, EF-hand calcium binding domai... [more]
ppef13.335e-6338.41protein phosphatase, EF-hand calcium binding domai... [more]
ppef13.335e-6338.41protein phosphatase, EF-hand calcium binding domai... [more]
ppp5c4.123e-5941.16protein phosphatase 5, catalytic subunit [Source:Z... [more]
CU695117.13.839e-5536.68protein phosphatase with EF-hand domain 2a [Source... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp5c2.222e-5840.00protein phosphatase 5, catalytic subunit [Source:N... [more]
PPEF22.249e-5838.21protein phosphatase, EF-hand calcium binding domai... [more]
usp431.955e-5537.50ubiquitin specific peptidase 43 [Source:Xenbase;Ac... [more]
ppp5c1.312e-5142.02protein phosphatase 5, catalytic subunit [Source:N... [more]
ppp5c6.856e-5137.67protein phosphatase 5, catalytic subunit [Source:N... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppef11.105e-12036.98protein phosphatase with EF hand calcium-binding d... [more]
Ppef29.917e-6139.52protein phosphatase, EF hand calcium-binding domai... [more]
Ppef29.917e-6139.52protein phosphatase, EF hand calcium-binding domai... [more]
Ppp5c5.287e-5539.12protein phosphatase 5, catalytic subunit [Source:M... [more]
Ppp5c3.372e-5242.98protein phosphatase 5, catalytic subunit [Source:M... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3SWT6|PPE1_RAT2.911e-13137.32Serine/threonine-protein phosphatase with EF-hands... [more]
sp|O14829|PPE1_HUMAN5.624e-12837.26Serine/threonine-protein phosphatase with EF-hands... [more]
sp|G5EBX9|PPE_CAEEL3.099e-12535.69Serine/threonine-protein phosphatase with EF-hands... [more]
sp|O35655|PPE1_MOUSE7.729e-12036.98Serine/threonine-protein phosphatase with EF-hands... [more]
sp|P40421|RDGC_DROME3.163e-11234.68Serine/threonine-protein phosphatase rdgC OS=Droso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DFW75.746e-14338.50Serine/threonine-protein phosphatase with EF-hands... [more]
A0A1I8F2Q41.767e-14239.25Serine/threonine-protein phosphatase with EF-hands... [more]
A0A369SL602.939e-14039.20Serine/threonine-protein phosphatase with EF-hands... [more]
A0A2T7PP072.269e-13939.52Serine/threonine-protein phosphatase with EF-hands... [more]
A7RNB76.293e-13938.19Serine/threonine-protein phosphatase with EF-hands... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppef11.531e-6538.41serine/threonine-protein phosphatase with EF-hands... [more]
ppef17.000e-6440.33serine/threonine-protein phosphatase with EF-hands... [more]
ENSAMXT00000016118.21.281e-6140.86pep primary_assembly:Astyanax_mexicanus-2.0:14:382... [more]
ppp5c3.139e-5939.80protein phosphatase 5 catalytic subunit [Source:NC... [more]
PPEF27.285e-5837.57protein phosphatase with EF-hand domain 2 [Source:... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp5c2.129e-5638.51protein phosphatase 5, catalytic subunit [Source:Z... [more]
ppp1cab8.442e-4133.81protein phosphatase 1, catalytic subunit, alpha is... [more]
ENSPMAT00000010086.11.354e-3634.63pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ppp1cb4.866e-3033.63protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp3cb5.509e-2831.78protein phosphatase 3, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PPT18.902e-4736.23Protein serine/threonine phosphatase; regulates Hs... [more]
PPH215.182e-4536.01Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
PPH228.646e-4535.66Catalytic subunit of protein phosphatase 2A (PP2A)... [more]
GLC75.062e-4436.90Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
