acid-sensing ion channel 5

Overview
Nameacid-sensing ion channel 5
Smed IDSMED30012641
Length (bp)2163
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of acid-sensing ion channel 5 (SMED30012641) t-SNE clustered cells

Violin plots show distribution of expression levels for acid-sensing ion channel 5 (SMED30012641) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of acid-sensing ion channel 5 (SMED30012641) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for acid-sensing ion channel 5 (SMED30012641) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012641

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30012641SMESG000072895.1 dd_Smed_v4_14044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012641SMESG000072895.1 dd_Smed_v4_14044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012641SMESG000072895.1 dd_Smed_v4_14044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012641SMESG000072895.1 dd_Smed_v4_14044_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of acid-sensing ion channel 5 vs. Ensembl Human
Match: ASIC3 (acid sensing ion channel subunit 3 [Source:HGNC Symbol;Acc:HGNC:101])

HSP 1 Score: 55.4546 bits (132), Expect = 1.870e-8
Identity = 26/78 (33.33%), Postives = 44/78 (56.41%), Query Frame = 3
Query: 1383 FVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLET----YFAIKQKEDR 1604
            ++  N + + I   +   + +E+ + Y  S LLGDIGG +GL++GASL+T+ E+ D L ++       YF  +Q   R
Sbjct:   34 YIAENVLALDIFFEALNYETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGYFWNRQHSQR 111          
BLAST of acid-sensing ion channel 5 vs. Ensembl Human
Match: ASIC3 (acid sensing ion channel subunit 3 [Source:HGNC Symbol;Acc:HGNC:101])

HSP 1 Score: 53.5286 bits (127), Expect = 7.695e-8
Identity = 26/74 (35.14%), Postives = 42/74 (56.76%), Query Frame = 3
Query: 1395 NFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLET----YFAIKQKEDR 1604
            N + + I   +   + +E+ + Y  S LLGDIGG +GL++GASL+T+ E+ D L ++       YF  +Q   R
Sbjct:   33 NVLALDIFFEALNYETVEQKKAYEMSELLGDIGGQMGLFIGASLLTILEILDYLCEVFRDKVLGYFWNRQHSQR 106          
BLAST of acid-sensing ion channel 5 vs. Ensembl Human
Match: ASIC2 (acid sensing ion channel subunit 2 [Source:HGNC Symbol;Acc:HGNC:99])

HSP 1 Score: 53.9138 bits (128), Expect = 7.983e-7
Identity = 55/239 (23.01%), Postives = 97/239 (40.59%), Query Frame = 3
Query:  858 CRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYL-DDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            CR+ +    ++ V+     S+     DC  + + E    +C C+   M       + PFC      P  +  C + A G L     +YC     C  T Y   +S    P+    KT+ ++++                  KFN                     KS +Y       +  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+FD + +L++
Sbjct:  289 CRSSEMGLDFFPVY-----SITACRIDCETRYIVE----NCNCRMVHMPG-----DAPFCT-----PEQHKECAEPALGLLAEKDSNYCLCRTPCNLTRYNKELSMVKIPS----KTSAKYLEK-----------------KFN---------------------KSEKY-------ISENILVLDIFFEALNYETIEQKKAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIK 459          
BLAST of acid-sensing ion channel 5 vs. Ensembl Human
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:HGNC Symbol;Acc:HGNC:21263])

HSP 1 Score: 53.1434 bits (126), Expect = 1.868e-6
Identity = 47/216 (21.76%), Postives = 80/216 (37.04%), Query Frame = 3
Query:  906 QNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLD-DCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFD 1550
            Q  S Y   S C  +  +EAV + C C+   M             + + PP +   C D     L  G    C+    C  T Y   IS                   +V I  R          ++ A K+++ +                        ++  NF+++ +   +   + +E+   Y  S LLGD+GG +GL++GAS++T+ E+ D
Sbjct:  435 QGYSAY-SVSACRLRCEKEAVLQRCHCRMVHMPG----------NETICPPNIYIECADHTLDSLGGGPEGPCFCPTPCNLTRYGKEIS-------------------MVRIPNR-------GSARYLARKYNRNET-----------------------YIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILD 590          
BLAST of acid-sensing ion channel 5 vs. Ensembl Human
Match: ASIC1 (acid sensing ion channel subunit 1 [Source:HGNC Symbol;Acc:HGNC:100])

HSP 1 Score: 48.9062 bits (115), Expect = 2.395e-6
Identity = 22/52 (42.31%), Postives = 35/52 (67.31%), Query Frame = 3
Query: 1395 NFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFD 1550
            N +++ I       + IE+ + Y  + LLGDIGG +GL++GAS++TV E+FD
Sbjct:    3 NILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFD 54          
BLAST of acid-sensing ion channel 5 vs. Ensembl Celegans
Match: deg-1 (Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:P24585])

HSP 1 Score: 56.9954 bits (136), Expect = 3.811e-8
Identity = 32/102 (31.37%), Postives = 53/102 (51.96%), Query Frame = 3
Query: 1347 FKSGRYDLMDL---------EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRVKIFRKR 1625
            + SG  DL D          ++   N  M+++       ++++E+E Y    L+ D GG +GLWLG S+ITV EV  LL D++  +F  + +E  ++   KR
Sbjct:  653 WPSGATDLGDCDGMTESECEQYYRLNAAMIEVFYEQLNYELLQESEAYGLVNLIADFGGHLGLWLGFSVITVMEVCVLLVDMISLFFKSRHEEKLLRQSTKR 754          
BLAST of acid-sensing ion channel 5 vs. Ensembl Celegans
Match: deg-1 (Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:P24585])

HSP 1 Score: 56.9954 bits (136), Expect = 3.811e-8
Identity = 32/102 (31.37%), Postives = 53/102 (51.96%), Query Frame = 3
Query: 1347 FKSGRYDLMDL---------EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRVKIFRKR 1625
            + SG  DL D          ++   N  M+++       ++++E+E Y    L+ D GG +GLWLG S+ITV EV  LL D++  +F  + +E  ++   KR
Sbjct:  653 WPSGATDLGDCDGMTESECEQYYRLNAAMIEVFYEQLNYELLQESEAYGLVNLIADFGGHLGLWLGFSVITVMEVCVLLVDMISLFFKSRHEEKLLRQSTKR 754          
BLAST of acid-sensing ion channel 5 vs. Ensembl Celegans
Match: deg-1 (Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:P24585])

HSP 1 Score: 56.9954 bits (136), Expect = 3.811e-8
Identity = 32/102 (31.37%), Postives = 53/102 (51.96%), Query Frame = 3
Query: 1347 FKSGRYDLMDL---------EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRVKIFRKR 1625
            + SG  DL D          ++   N  M+++       ++++E+E Y    L+ D GG +GLWLG S+ITV EV  LL D++  +F  + +E  ++   KR
Sbjct:  653 WPSGATDLGDCDGMTESECEQYYRLNAAMIEVFYEQLNYELLQESEAYGLVNLIADFGGHLGLWLGFSVITVMEVCVLLVDMISLFFKSRHEEKLLRQSTKR 754          
BLAST of acid-sensing ion channel 5 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 51.9878 bits (123), Expect = 1.783e-6
Identity = 27/98 (27.55%), Postives = 48/98 (48.98%), Query Frame = 3
Query: 1308 QNANLTIANISVAFKSGRYDLMD--------LEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETY 1577
            Q  N  +   S  + SG   +M+        LE   +N  MV+I       + ++E+  Y  + +L D+GG  GLW+GAS++++ E+  L+    + Y
Sbjct:  588 QETNYEVTYSSARWPSGSAKVMECLPGDFLCLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLIVFATQAY 685          
BLAST of acid-sensing ion channel 5 vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 51.9878 bits (123), Expect = 1.783e-6
Identity = 27/98 (27.55%), Postives = 48/98 (48.98%), Query Frame = 3
Query: 1308 QNANLTIANISVAFKSGRYDLMD--------LEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETY 1577
            Q  N  +   S  + SG   +M+        LE   +N  MV+I       + ++E+  Y  + +L D+GG  GLW+GAS++++ E+  L+    + Y
Sbjct:  588 QETNYEVTYSSARWPSGSAKVMECLPGDFLCLEKYRKNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLIVFATQAY 685          
BLAST of acid-sensing ion channel 5 vs. Ensembl Zebrafish
Match: asic1c (acid-sensing (proton-gated) ion channel 1c [Source:NCBI gene;Acc:407670])

HSP 1 Score: 55.0694 bits (131), Expect = 7.570e-8
Identity = 36/117 (30.77%), Postives = 66/117 (56.41%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRV--KIFRKRLATNHEITSESFLPKTLDEKSDFHQSNV*MLFS 1724
            +++  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+FD L ++L         +D++   + RKR    H   S++ +  +L    DF  S+V +L S
Sbjct:  119 QYITDNILVLDIFFEALNYEKIEQKKAYEVAGLLGDIGGQMGLFIGASVLTILEIFDYLYEVL---------KDKILGSVLRKR--RPHRSASDNLVIVSL---HDFKISSVFLLAS 221          
BLAST of acid-sensing ion channel 5 vs. Ensembl Zebrafish
Match: asic4a (acid-sensing (proton-gated) ion channel family member 4a [Source:NCBI gene;Acc:407668])

HSP 1 Score: 54.6842 bits (130), Expect = 2.116e-7
Identity = 32/114 (28.07%), Postives = 62/114 (54.39%), Query Frame = 3
Query: 1266 FSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRV 1607
            F +   N  ++ K  +     +  S  + S +YD  + +++  NF+++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+ D +      Y  IK + +R+
Sbjct:  172 FCETPCNLTRYGKELSMVKIPSKGSARYLSRKYDKSE-DYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVLTILEILDYV------YEVIKHRLERL 278          
BLAST of acid-sensing ion channel 5 vs. Ensembl Zebrafish
Match: asic4a (acid-sensing (proton-gated) ion channel family member 4a [Source:NCBI gene;Acc:407668])

HSP 1 Score: 54.299 bits (129), Expect = 3.950e-7
Identity = 29/90 (32.22%), Postives = 54/90 (60.00%), Query Frame = 3
Query: 1338 SVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRV 1607
            S  + S +YD  + +++  NF+++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+ D +      Y  IK + +R+
Sbjct:  388 SARYLSRKYDKSE-DYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVLTILEILDYV------YEVIKHRLERL 470          
BLAST of acid-sensing ion channel 5 vs. Ensembl Zebrafish
Match: asic1b (acid-sensing (proton-gated) ion channel 1b [Source:NCBI gene;Acc:407672])

HSP 1 Score: 53.9138 bits (128), Expect = 4.975e-7
Identity = 25/81 (30.86%), Postives = 52/81 (64.20%), Query Frame = 3
Query: 1329 ANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            +  S  + + +Y+  + +++  N M++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+FD L ++++
Sbjct:  396 SKASAKYLAKKYNKTE-QYISDNIMVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLYEVIK 475          
BLAST of acid-sensing ion channel 5 vs. Ensembl Zebrafish
Match: asic1a (acid-sensing (proton-gated) ion channel 1a [Source:NCBI gene;Acc:791696])

HSP 1 Score: 53.9138 bits (128), Expect = 5.179e-7
Identity = 25/81 (30.86%), Postives = 52/81 (64.20%), Query Frame = 3
Query: 1329 ANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            +  SV + + +Y   + +++  N M++ +   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+FD L ++++
Sbjct:  385 SKASVKYLAKKYSKSE-KYITENVMVLDVFFEALNYETIEQRKAYEVAGLLGDIGGQMGLFIGASILTILELFDYLYEVMK 464          
BLAST of acid-sensing ion channel 5 vs. Ensembl Xenopus
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:100486325])

HSP 1 Score: 55.4546 bits (132), Expect = 2.044e-7
Identity = 29/103 (28.16%), Postives = 54/103 (52.43%), Query Frame = 3
Query: 1383 FVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRVKIFRKRLATNHEITSESFLPKTLDEKSD 1691
            ++  NF+++ I   +   + IE+ + Y    LLGDIGG +GL++GAS +T+ E+ D + +++          D+VK    R  +  +  SE+     +D+  D
Sbjct:  359 YIRENFLVLDIFFEALNYETIEQKKAYDLPSLLGDIGGQMGLFIGASFLTILEILDYMYEVI---------RDKVKRVAGRKQSPAKKPSENIATLVMDDNKD 452          
BLAST of acid-sensing ion channel 5 vs. Ensembl Xenopus
Match: ASIC4 (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:100486325])

HSP 1 Score: 54.299 bits (129), Expect = 5.708e-7
Identity = 22/66 (33.33%), Postives = 42/66 (63.64%), Query Frame = 3
Query: 1383 FVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYF 1580
            ++  NF+++ I   +   + IE+ + Y    LLGDIGG +GL++GAS +T+ E+ D + ++++  F
Sbjct:  359 YIRENFLVLDIFFEALNYETIEQKKAYDLPSLLGDIGGQMGLFIGASFLTILEILDYMYEVIQVLF 424          
BLAST of acid-sensing ion channel 5 vs. Ensembl Xenopus
Match: ASIC1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:100489966])

HSP 1 Score: 51.9878 bits (123), Expect = 2.481e-6
Identity = 23/63 (36.51%), Postives = 42/63 (66.67%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLL 1568
            +++  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++TV E+FD   ++L
Sbjct:  343 QYIAENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVL 405          
BLAST of acid-sensing ion channel 5 vs. Ensembl Xenopus
Match: ASIC1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:100489966])

HSP 1 Score: 51.9878 bits (123), Expect = 2.830e-6
Identity = 23/63 (36.51%), Postives = 42/63 (66.67%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLL 1568
            +++  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++TV E+FD   ++L
Sbjct:  396 QYIAENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVL 458          
BLAST of acid-sensing ion channel 5 vs. Ensembl Xenopus
Match: ASIC1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:100489966])

HSP 1 Score: 51.9878 bits (123), Expect = 2.956e-6
Identity = 23/63 (36.51%), Postives = 42/63 (66.67%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLL 1568
            +++  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++TV E+FD   ++L
Sbjct:  404 QYIAENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVL 466          
BLAST of acid-sensing ion channel 5 vs. Ensembl Mouse
Match: Asic5 (acid-sensing (proton-gated) ion channel family member 5 [Source:MGI Symbol;Acc:MGI:1929259])

HSP 1 Score: 66.6254 bits (161), Expect = 5.108e-11
Identity = 105/512 (20.51%), Postives = 196/512 (38.28%), Query Frame = 3
Query:  105 NFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNV-LQDHTAFVYPDVSFCFTNPIYFPPAKSPYRR--FIMAQYKKYIQFKKYPSN---------FLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFA-YGACYTFNYSRFESSAGNKYRYGNKELDFII----YKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPK---LQESYILDEYSQVNLKIINKQHLNI--GKTCRTVK-NKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQC-------QWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFD 1550
            +F   ++ HG++ +A  ++  ++  W+ + L +   +V   Y  +  +   P  T++ +Q      +P V+ C  N  +   A S +    F+     K ++ ++  +N         F+T    F+   ++  N  Y +     LV C +    CS +D   +H+F  YG C+TFNY        NK     + L  ++     +  D P+  F D        +G++ +IH     P+   L  S  +  +++V ++ +   H     G+    +K   FI Y        S YG   +C  +++Q    + C C          E  +L +Y  +   +DH+              G    G+ +      CE T Y   +S S FP+   R T                        +F A K ++ Q                       E++  N + ++I  +     + ++ +      LL D+GG +GL+ GASLIT+ E+ +
Sbjct:   40 DFAMSTSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLNR-FQTEAVSRFGIIFFLWDIVSKVLRLQEISANNTGSPETLDFVTNHQNFSITEFVKNNGFYLNN--DTLVHCEFFGKTCSPKD--FKHVFTEYGNCFTFNYGE-NIQNKNKVSVSGRGLKLLLDVHQEEFTDNPVPGFAD--------AGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTVHQEYPWGECNPNIKLRNFITY--------STYGCLKECKARHIQ----RLCGCLPFLLPGNGVECDLLEYYNCVSPILDHI-----------ERKGLCTMGTHNSSCPVSCEETEYPATVSYSTFPS--QRAT------------------------RFLAKKLNQSQ-----------------------EYIRENLVNIEINYSDLNYKITQQQKAVSVPELLADVGGQLGLFCGASLITIIEIIE 465          
BLAST of acid-sensing ion channel 5 vs. Ensembl Mouse
Match: Asic5 (acid-sensing (proton-gated) ion channel family member 5 [Source:MGI Symbol;Acc:MGI:1929259])

HSP 1 Score: 65.0846 bits (157), Expect = 1.668e-10
Identity = 104/507 (20.51%), Postives = 194/507 (38.26%), Query Frame = 3
Query:  120 STIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNV-LQDHTAFVYPDVSFCFTNPIYFPPAKSPYRR--FIMAQYKKYIQFKKYPSN---------FLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFA-YGACYTFNYSRFESSAGNKYRYGNKELDFII----YKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPK---LQESYILDEYSQVNLKIINKQHLNI--GKTCRTVK-NKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQC-------QWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFD 1550
            ++ HG++ +A  ++  ++  W+ + L +   +V   Y  +  +   P  T++ +Q      +P V+ C  N  +   A S +    F+     K ++ ++  +N         F+T    F+   ++  N  Y +     LV C +    CS +D   +H+F  YG C+TFNY        NK     + L  ++     +  D P+  F D        +G++ +IH     P+   L  S  +  +++V ++ +   H     G+    +K   FI Y        S YG   +C  +++Q    + C C          E  +L +Y  +   +DH+              G    G+ +      CE T Y   +S S FP+   R T                        +F A K ++ Q                       E++  N + ++I  +     + ++ +      LL D+GG +GL+ GASLIT+ E+ +
Sbjct:    3 TSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLNR-FQTEAVSRFGIIFFLWDIVSKVLRLQEISANNTGSPETLDFVTNHQNFSITEFVKNNGFYLNN--DTLVHCEFFGKTCSPKDF--KHVFTEYGNCFTFNYGE-NIQNKNKVSVSGRGLKLLLDVHQEEFTDNPVPGFAD--------AGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTVHQEYPWGECNPNIKLRNFITY--------STYGCLKECKARHIQ----RLCGCLPFLLPGNGVECDLLEYYNCVSPILDHI-----------ERKGLCTMGTHNSSCPVSCEETEYPATVSYSTFPS--QRAT------------------------RFLAKKLNQSQ-----------------------EYIRENLVNIEINYSDLNYKITQQQKAVSVPELLADVGGQLGLFCGASLITIIEIIE 423          
BLAST of acid-sensing ion channel 5 vs. Ensembl Mouse
Match: Asic4 (acid-sensing (proton-gated) ion channel family member 4 [Source:MGI Symbol;Acc:MGI:2652846])