PPH33.164e-4034.51Catalytic subunit of protein phosphatase PP4 compl... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470348.702e-14338.19Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297599.061e-4533.11Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO446483.486e-4435.02Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499365.134e-4034.02Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO362727.869e-3031.99Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppef11.195e-5937.96protein phosphatase with EF-hand domain 1 [Source:... [more]
PPEF27.429e-5938.81serine/threonine-protein phosphatase with EF-hands... [more]
ppp5c1.634e-5840.48protein phosphatase 5 catalytic subunit [Source:NC... [more]
ENSORLT00000036394.13.255e-5738.07serine/threonine-protein phosphatase with EF-hands... [more]
ENSORLT00000000429.23.043e-5635.57serine/threonine-protein phosphatase with EF-hands... [more]
back to top
BLAST of Serine/threonine-protein phosphatase with EF-hands vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003989.10.000e+091.40SMESG000003989.1[more]
SMESG000003989.13.080e-1576.56SMESG000003989.1[more]
SMESG000042202.15.940e-14941.95SMESG000042202.1[more]
SMESG000042202.11.129e-14842.06SMESG000042202.1[more]
SMESG000076282.12.513e-14037.78SMESG000076282.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012659 ID=SMED30012659|Name=Serine/threonine-protein phosphatase with EF-hands|organism=Schmidtea mediterranea sexual|type=transcript|length=1935bp
ATCAATTTAAAAATTATAAATTTAGGCATATTTTGAACCTAAAGTTTGGC
GGCCAGTTATGGGTTGTAAATTAAGTAGCAACTTATTTAAAAATAACACT
AATGACGATATGATTGCATGCAAATCTTCCAATATCGTTGCAACGCTTAA
AGCCGTACTTCTCATTCAGAAGTATTATCGGAGATATAGGGCAAAGTGTG
AGGCTAAACGTAAAATGATTTGGAAAATTCACCAATTAGTTGAGTATTCA
AACGAACAAAATCAAATCCTAATGCAGAAGTTGTTATCAATAACTTTGCA
CAACAACCCAGAACGTCATTTCGATGTCAAATGCAAATTCTCCAAATTCA
ATGACATCCTCCCACCGGACAAGCAAGCCATTCCTTGGGCGGATATCGAT
GCACTCGATGCTTCCCACAACGGTTTCAAGCTCAAATATCCAATAACATC
AAAGATTGTGAGGAATCTTGTCGAATTCTATAAATCCGGAAACAATAAAT
TATCGAATCGTGACCTCATCGAATTACTGCTTCGTGCGCAAGTCGTGCTC
AGAGATCTTCCTAATGTATATGAGATATCCCCAGTGTCTATTACAATTTG
CGGTGATATTCATGGAAATTTCGATGACCTCGTTACAATTTTTCAGAAGA
ATTGTCTGCCCTCTACATCCAATCCATATCTTTTCAATGGAGATTTCGTT
GATCGAGGATCTAAATCCGTGGAGGTGATATCAGTTCTACTTGTTTGCTT
CCTACAGAATCCAAACGCAGTTTTCCTTAACAGAGGCAACCACGAGGATC
ATTTTATGAATTCTCGATATGGATTTTTCAAGGAACTCAATAATAAATAC
AAAGAAATTTCTGAAATTCTTATCAAATTATTTACTGAAACATTTTCGCT
TCTTCCATTGGCAACTGTTTTGAGAAATTCCATGTTTGTTGTCCACGGCG
GAATCTCTCTCGACACAGACCTCGCCATGATAAGAATTTTGCGTCGCGAG
AAATTCAAATCAGTGCTACAATACGAGTCCGATAATATGAATGAGTGTGA
GATCAACGAATGGAAACAGGTCCTCAATTTGTTATGGAGTGACCCAAGGC
CTCTAAATGGCTGCAAGATGAATACATATCGCGGTGGCGGATGCTATTTT
GGTCCAGATGTGACACTTCAATTTCTGGAGAAAAATTTTATGAAATTGAT
AATTCGTTCTCATGAATGCAAAATGAACGGATGGGATTATTGTCATGAAG
ATAAAGTGCTGACATTATTTTCCGCTTCCAATTATTACGAATTAGGTAGC
AATTACGGTGCGTTTGCAATCATCGATAAGTCAGCAAATGTCCGAATAAC
TCAGTATAAAAGTCAAGAAGGTGTTGATTTCAGGAAAAACGAAGAAGAAT
CGGTCCGATGCTTGATGTCGGAGATCTGGCGAAAAAGAAACTCGTTATTG
AAAAAATTTCGTGAATTTGATATTGACAAGTCAGGAGTTATATCCATTGG
TCAATGGGTTACTGCTATGTCGACGATCATGAATATGGATCTCCCTTGGA
GACAGCTCAAATGGTATCTCATCCCTACCAGCCTGGTGGAAACTGATGTC
CCTTATCTGACCATGATTAATAATGCAGAAATTCAGTACACTAATAAGAA
AATTTCTTCACTTGGAGAAATTGATTCTAGATTTGACTCAAATGTTGAGG
AAATGTTTCATGTTCTGGATTCCAAATATTCGGGGCACCTAACTTTTCCC
GAGTTCGCAGAATTTATTCAGAACACAACTCTAGGACAAAACCCTTTGCA
AGATGAAGAATTGACACAATTATGGAAAAACTTCGACTTGAACAATGATG