HSP 1 Score: 55.0694 bits (131), Expect = 2.412e-7
Identity = 48/216 (22.22%), Postives = 82/216 (37.96%), Query Frame = 3
Query:  906 QNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLD-DCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFD 1550
            Q  S Y   S C  +  +EAV + C C+   M             + + PP +   C D     L  GS   C+    C  T Y   IS                   +V+I  R          ++ A K+++ +                        ++  NF+++ +   +   + +E+   Y  S LLGD+GG +GL++GAS++T+ E+ D
Sbjct:  308 QGYSAY-SVSACRLRCEKEAVLQRCHCRMVHMPG----------NETICPPNIYIECADHTLDSLGGGSEGPCFCPTPCNLTRYGKEIS-------------------MVKIPNR-------GSARYLARKYNRNET-----------------------YIRENFLVLDVFFEALTSEAMEQQAAYGLSALLGDLGGQMGLFIGASILTLLEILD 463          
BLAST of acid-sensing ion channel 5 vs. Ensembl Mouse
Match: Asic2 (acid-sensing (proton-gated) ion channel 2 [Source:MGI Symbol;Acc:MGI:1100867])

HSP 1 Score: 53.9138 bits (128), Expect = 5.204e-7
Identity = 55/239 (23.01%), Postives = 97/239 (40.59%), Query Frame = 3
Query:  858 CRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYL-DDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            CR+ +    ++ V+     S+     DC  + + E    +C C+   M       + PFC      P  +  C + A G L     +YC     C  T Y   +S    P+    KT+ ++++                  KFN                     KS +Y       +  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+FD + +L++
Sbjct:  289 CRSSEMGLDFFPVY-----SITACRIDCETRYIVE----NCNCRMVHMPG-----DAPFCT-----PEQHKECAEPALGLLAEKDSNYCLCRTPCNLTRYNKELSMVKIPS----KTSAKYLEK-----------------KFN---------------------KSEKY-------ISENILVLDIFFEALNYETIEQKKAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIK 459          
BLAST of acid-sensing ion channel 5 vs. Ensembl Mouse
Match: Asic2 (acid-sensing (proton-gated) ion channel 2 [Source:MGI Symbol;Acc:MGI:1100867])

HSP 1 Score: 52.373 bits (124), Expect = 1.878e-6
Identity = 55/239 (23.01%), Postives = 97/239 (40.59%), Query Frame = 3
Query:  858 CRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYL-DDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            CR+ +    ++ V+     S+     DC  + + E    +C C+   M       + PFC      P  +  C + A G L     +YC     C  T Y   +S    P+    KT+ ++++                  KFN                     KS +Y       +  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+FD + +L++
Sbjct:  340 CRSSEMGLDFFPVY-----SITACRIDCETRYIVE----NCNCRMVHMPG-----DAPFCT-----PEQHKECAEPALGLLAEKDSNYCLCRTPCNLTRYNKELSMVKIPS----KTSAKYLEK-----------------KFN---------------------KSEKY-------ISENILVLDIFFEALNYETIEQKKAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIK 510          
BLAST of acid-sensing ion channel 5 vs. UniProt/SwissProt
Match: sp|Q9R0Y1|ASIC5_MOUSE (Acid-sensing ion channel 5 OS=Mus musculus OX=10090 GN=Asic5 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.573e-10
Identity = 105/512 (20.51%), Postives = 196/512 (38.28%), Query Frame = 3
Query:  105 NFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNV-LQDHTAFVYPDVSFCFTNPIYFPPAKSPYRR--FIMAQYKKYIQFKKYPSN---------FLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFA-YGACYTFNYSRFESSAGNKYRYGNKELDFII----YKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPK---LQESYILDEYSQVNLKIINKQHLNI--GKTCRTVK-NKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQC-------QWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFD 1550
            +F   ++ HG++ +A  ++  ++  W+ + L +   +V   Y  +  +   P  T++ +Q      +P V+ C  N  +   A S +    F+     K ++ ++  +N         F+T    F+   ++  N  Y +     LV C +    CS +D   +H+F  YG C+TFNY        NK     + L  ++     +  D P+  F D        +G++ +IH     P+   L  S  +  +++V ++ +   H     G+    +K   FI Y        S YG   +C  +++Q    + C C          E  +L +Y  +   +DH+              G    G+ +      CE T Y   +S S FP+   R T                        +F A K ++ Q                       E++  N + ++I  +     + ++ +      LL D+GG +GL+ GASLIT+ E+ +
Sbjct:   40 DFAMSTSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLNR-FQTEAVSRFGIIFFLWDIVSKVLRLQEISANNTGSPETLDFVTNHQNFSITEFVKNNGFYLNN--DTLVHCEFFGKTCSPKD--FKHVFTEYGNCFTFNYGE-NIQNKNKVSVSGRGLKLLLDVHQEEFTDNPVPGFAD--------AGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTVHQEYPWGECNPNIKLRNFITY--------STYGCLKECKARHIQ----RLCGCLPFLLPGNGVECDLLEYYNCVSPILDHI-----------ERKGLCTMGTHNSSCPVSCEETEYPATVSYSTFPS--QRAT------------------------RFLAKKLNQSQ-----------------------EYIRENLVNIEINYSDLNYKITQQQKAVSVPELLADVGGQLGLFCGASLITIIEIIE 465          
BLAST of acid-sensing ion channel 5 vs. UniProt/SwissProt
Match: sp|Q9R0W5|ASIC5_RAT (Acid-sensing ion channel 5 OS=Rattus norvegicus OX=10116 GN=Asic5 PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.655e-9
Identity = 110/513 (21.44%), Postives = 199/513 (38.79%), Query Frame = 3
Query:  105 NFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNV-LQDHTAFVYPDVSFCFTNPIYFPPAKSPYRR--FIMAQYKKYIQFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWS--------VLVECRYQDLQCSFQDLILRHLFA-YGACYTFNYSRFESSAGNKYRYGNKELDFII----YKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPK---LQESYILDEYSQVNLKIINKQHLNI--GKTCRTVK-NKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQC-------QWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLL 1556
            +F   ++ HG++ +A  ++  ++  W+ + L +   +V   Y  +  +   P  T++ +Q      +P V+FC  N  +   A S +    F+     K ++ ++   N  T   +  DF+   RN + T  + +         LV C +    C  +D   +H+F  YG C+TFNY     S  NK     + L  ++     +  D P+  F D        +G++ +IH     P+   L  S  +  +++V ++ +   H     G+    +K   F  Y        S YG   +C  +++Q    + C C          E  +L +Y  +   +DH+   R     + T     +N S        CE T Y   I+ S FP+   R T                        KF A K ++ Q                       E++  N + ++I  +     + ++ +      LL D+GG +GL+ GASLIT+ E+ + L
Sbjct:   40 DFAISTSFHGIHNIAQNQNKVRKVIWLSVVLGSVSLLVWQIYSRLVNYFMWPTTTSIEVQYVEKIEFPAVTFCNLNR-FQTEAVSRFGIIFFLWDIVSKVLRLQEISGNN-TGSPEALDFVASHRNFSITEFVKNNGFYLNHDTLVHCEFFGKTCDPKD--FKHVFTEYGNCFTFNYGENVQSK-NKVSVSGRGLKLLLDVHQEEFTDNPVPGFAD--------AGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTIHQEYPWGECNPDIKLRNFTTY--------STYGCLKECKAKHIQ----RLCGCLPFLLPGNGVECDLLKYYNCVSPILDHI--ERKGLCTMGT-----HNSSCPV----PCEETEYPATIAYSTFPS--QRAT------------------------KFLAKKLNQSQ-----------------------EYIRENLVNIEINYSDLNYKITQQQKAVSVPELLADVGGQLGLFCGASLITIIEIIEYL 467          
BLAST of acid-sensing ion channel 5 vs. UniProt/SwissProt
Match: sp|P24585|DEG1_CAEEL (Degenerin deg-1 OS=Caenorhabditis elegans OX=6239 GN=deg-1 PE=1 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 4.847e-7
Identity = 32/102 (31.37%), Postives = 53/102 (51.96%), Query Frame = 3
Query: 1347 FKSGRYDLMDL---------EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRVKIFRKR 1625
            + SG  DL D          ++   N  M+++       ++++E+E Y    L+ D GG +GLWLG S+ITV EV  LL D++  +F  + +E  ++   KR
Sbjct:  653 WPSGATDLGDCDGMTESECEQYYRLNAAMIEVFYEQLNYELLQESEAYGLVNLIADFGGHLGLWLGFSVITVMEVCVLLVDMISLFFKSRHEEKLLRQSTKR 754          
BLAST of acid-sensing ion channel 5 vs. UniProt/SwissProt
Match: sp|Q9JHS6|ASIC4_RAT (Acid-sensing ion channel 4 OS=Rattus norvegicus OX=10116 GN=Asic4 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.574e-6
Identity = 48/216 (22.22%), Postives = 82/216 (37.96%), Query Frame = 3
Query:  906 QNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLD-DCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFD 1550
            Q  S Y   S C  +  +EAV + C C+   M             + + PP +   C D     L  GS   C+    C  T Y   IS                   +V+I  R          ++ A K+++ +                        ++  NF+++ +   +   + +E+   Y  S LLGD+GG +GL++GAS++T+ E+ D
Sbjct:  308 QGYSAY-SVSACRLRCEKEAVLQRCHCRMVHMPG----------NETICPPNIYIECADHTLDSLGGGSEGPCFCPTPCNLTRYGKEIS-------------------MVKIPNR-------GSARYLARKYNRNET-----------------------YIRENFLVLDVFFEALTSEAMEQRAAYGLSALLGDLGGQMGLFIGASILTLLEILD 463          
BLAST of acid-sensing ion channel 5 vs. UniProt/SwissProt
Match: sp|Q62962|ASIC2_RAT (Acid-sensing ion channel 2 OS=Rattus norvegicus OX=10116 GN=Asic2 PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 1.672e-6
Identity = 56/239 (23.43%), Postives = 97/239 (40.59%), Query Frame = 3
Query:  858 CRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYL-DDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            CR+ +    ++ V+     S+     DC  + + E    +C C+   M       + PFC      P  +  C + A G L     +YC     C  T Y   +S    P+    KT+ ++++                  KFN                     KS +Y       +  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GASL+T+ E+FD + +L++
Sbjct:  289 CRSSEMGLDFFPVY-----SITACRIDCETRYIVE----NCNCRMVHMPG-----DAPFCT-----PEQHKECAEPALGLLAEKDSNYCLCRTPCNLTRYNKELSMVKIPS----KTSAKYLEK-----------------KFN---------------------KSEKY-------ISENILVLDIFFEALNYETIEQKKAYEVAALLGDIGGQMGLFIGASLLTILELFDYIYELIK 459          
BLAST of acid-sensing ion channel 5 vs. TrEMBL
Match: A0A0R3SIE1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4705 PE=3 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 1.994e-126
Identity = 205/498 (41.16%), Postives = 305/498 (61.24%), Query Frame = 3
Query:  102 LNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYIQFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRF------ESSAGNKYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNG-SLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRE-TEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            L F +RST+HGLN LA  ++ Q+R FW+ I ++A +G   N ++LI+K+++ PVLTNVL D   F+YPDV+FC  NPIYFPP ++   + ++A  +K+ +FKK     +  +++ AD+L++ RN  Y HP W  +VEC+Y    CS++    + L+ YGACYTFN ++       E    N++     +   I+YKA+D+P     DP  ++ +PSGILLMIH+  T+P +  S I+DE +Q+ L++   +HL     C   +    Y +    ++ +     SDC+   VQ A+A++C CQ   M V+  Y NLPFC        LNFS +++ + +++N     +C+ D CEH T + V+  + FPA+ +R T   W++ L  +E RE  ++ G SD+   AL  D   N NLTI +I   F SG   L++L+FV RNFMM++IVP S FMD +EETE YPFSRLL DIGG VGLW+GASLIT+FE  DL+ D ++
Sbjct:   80 LRFSRRSTMHGLNHLAQARTAQRRLFWLCISIAALVGFFFNMFFLIEKYIQVPVLTNVLHDSDNFIYPDVTFCNINPIYFPPKETAEFKRMIAAIEKFKKFKKSTHPHVH-RLELADYLFVERNTFYVHPKWLTIVECQYMQTPCSYKHFDEKILWPYGACYTFNATKMLNNMTREIITRNRFNRFRPDFKIIVYKALDMPEEYRMDPHGSVNVPSGILLMIHEPGTYPHIGHSSIVDECAQIELRMTYVKHLAKLGKCVPEREHISYVNTATNESQNFLSSQSDCLDAAVQTALAENCGCQMHTMPVMYRYNNLPFCFSD----SLNFSFIESCFSNVSNAVDRQHCFRDVCEHFTIDRVVVHAKFPAIAERHTYQNWLRLLARLEEREKAQYRGKSDIAKLALNADFTANPNLTIKDI---FASGNTSLLNLDFVNRNFMMLRIVPASLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFEFADLILDFMD 569          
BLAST of acid-sensing ion channel 5 vs. TrEMBL
Match: A0A564Z6I1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS12764 PE=3 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 2.315e-126
Identity = 205/498 (41.16%), Postives = 305/498 (61.24%), Query Frame = 3
Query:  102 LNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYIQFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRF------ESSAGNKYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNG-SLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRE-TEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            L F +RST+HGLN LA  ++ Q+R FW+ I ++A +G   N ++LI+K+++ PVLTNVL D   F+YPDV+FC  NPIYFPP ++   + ++A  +K+ +FKK     +  +++ AD+L++ RN  Y HP W  +VEC+Y    CS++    + L+ YGACYTFN ++       E    N++     +   I+YKA+D+P     DP  ++ +PSGILLMIH+  T+P +  S I+DE +Q+ L++   +HL     C   +    Y +    ++ +     SDC+   VQ A+A++C CQ   M V+  Y NLPFC        LNFS +++ + +++N     +C+ D CEH T + V+  + FPA+ +R T   W++ L  +E RE  ++ G SD+   AL  D   N NLTI +I   F SG   L++L+FV RNFMM++IVP S FMD +EETE YPFSRLL DIGG VGLW+GASLIT+FE  DL+ D ++
Sbjct:   80 LRFSRRSTMHGLNHLAQARTAQRRLFWLCISIAALVGFFFNMFFLIEKYIQVPVLTNVLHDSDNFIYPDVTFCNINPIYFPPKETAEFKRMIAAIEKFKKFKKSTHPHVH-RLELADYLFVERNTFYVHPKWLTIVECQYMQTPCSYKHFDEKILWPYGACYTFNATKMLNNMTREIITRNRFNRFRPDFKIIVYKALDMPEEYRMDPHGSVNVPSGILLMIHEPGTYPHIGHSSIVDECAQIELRMTYVKHLAKLGKCVPEREHISYVNTATNESQNFLSSQSDCLDAAVQTALAENCGCQMHTMPVMYRYNNLPFCFSD----SLNFSFIESCFSNVSNAVDRQHCFRDVCEHFTIDRVVVHAKFPAIAERHTYQNWLRLLARLEEREKAQYRGKSDIAKLALNADFTANPNLTIKDI---FASGNTSLLNLDFVNRNFMMLRIVPASLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFEFADLILDFMD 569          
BLAST of acid-sensing ion channel 5 vs. TrEMBL
Match: A0A183SCX1 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS2069 PE=3 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 8.896e-122
Identity = 201/488 (41.19%), Postives = 294/488 (60.25%), Query Frame = 3
Query:  102 LNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYIQFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRF------ESSAGNKYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFY-GFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEV 1544
            L F +RST+HGLN LA  ++ Q+R FW+ I L++S G   N ++L++K+++ PVLTNVL D   F++PDV+FC  NPIYFPP  +P    I      +  FK+  SN    ++  AD+L++ RN  Y HP W  +VEC Y    CS +    + ++ YGACYTFN +R       E S   +Y     +L  I+YKA++ P     DP D+  +P G+LLMIH+  T+P +  S I+DE +QV LK+ +  HL     C  ++++  Y +V   ++ +     SDC+   VQ A+AK+C CQ   M ++  Y++ PFC    + P    +C + A   ++     +C+LD CEH T + VI+ + FPA+ DR T   W++ L ++E RE + Y G SDL   ALK   +   N+T+A    A K  + DL++++FV RNFMM+++VP S FMD +EETE YPFSRLL DIGG VGLW+GASLIT+FE+
Sbjct:   78 LRFSRRSTMHGLNHLAQARTAQRRLFWLCISLASSFGFFFNLFFLMEKYIQVPVLTNVLHDSDNFIFPDVTFCNVNPIYFPPNGTPEFERIKENIHAFEDFKRS-SNPFAKRLALADYLFIKRNTYYVHPKWLTIVECSYMQTPCSSEHFDEKIIWPYGACYTFNATRMPHNMSREISTRTRYNRFRPDLRIIVYKALEFPEGYRFDPHDSFQVPPGVLLMIHEPGTYPHIGHSGIVDECTQVELKMTSVTHLAKLGKCIPMRSRIAYVNVASNESQTFLSSQSDCLDAEVQSALAKYCGCQMHTMPIMYEYHHQPFCFSGALEPSFLETCFNKATASVDR---KHCFLDVCEHYTIDRVIAHTKFPAVEDRHTEQHWLQLLADLEDRELKQYSGRSDLAKMALK--DVPGGNITLAE---AAKKRQIDLLNIDFVNRNFMMLRVVPDSLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFEL 556          
BLAST of acid-sensing ion channel 5 vs. TrEMBL
Match: A0A3P7LUS4 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS5772 PE=3 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 7.719e-120
Identity = 200/488 (40.98%), Postives = 292/488 (59.84%), Query Frame = 3
Query:  102 LNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYIQFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRF------ESSAGNKYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGF-SDLKFNALK-WDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFE 1541
            L F +RST+HGLN LA  ++ Q+R FW+ I L++S G   N ++L++K+L+ PVLTNVL D   F++PDV+FC  NPI+FPP  +P    I    +++  FK+ P+ F   ++  AD+L++ RN  Y HP W  +VEC Y    CS +    + ++ YGACYTFN +R       E S   +Y     +L  I+YKA++ P     DP D+  +P G+LLMIH+  T+P +  S I+DE +QV LK+ +  HL     C  ++++  Y +V   ++ +     SDC+   VQ A+AK+C CQ   M ++  Y+  PFC    + P    +C + A   ++     +C+LD CEH T + VI+ + FPA+ DR T + W++ L  +E RE   YG  SDL   ALK   +    N T+A    A    + DL++++FV RNFMM+++VP S FMD +EETE YPFSRLL DIGG VGLW+GASLIT+FE
Sbjct:   74 LRFSRRSTMHGLNHLAQARTAQRRLFWLCISLASSFGFFFNLFFLMEKYLQMPVLTNVLHDSDNFIFPDVTFCNVNPIHFPPNGTPEFERIKENIREFEDFKRGPNPFAQ-RLALADYLFIKRNTYYVHPKWLTIVECSYMQTPCSSEHFDEKIIWPYGACYTFNATRMPHNMTREISTRTRYNRFRPDLRVIVYKALEFPEGYRFDPHDSFQVPPGVLLMIHEPGTYPHIGHSGIVDECTQVELKMTSVTHLAKLGKCIPIRSRISYVNVAKNESQTFLSSQSDCLDAEVQSALAKYCGCQMHTMPIMYEYHYQPFCFSGALDPTFLENCFNNATASVDR---KHCFLDVCEHYTIDQVIAHTKFPAIEDRHTELHWLQLLARLEARERNHYGGKSDLAKLALKNASRDGGGNWTLAE---AVNQRQIDLLNIDFVNRNFMMLRVVPASLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFE 554          
BLAST of acid-sensing ion channel 5 vs. TrEMBL
Match: A0A0R3TJX9 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7422 PE=3 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 2.212e-115
Identity = 199/499 (39.88%), Postives = 299/499 (59.92%), Query Frame = 3
Query:  102 LNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYIQFKKYPSNFLTV-KIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRF------ESSAGNKYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNG-SLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRE-TEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            L F +RST+HGLN L+  ++ Q+R FW+ I ++A  G   N ++L++K+++ PVLTNVL D   F+YPDV+FC  NPIYFPP  +     + +  +K+ +FK+  SN   V +++ AD+L++ RN  Y HP W  +VEC+Y    CS++    + L+ YGACYTFN ++       E    N++     +   I+YKA+D+P     DP  ++ +PSG+LLMIH+  T+P +  S I+DE +Q+ L++   +HL     C   +    Y +    ++        DC+   VQ A+A++C CQ   M V+  Y++LPFC        LNF+ ++  + ++ N     +C+ D CEH T + V++ + FPA+ +R T   W+  L  +E RE  ++ G SD+   AL  D   N NLTI  + V   SG   L++L+FV RNFMM++IVP S FMD +EETE YPFSRLL DIGG VGLW+GASLIT+FE  DL+ D ++
Sbjct:   82 LRFSRRSTMHGLNHLSQARTAQRRLFWLCISIAALFGFFFNMFFLVEKYVQVPVLTNVLHDSDNFIYPDVTFCTINPIYFPPEGTTEFERMSSAIEKFKEFKR--SNHPHVHRLELADYLFVERNTYYVHPKWLTIVECQYMQTPCSYKHFDEKILWPYGACYTFNATKMLNNMTREIITRNRFNRFRPDFKIIVYKALDMPEKFRMDPHGSVNVPSGVLLMIHEPGTYPHIGHSSIVDECTQIELRMTYVKHLAKLGKCVPEREYISYVNTATNKSQIFLSSQPDCLDAAVQTALAENCGCQMHTMPVMYKYHHLPFCFSDA----LNFTFIENCFSNVANTVDRKHCFRDVCEHFTIDRVVAHAKFPAIEERHTYYNWLHLLARLEEREEAQYKGKSDIAKLALNADFTVNPNLTIKEVLV---SGNTSLLNLDFVNRNFMMLRIVPASLFMDRVEETEEYPFSRLLSDIGGCVGLWIGASLITLFEFADLILDCVD 571          
BLAST of acid-sensing ion channel 5 vs. Ensembl Cavefish
Match: asic4a (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103040152])