GCTGGATTGATAAGGAGGAATTTCTCAAGATTGCAAGAATTTATTTATGA
AAGAGCATGAAGAACTATTAATATTTAATCGGATT
back to top

protein sequence of SMED30012659-orf-1

>SMED30012659-orf-1 ID=SMED30012659-orf-1|Name=SMED30012659-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=614bp
MGCKLSSNLFKNNTNDDMIACKSSNIVATLKAVLLIQKYYRRYRAKCEAK
RKMIWKIHQLVEYSNEQNQILMQKLLSITLHNNPERHFDVKCKFSKFNDI
LPPDKQAIPWADIDALDASHNGFKLKYPITSKIVRNLVEFYKSGNNKLSN
RDLIELLLRAQVVLRDLPNVYEISPVSITICGDIHGNFDDLVTIFQKNCL
PSTSNPYLFNGDFVDRGSKSVEVISVLLVCFLQNPNAVFLNRGNHEDHFM
NSRYGFFKELNNKYKEISEILIKLFTETFSLLPLATVLRNSMFVVHGGIS
LDTDLAMIRILRREKFKSVLQYESDNMNECEINEWKQVLNLLWSDPRPLN
GCKMNTYRGGGCYFGPDVTLQFLEKNFMKLIIRSHECKMNGWDYCHEDKV
LTLFSASNYYELGSNYGAFAIIDKSANVRITQYKSQEGVDFRKNEEESVR
CLMSEIWRKRNSLLKKFREFDIDKSGVISIGQWVTAMSTIMNMDLPWRQL
KWYLIPTSLVETDVPYLTMINNAEIQYTNKKISSLGEIDSRFDSNVEEMF
HVLDSKYSGHLTFPEFAEFIQNTTLGQNPLQDEELTQLWKNFDLNNDGWI
DKEEFLKIARIYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0016787hydrolase activity
GO:0005509calcium ion binding
GO:0004721phosphoprotein phosphatase activity
GO:0005506iron ion binding
GO:0030145manganese ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR012008Ser/Thr-Pase_EF-hand_contain
IPR006186Ser/Thr-sp_prot-phosphatase
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR029052Metallo-depent_PP-like
IPR004843Calcineurin-like_PHP_ApaH
IPR018247EF_Hand_1_Ca_BS
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0050906detection of stimulus involved in sensory perception
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePRINTSPR00114STPHPHTASEcoord: 320..347
score: 26.41
coord: 377..397
score: 28.45
coord: 399..415
score: 45.44
coord: 240..264
score: 47.47
coord: 207..234
score: 48.66
coord: 177..204
score: 41.81
coord: 277..303
score: 35.9
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphataseSMARTSM00156pp2a_7coord: 148..437
e-value: 2.8E-94
score: 329.2
IPR006186Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatasePROSITEPS00125SER_THR_PHOSPHATASEcoord: 241..246
IPR002048EF-hand domainSMARTSM00054efh_1coord: 462..490
e-value: 0.46
score: 19.5
coord: 584..612
e-value: 0.049
score: 22.8
coord: 545..573
e-value: 7.3
score: 10.8
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 546..609
e-value: 1.1E-10
score: 41.8
IPR002048EF-hand domainPFAMPF13202EF-hand_5coord: 464..480
e-value: 0.074
score: 12.6
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 458..493
score: 10.692
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 580..613
score: 13.342
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 541..576
score: 10.385
IPR002048EF-hand domainCDDcd00051EFhcoord: 546..610
e-value: 5.56822E-8
score: 47.9277
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 177..388
e-value: 1.1E-25
score: 91.3
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 107..451
e-value: 2.3E-97
score: 327.6
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 455..613
e-value: 1.7E-16
score: 62.7
NoneNo IPR availablePANTHERPTHR45668:SF3SERINE/THREONINE-PROTEIN PHOSPHATASE RDGCcoord: 26..611
NoneNo IPR availablePANTHERPTHR45668FAMILY NOT NAMEDcoord: 26..611
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 125..445
IPR012008Serine/threonine-protein phosphatase with EF-handsPIRSFPIRSF000912PPEFcoord: 323..612
e-value: 5.4E-77
score: 256.8
coord: 7..332
e-value: 3.3E-91
score: 303.8
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 593..605
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 461..609