HSP 1 Score: 56.225 bits (134), Expect = 9.480e-8
Identity = 55/239 (23.01%), Postives = 98/239 (41.00%), Query Frame = 3
Query:  903 KQNISVYGKYS--DCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLD-DCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYF--AIKQKEDR 1604
            +Q I  Y  YS   C      +AV + CQC+   M             D + PP     C+D A   L   S D C  +  C  T Y   +S                   +V+I ++          ++ + K+ K ++                       ++  NF+++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++TV E+ D + ++++     A+K ++D+
Sbjct:  302 EQLIPGYDTYSISACRLHCETQAVQQECQCRMVHMPG----------TDDICPPN-KIKCVDRALALLQKSSGDSCPCETPCNLTRYGKELS-------------------MVKIPSK-------GSARYLSRKYHKSED-----------------------YIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASILTVLEILDYIYEVVKRRLQRALKPQKDQ 480          
BLAST of acid-sensing ion channel 5 vs. Ensembl Cavefish
Match: asic4b (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103044180])

HSP 1 Score: 52.7582 bits (125), Expect = 1.031e-6
Identity = 21/64 (32.81%), Postives = 44/64 (68.75%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            +++  NF+++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+ D + ++++
Sbjct:  408 DYIRDNFLILDIYFEALNYETIEQKKAYDIAGLLGDIGGQMGLFIGASILTILEILDYIYEVIK 471          
BLAST of acid-sensing ion channel 5 vs. Ensembl Cavefish
Match: asic1c (acid-sensing ion channel 1C-like [Source:NCBI gene;Acc:103034544])

HSP 1 Score: 52.7582 bits (125), Expect = 1.072e-6
Identity = 27/79 (34.18%), Postives = 47/79 (59.49%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLL----SDLLETYFAIKQKEDR 1604
            +++  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+FD L     D +  YF  K +  R
Sbjct:  399 QYIGDNILVLDIFFEALNYEKIEQKKAYEVAGLLGDIGGQMGLFIGASVLTILEIFDYLYEVFKDKVLGYFLRKGRPRR 477          
BLAST of acid-sensing ion channel 5 vs. Ensembl Cavefish
Match: asic1c (acid-sensing ion channel 1C-like [Source:NCBI gene;Acc:103034544])

HSP 1 Score: 52.7582 bits (125), Expect = 1.076e-6
Identity = 27/79 (34.18%), Postives = 47/79 (59.49%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLL----SDLLETYFAIKQKEDR 1604
            +++  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+FD L     D +  YF  K +  R
Sbjct:  399 QYIGDNILVLDIFFEALNYEKIEQKKAYEVAGLLGDIGGQMGLFIGASVLTILEIFDYLYEVFKDKVLGYFLRKGRPRR 477          
BLAST of acid-sensing ion channel 5 vs. Ensembl Cavefish
Match: ENSAMXT00000038299.1 (acid-sensing ion channel 1 [Source:NCBI gene;Acc:103026179])

HSP 1 Score: 52.7582 bits (125), Expect = 1.157e-6
Identity = 22/64 (34.38%), Postives = 44/64 (68.75%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            +++  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+FD L ++++
Sbjct:  404 QYISDNILVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTILELFDYLYEVIK 467          
BLAST of acid-sensing ion channel 5 vs. Ensembl Sea Lamprey
Match: asic1a (acid-sensing (proton-gated) ion channel 1a [Source:NCBI gene;Acc:791696])

HSP 1 Score: 75.0998 bits (183), Expect = 2.311e-14
Identity = 107/512 (20.90%), Postives = 194/512 (37.89%), Query Frame = 3
Query:   81 QKYINITLNFCQRSTIHGLNQLAFPKSVQ-QRYFWIFICLSASIGMVINNYYLIDK---FLERPVLTNV-LQDHTAFVYPDVSFCFTNPIY---FPPAKSPYRRFIMAQYKKYIQFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCS---FQDLILRHLFAYGACYTFNYSRFESSAGNKYRYG-NKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQE-SYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDD-CEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIV-PTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            Q   +    F   ST+HG+N +  P     +R  W    L AS+GM +  Y   D+   +LE   +T +  Q+    ++P ++ C  N        P    Y   I+                L    +++ + +  R     H +  +L+ CRY+D +C    F  +  R    YG CY FN  +         + G    L+ ++    D  +  +G+  D I + +G+ + IH ++  P + +  + +    Q  +    ++ + +       K   I  D F   +I+       C        V ++C C+   M       + P+C      P     C D A   L     +YC  D  C  T Y   +S    P+                           +  K+ A K++K ++                       ++  N +++ I    +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+FD L ++L+
Sbjct:   42 QPQASAITEFASESTLHGINHIFAPGEFSLRRAIWACAFL-ASLGMFL--YQSADRIVFYLEHHHVTQLDEQESHLMLFPAITLCNFNSFRRSKVTPVDKHYAGPILGIPDNDPDLATVDVRLLRAWSRYSTYEFYDRAG---HTMDEMLLRCRYRDRECGPTNFTTVFTR----YGKCYMFNSGKGGRPLLTTLKGGTGNGLEMMLDIQQDEYLPVWGET-DEISLEAGVKVQIHSQDEPPFVHQLGFGVAPGFQTFVSCQEQRLIYLPSPWGDCKADPINSDFFDTYSITA------CRIDCETRYVVENCNCRMVHMPG-----DAPYCT-----PEQYKECADPALDFLVEKDNNYCVCDTPCNTTRYGKELSMVKIPSK--------------------------ASAKYLAKKYNKTED-----------------------YIRENVLVLDIFFEAALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTILEIFDYLYEVLK 477          
BLAST of acid-sensing ion channel 5 vs. Ensembl Sea Lamprey
Match: asic1b (acid-sensing (proton-gated) ion channel 1b [Source:NCBI gene;Acc:407672])

HSP 1 Score: 49.6766 bits (117), Expect = 1.890e-6
Identity = 27/78 (34.62%), Postives = 48/78 (61.54%), Query Frame = 3
Query: 1383 FVERNFMMVKIVPTSFFMDMIEETEGYPFSRLL--GDIGGSVGLWLGASLITVFEVFD----LLSDLLETYFAIKQKE 1598
            ++  N +++ I   +   + IE+ + Y  + LL  GDIGG +GL++GAS++T+ E+FD    L+ D +  YF  K+K+
Sbjct:  404 YIAENVLVLDIFFEALNYETIEQKKAYEVAGLLETGDIGGQMGLFIGASILTILEIFDYVYELIRDKILFYFRAKKKQ 481          
BLAST of acid-sensing ion channel 5 vs. Ensembl Nematostella
Match: EDO41313 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4N0])

HSP 1 Score: 77.0258 bits (188), Expect = 6.703e-15
Identity = 111/506 (21.94%), Postives = 194/506 (38.34%), Query Frame = 3
Query:  120 STIHGLNQLAFPKSVQQRYFW---IFICLSASIGMVINNYYLIDKFLERPV-LTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYIQFKKYPS------NFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRFESSAGNKYRYGNKELDFIIYKAVDIPIANFGD-PFDNIMMPSGILLMIHDRNTWPKLQ-ESYILDEYSQVNLKI-------INKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSD--CVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDH-------VVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDL 1553
            +T+HG + L    SV +R  W   I I L   +  ++N    I  + +R + ++  +++     +P V+ C  N +     KS     I    ++Y+    Y        N    ++   DF+       Y H L  ++  C ++D +C+ QD I       G CYTFN  R  SS       G   L+ +I +    P   +G   ++N+    G +L +HD+   P ++  +Y +      NL+I       I   H  I    R  K    Y      +N+S+Y +YS   C+ +     +  HC C+   M  +      PFC          ++P  L  S  D                  C+H  Y    S +H+P+    K+ I+ +                            + + N+T  N +             E +     ++++   +   ++I+E   Y  + L  D+GGS+GL+LG S++T+ E  DL
Sbjct:    8 TTLHGFHFLVDSYSVTRRVVWTCFIVISLGFLLYQLVNG---IKNYNDRGIIMSRSVEEPNEVDFPAVTICNQNIM----KKS---LIIGTDAQRYLDEMNYIKADLGLVNSTNERLDAEDFV-----RKYGHTLGEMMYGCEFKDRRCTAQDFIPLPFLQRGLCYTFNSGRDNSSVRRIATPG--RLESLILRLNAQPEEYYGAYSYENV----GFVLAVHDQAEPPDMELNAYDIPPGFTTNLRIRRFKVDDIRVYHQAINPAIRRYKP---YPTKCGSRNLSLYKRYSRKACMQECYARLIITHCGCRLLGMPPM----KAPFCTSKEYLDCQLMMPVLLKPSKCDCP--------------KRCQHIHYSVQPSLAHYPS----KSVIKEL----------------------------LPSLNMTEVNSTT------------ERINEVNRIIRVFYETLRTEIIKEKPQYTLATLTSDMGGSMGLFLGCSVLTICEFIDL 427          
BLAST of acid-sensing ion channel 5 vs. Ensembl Nematostella
Match: EDO49452 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGQ6])

HSP 1 Score: 71.633 bits (174), Expect = 3.942e-13
Identity = 111/524 (21.18%), Postives = 208/524 (39.69%), Query Frame = 3
Query:  105 NFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFV-YPDVSFCFTN--PIYF------PPAKSPYRRFIMAQYKKYIQFKKY--PSNF--LTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRFESSAGNKYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLN-----IGKTCRTVKNKFIYYDVFIKQNISVYGKY--SDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGD--LNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRVK 1610
            +F    T+HG   +       ++  W+ I L A   +++ +   I K+ + P+ T+V  +    + +P V+ C  N  P Y          K+     I+  + + +  + +    +F  L  K  FA+F+      T+ H +  ++ +CR++   C  ++     +  +G CYTFN            R G   +D+ +   + +    +   + ++   SG  +M+HD+   P + E  I  +        + K+ ++         CR ++             +  + KY  S C+ +   + V K C+C+  +++  +     P C      PR   +C+  A G       ++  C +  CE T Y+T +S +  PA           KH  E+  R                                  K    D+M   ++  NF+ + +      + +I++ + Y    L GDIGG VGL+LGAS++TV E  DLL  +L   F  K+K  +V+
Sbjct:    4 DFLHTLTLHGFRFVFERGPTIRKVLWLAILLFAVGMLMMQSKKSIQKYFDHPITTSVQVEFLEEIQFPAVTICNFNLFPYYLINGTIGEKVKTAPNLLILFFFSRPLLSESFFFEKDFGELDEKFDFAEFV-----RTHGHRIDHMIKKCRWKSQPCGPENFTAV-ITEFGLCYTFNSGMKGHPLLKVQRAG---VDYALRLQLSVQQDQY---YGSLRDSSGFKVMVHDQEEPPLINELGIAIQPGTHTFCGLRKEEMHNLPAPFKTACRDMQ-------------LEGFKKYTKSACLLKCRADYVMKMCKCRSYDLKGPA-----PPC-----QPREVKNCVWPAMGTCMFKQMTVQVCPVP-CEITKYQTQLSYAQTPA-----------KHFSEVLARR---------------------------------KHINKDVMR-HYLRDNFLELDVYFEEMQVTLIQQRQAYDQESLFGDIGGQVGLFLGASILTVLEFLDLLWRILIHKFK-KRKNRKVR 445          
BLAST of acid-sensing ion channel 5 vs. Ensembl Nematostella
Match: EDO39877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S3])

HSP 1 Score: 62.7734 bits (151), Expect = 2.533e-10
Identity = 74/311 (23.79%), Postives = 126/311 (40.51%), Query Frame = 3
Query:  105 NFCQRSTIHGLNQLAFPKSVQQRYFWI----------FICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYI-QFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHL-FAYGACYTFNYSRFESSAGNKYRYGNK-ELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQE-SYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKY--SDCVYQNVQEAVAKHCQCQ 989
            NF   +T+HG + L     + +R  W           FI L  S G +     ++ K +ERP+  NVL       YP V+ C  N +     KS   R      ++Y+ Q     ++   V      F        Y H +  +L EC + +  CS +D  +R+  ++ G CYTFN     S  G     G +  L   +    D     +  PF      +G  L +HD+N  P + E ++ +      N++I  ++ +N+    R+             +++S   KY  S C+Y+   + +A  C+C+
Sbjct:   34 NFSSYTTLHGFHFLLDSSPMPRRVLWTALVGFGLVVFFIQLVMSYGKLRARESILAKGVERPM--NVL-------YPAVTICNQNMM----RKS---RITGTAAQRYLDQLDHIKASLSRVNRTNERFETEEMVRLYGHNITDMLWECNFMNKPCSHKDFAMRYTSYSRGLCYTFNAGANGSPIGQATTSGTRTSLSLRLNAESD----EYYGPFS--YDATGFKLAVHDQNEIPNMDEDAFDISPGFLTNIRIRREKEINLPSPYRSECG---------SRDLSNAPKYSMSGCIYECYSKIIADKCKCR 313          
BLAST of acid-sensing ion channel 5 vs. Ensembl Nematostella
Match: EDO39413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA77])

HSP 1 Score: 58.5362 bits (140), Expect = 5.654e-9
Identity = 56/227 (24.67%), Postives = 94/227 (41.41%), Query Frame = 3
Query:  930 YSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRVK 1610
            Y +C+ +   + +   C+C+   M  L      P+C    V       C+   +   +    D C +  CE TT+ + IS ++FP+    +T + ++          T  Y   DL    L  D++                   D+    FV + F MVKI   +   +M  +   Y  S L  D+GG++GL+LG S++T+ E  DL   LL T F  ++  D  +
Sbjct:  331 YKNCIRECHTQLMIGRCRCRAIGM-TLQENDTTPYCTTREVQ-----DCIMRVHERSSRQRCD-CPVP-CEMTTFTSRISLAYFPSQHVWETFLPFL----------TTAY---DLNLTGLSPDEL-------------------DMKAEHFVRKRFAMVKIFYETLRTEMYHQRPAYEMSDLFADVGGNMGLFLGCSMLTIAEFIDLAIMLLITKFWRRRTVDHAQ 517          
BLAST of acid-sensing ion channel 5 vs. Ensembl Nematostella
Match: EDO48658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI84])

HSP 1 Score: 56.9954 bits (136), Expect = 5.665e-9
Identity = 51/220 (23.18%), Postives = 96/220 (43.64%), Query Frame = 3
Query:  906 QNISVYGKYS--DCVYQNVQEAVAKHCQCQ-WQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLL 1556
            + + +Y KYS  +C  +++ + + + C+C+ W    V++               +    C+  A+ D +N + +Y    DCE   Y+T +S + F            +   +   T++ +F          ++   I N              G  D     F+  N+ ++ +      +D I++T  Y F RL+GD+GG +GL LGAS+IT+ E+ DL+
Sbjct:   39 RGLDLYPKYSRNNCYMESLTKYILQQCKCRAWFMADVINT---------STCSIKEALDCMWPAWEDFDN-AYNYTCPVDCEERVYKTRLSSALF------------LPQKLLPLTKKYKFL---------MRPKGIPNDT-----------EGAVD-----FILENYSVINLFFDELRLDTIQQTPAYGFFRLVGDVGGQLGLVLGASVITIVEIIDLV 211          
BLAST of acid-sensing ion channel 5 vs. Ensembl Medaka
Match: asic4a (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:101159336])

HSP 1 Score: 57.7658 bits (138), Expect = 2.790e-8
Identity = 65/288 (22.57%), Postives = 112/288 (38.89%), Query Frame = 3
Query:  858 CR-TVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLD-DCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFA--IKQKEDRVKIFRKRLATNHEITSESFLPKTLDEKSDFHQSNV 1709
            CR T K KF  YD +           S C        V + C+C+   M         P   D + PP    SC+D A   L   S D C  +  C  T Y   +S    P+    K + +++                        K+DK ++                       ++  NF+++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++TV E+ D + +++       ++ +++  K  +  +AT   ++ E    K  ++ S  HQ   
Sbjct:  294 CRSTSKEKFPGYDTY---------SISACRLLCETNEVLRVCKCRMVHM---------PGTAD-ICPPS-KISCVDKALAQLQKNSGDTCPCETPCNLTRYGKELSMVKIPS----KGSARYLSR----------------------KYDKSED-----------------------YIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASILTVLEILDYVFEVIRHRLQRLLRPQKEEKKQPKSAVAT---VSLEEMKAKEPNDTSRSHQEGA 509          
BLAST of acid-sensing ion channel 5 vs. Ensembl Medaka
Match: ENSORLT00000031246.1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 54.6842 bits (130), Expect = 2.813e-7
Identity = 24/64 (37.50%), Postives = 44/64 (68.75%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            +++  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++TV E+FD L ++L+
Sbjct:  397 QYIADNILVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTVLELFDYLYEILK 460          
BLAST of acid-sensing ion channel 5 vs. Ensembl Medaka
Match: ENSORLT00000021925.2 (acid-sensing ion channel 1C [Source:NCBI gene;Acc:101174951])

HSP 1 Score: 54.299 bits (129), Expect = 3.826e-7
Identity = 27/79 (34.18%), Postives = 48/79 (60.76%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLL----SDLLETYFAIKQKEDR 1604
            +++  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++T+ E+FD L     D +  YF  K++  R
Sbjct:  396 QYIGDNILVLDIFFEALNYEKIEQKKAYEIAGLLGDIGGQMGLFIGASVLTILEIFDYLYEVFKDKVLGYFLRKKRPQR 474          
BLAST of acid-sensing ion channel 5 vs. Ensembl Medaka
Match: ENSORLT00000008662.2 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 54.299 bits (129), Expect = 3.988e-7
Identity = 24/64 (37.50%), Postives = 44/64 (68.75%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            +++  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++TV E+FD L ++L+
Sbjct:  414 QYIADNILVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTVLELFDYLYEILK 477          
BLAST of acid-sensing ion channel 5 vs. Ensembl Medaka
Match: ENSORLT00000031708.1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 53.9138 bits (128), Expect = 4.136e-7
Identity = 24/64 (37.50%), Postives = 44/64 (68.75%), Query Frame = 3
Query: 1380 EFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLE 1571
            +++  N +++ I   +   + IE+ + Y  + LLGDIGG +GL++GAS++TV E+FD L ++L+
Sbjct:  431 QYIADNILVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASILTVLELFDYLYEILK 494          
BLAST of acid-sensing ion channel 5 vs. Planmine SMEST
Match: SMESG000072895.1 (SMESG000072895.1)

HSP 1 Score: 1179.47 bits (3050), Expect = 0.000e+0
Identity = 563/566 (99.47%), Postives = 564/566 (99.65%), Query Frame = 3
Query:   12 MHSSECAPNILPKSSFLGKSWRTQKYINITLNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYIQFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRFESSAGNKYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRVKIFRKRLATNHEITSESFLPKTLDEKSDFHQSNV 1709
            MHSSECAPNILPKSSFLGKSWRTQKYINITLNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYR FIMAQYKKYIQFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSF DLILRHLFAYGACYTFNYSRFESSAGNKYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDL+ETYFAIKQKEDRVKIFRKRLATNHEITSESFLPKTLDEKSDFHQSNV
Sbjct:    1 MHSSECAPNILPKSSFLGKSWRTQKYINITLNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRSFIMAQYKKYIQFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFHDLILRHLFAYGACYTFNYSRFESSAGNKYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLIETYFAIKQKEDRVKIFRKRLATNHEITSESFLPKTLDEKSDFHQSNV 566          
BLAST of acid-sensing ion channel 5 vs. Planmine SMEST
Match: SMESG000028094.1 (SMESG000028094.1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 278/504 (55.16%), Postives = 365/504 (72.42%), Query Frame = 3
Query:   69 SWRTQKYINITLNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYIQFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRFESSAGN--KYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLET 1574
            S+RT   ++I L FC++STIHGLN +A  KSV QR FW+ IC SAS+G+ IN YYLI+KF+ERPVLTN+LQDH  F YPD+SFCF NPIYFPP  + +  F+M +Y++Y  +      F    IKF +FL+M +N TYTHP W  ++ C Y  L CS  + I R+LF +GACYTFN +  E+S     ++   N+EL+ II+KAVDI      DPF++++MPSG+L MIHD+ TWP+++ESY+LD YSQ++LKIINK HLNIG  CR +KNKF YYDVF+K N SVYGKYSDCV+QNVQ+ V+++C+CQW +MQ LS ++NLPFC+D  +      +C+  AY  L+ G LD CY+DDCEHTTYETVISQS FPA+++RKT  +W+K L ++E +E E +G SDL   +LK     + N    N+S A  +  + L+D EFVERNFMM+K++PTS F+D +EETE YP SRLL DIGG VGLW+GASLIT+FE  DL  D +ET
Sbjct:   21 SYRT---LSIGLTFCRKSTIHGLNHVANSKSVCQRIFWLSICFSASVGLFINMYYLIEKFIERPVLTNILQDHAVFSYPDISFCFMNPIYFPPMNTSHFAFLMEKYQEYKHYVAVQEEFFKYHIKFGEFLFMKKNQTYTHPAWLAVISCNYLGLPCSHVNFIQRYLFPFGACYTFNSTSVEASDAQFRQHMTTNRELEIIIFKAVDIVPGTISDPFESVLMPSGMLFMIHDKETWPQVRESYVLDGYSQIDLKIINKVHLNIGNRCRPIKNKFSYYDVFMKTNTSVYGKYSDCVFQNVQQEVSRYCKCQWPKMQALSEFHNLPFCLDGHLSLIEFGNCVSKAYTILDGGILDECYMDDCEHTTYETVISQSKFPAMIERKTQQKWLKILADLEKKEIEHFGKSDLYLRSLK-----STNKYQVNLSEALNNKDWSLLDEEFVERNFMMIKVMPTSMFIDKVEETEEYPISRLLSDIGGCVGLWIGASLITIFEFLDLFMDFVET 516          
BLAST of acid-sensing ion channel 5 vs. Planmine SMEST
Match: SMESG000024270.1 (SMESG000024270.1)

HSP 1 Score: 444.891 bits (1143), Expect = 2.580e-148
Identity = 219/529 (41.40%), Postives = 331/529 (62.57%), Query Frame = 3
Query:   84 KYINITLNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYIQFKKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRFESSAGNKYR--YGNKEL----DFIIYKAVDIPIANFG-DPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRVKIFRKRLATNHEIT 1649
            +++NI L+FC RST HGL+Q+A  + ++QR FWI IC  AS+G +IN YYL+DK+LE P+LTNV+Q++  F++PD+S CFTNPIY+PP  S   + +M  Y+ Y+ +KK    F + ++  A++L+MT+ + Y H  W  +V C Y    CS++    RH++ +G C+TFN ++       K     G + +       +YKAVD+   NF  DPFD++ +P GIL+MIHD +T+P +  SYILD YSQ++L+I +KQHLN+   C+  +  + Y D+F  ++ +   K  DCVY  +Q  V K+CQC WQ    +    +  +C+D          CL   + ++    L  CY D C+H  +E+VISQS FPA+ +R T+  W+K L ++E  E +++G S+L+  AL   K+ NA+ T   ++ A K  R DL+D EFV+RNFMM+++VP SFFMD +EET  YP SRLL D+GG VGLW+GASLIT+FE  DL+ D  +    +K+   R K   K+ + + +++
Sbjct:   14 RFLNIVLHFCHRSTFHGLSQIARARKIRQRVFWITICGGASLGFLINIYYLLDKYLETPILTNVIQNYQRFIFPDISICFTNPIYYPPKDSEAHKLLMDNYQNYLYYKKNMDPFFSNRVNLAEYLFMTKTDFYGHHAWGSIVSCSYMGHDCSYKHFETRHIYPFGVCHTFNSTKIMMKDIRKINSFSGMQSVKPFFQITVYKAVDMG-ENFNVDPFDDVTIPGGILVMIHDEHTFPFIGNSYILDAYSQIDLRITSKQHLNVNNRCKISQEFYTYMDLFENKSTAFSAKTEDCVYITIQINVMKNCQCIWQHFPTILVPPSTRYCLDGTFSVNHLKDCLRKTHAEITEEYLPKCYQDLCDHKVFESVISQSKFPAVTERGTHASWLKILADLERNEMKYFGQSELRTKAL---KMINAS-TRMTLNKAHKMQRIDLLDEEFVDRNFMMLRVVPNSFFMDKVEETMEYPISRLLSDVGGCVGLWVGASLITIFEFLDLIFDFFDVTVQLKKLRMREKNLIKQQSNSTQLS 537          
BLAST of acid-sensing ion channel 5 vs. Planmine SMEST
Match: SMESG000047581.1 (SMESG000047581.1)

HSP 1 Score: 408.297 bits (1048), Expect = 6.793e-133
Identity = 214/548 (39.05%), Postives = 323/548 (58.94%), Query Frame = 3
Query:   96 ITLNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYIQF-------KKYPSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRF---------ESSAGNKYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFSCLDTAYGDLNNGSL-DYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDL-KFNALKWDKIQNANLTIANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDLLETYFAIKQKEDRVKIFRKRLATNHEI----TSESFLPKT 1673
            + L+F +RSTIHGLN LA  +S + R FW+ I  SAS+G  +N +YLI+KFL+ PVLTNV  D   F YPD+S C  NPIYFPP  + YR  +++  ++Y +         K   N    KI+ +D+L+M     Y+HP WS ++ CRY   +C++     RH++ YG C+TFN ++          +++  N +R    +   +IYKA++ P+    DPF++I  PSG+L+MIH+ NT+P + ES+++D ++QV+LKI  K HL+  K C +++N + YYD     +    G+  DC++  +Q  +A +C CQ  +M +L  +  LPFC D          CL  +  D++   L   CY D CEH ++ TV+S S +PA+ +R+T++ W++HL ++E  E E YG S+L     LK +     N    +I   +  GR DL++ +F+ +NFM ++ VP+S FMD +EETE YP SRLL DIGG VGLW+GASLITVFE  DLL DL E    I +   +  +  K++  N +      S+S +P T
Sbjct:   56 VLLHFSRRSTIHGLNHLAQARSAKHRLFWLTISCSASLGFCVNLFYLIEKFLQTPVLTNVFHDFNNFTYPDLSICIVNPIYFPPENTRYRNELISTIEEYYRLTNSSFHDSKSSYNANLQKIELSDYLFMHSKLEYSHPSWSAIILCRYLKKKCNYTHFETRHIWPYGNCFTFNGTKMGLEGTRDVKKNTVLNGWR---PDFKLVIYKALEYPVNLQIDPFNDINKPSGVLVMIHEPNTYPHIGESFVVDSFTQVDLKITTKSHLSSLKKCESIRNNYTYYDFKTNTSNIFVGRQGDCLFSIIQTNIANYCGCQLHKMPILEKHKQLPFCYDKRFRNENLTYCLHASLDDVDREQLRQLCYKDLCEHPSFSTVVSHSKYPAVRERQTHMLWLEHLKDLELLEIEHYGQSELINMAILKSNSSLKHNY--KSIREIYDKGRIDLLNEKFINKNFMHLRFVPSSLFMDHVEETEEYPLSRLLSDIGGCVGLWVGASLITVFEFIDLLLDLSE----IIRYRSQATVVYKQMCRNQKSFILNNSKSLVPNT 594          
BLAST of acid-sensing ion channel 5 vs. Planmine SMEST
Match: SMESG000009914.1 (SMESG000009914.1)

HSP 1 Score: 393.66 bits (1010), Expect = 1.795e-127
Identity = 213/548 (38.87%), Postives = 322/548 (58.76%), Query Frame = 3
Query:   33 PNILPKSSFLGKSWRT----QKYINITLNFCQRSTIHGLNQLAFPKSVQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDVSFCFTNPIYFPPAKSPYRRFIMAQYKKYIQ-----FKKY-----PSNFLTVKIKFADFLYMTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRFESSAGNKYRYGNK------ELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRNTWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQNISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPRLNFS----CLDTAYGDLNNGSL-DYCYLDDCEHTTYETVISQSHFPALVDRKTNIQWMKHLVEIETRETEFYGFSDLKFNALKWDK---IQNANLT---------IANISVAFKSGRYDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLWLGASLITVFEVFDLLSDL 1565
            P   PK +F  +   T    ++   I L+F +RSTIHGLN LA  +S ++R FW+FI   A++G  +N +YL++KF++ P+LTN   D+T+F+YPD++FC  NPI FPP  S   ++++     YI+     F KY       +FL  K++  D+L++  N +Y+H  WS +V+CRY    CS++   +  ++ YG C+TFN ++ + +     +   +      +   IIYK+++   +   DPF++I  PSG+L+MIH+  T+P + +S+I+D Y+QV+LKI  K HL   K C   +  + Y D   K+  +  G+  DCV++ +Q  +AK+C+CQ   M VL      PFC   ++   LN S    CL+     ++  S+   CY D C H +Y TVIS S +PA+ DR+T+  W+K L+ IE RE E YG S+L   A+K +    ++N N             +I   ++  R DL+D  F+++NFM ++ VP+S FMD IEETE YP SRLL DIGG VGLW+GASLIT+FE FDLL DL
Sbjct:   10 PKRKPKKTFFQQKSPTIIIFKRLGTIFLHFTRRSTIHGLNHLAQARSAKRRLFWLFISTCATVGFFVNLFYLVEKFIQTPILTNTFHDYTSFIYPDITFCLVNPINFPPKTSAQYKYLIGIINNYIRNEESLFHKYINSSKNEDFLP-KLELMDYLFIKENISYSHSPWSAIVDCRYLHYPCSWEHFDVHFVWPYGNCFTFNATKMQKNLTRDVQRNMQLNGFRPDFRIIIYKSINRLSSVVHDPFNDITKPSGVLVMIHEIETYPHVSDSFIVDSYTQVDLKITTKSHLESLKKCNPNRQNYTYCDYRSKKCQTFQGRNIDCVFEIIQNKIAKNCKCQMHTMPVLMKNRFYPFCYSLMLSNPLNVSSIRKCLNQTIVGVDKQSIHSICYQDLCSHPSYSTVISHSKYPAIQDRQTHSLWLKKLIVIEKREIENYGISNLFQKAIKRNHSTLLRNPNFMENQIPIGKRFDSIDAVYRDMRDDLIDELFIDQNFMQLRFVPSSLFMDHIEETEEYPISRLLSDIGGCVGLWVGASLITIFEFFDLLMDL 556          
The following BLAST results are available for this feature:
BLAST of acid-sensing ion channel 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASIC31.870e-833.33acid sensing ion channel subunit 3 [Source:HGNC Sy... [more]
ASIC37.695e-835.14acid sensing ion channel subunit 3 [Source:HGNC Sy... [more]
ASIC27.983e-723.01acid sensing ion channel subunit 2 [Source:HGNC Sy... [more]
ASIC41.868e-621.76acid sensing ion channel subunit family member 4 [... [more]
ASIC12.395e-642.31acid sensing ion channel subunit 1 [Source:HGNC Sy... [more]
back to top
BLAST of acid-sensing ion channel 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
deg-13.811e-831.37Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
deg-13.811e-831.37Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
deg-13.811e-831.37Degenerin deg-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-1051.783e-627.55Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1051.783e-627.55Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
back to top
BLAST of acid-sensing ion channel 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of acid-sensing ion channel 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic1c7.570e-830.77acid-sensing (proton-gated) ion channel 1c [Source... [more]
asic4a2.116e-728.07acid-sensing (proton-gated) ion channel family mem... [more]
asic4a3.950e-732.22acid-sensing (proton-gated) ion channel family mem... [more]
asic1b4.975e-730.86acid-sensing (proton-gated) ion channel 1b [Source... [more]
asic1a5.179e-730.86acid-sensing (proton-gated) ion channel 1a [Source... [more]
back to top
BLAST of acid-sensing ion channel 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASIC42.044e-728.16acid sensing ion channel subunit family member 4 [... [more]
ASIC45.708e-733.33acid sensing ion channel subunit family member 4 [... [more]
ASIC12.481e-636.51acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
ASIC12.830e-636.51acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
ASIC12.956e-636.51acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
back to top
BLAST of acid-sensing ion channel 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Asic55.108e-1120.51acid-sensing (proton-gated) ion channel family mem... [more]
Asic51.668e-1020.51acid-sensing (proton-gated) ion channel family mem... [more]
Asic42.412e-722.22acid-sensing (proton-gated) ion channel family mem... [more]
Asic25.204e-723.01acid-sensing (proton-gated) ion channel 2 [Source:... [more]
Asic21.878e-623.01acid-sensing (proton-gated) ion channel 2 [Source:... [more]
back to top
BLAST of acid-sensing ion channel 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R0Y1|ASIC5_MOUSE3.573e-1020.51Acid-sensing ion channel 5 OS=Mus musculus OX=1009... [more]
sp|Q9R0W5|ASIC5_RAT1.655e-921.44Acid-sensing ion channel 5 OS=Rattus norvegicus OX... [more]
sp|P24585|DEG1_CAEEL4.847e-731.37Degenerin deg-1 OS=Caenorhabditis elegans OX=6239 ... [more]
sp|Q9JHS6|ASIC4_RAT1.574e-622.22Acid-sensing ion channel 4 OS=Rattus norvegicus OX... [more]
sp|Q62962|ASIC2_RAT1.672e-623.43Acid-sensing ion channel 2 OS=Rattus norvegicus OX... [more]
back to top
BLAST of acid-sensing ion channel 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SIE11.994e-12641.16Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564Z6I12.315e-12641.16Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A183SCX18.896e-12241.19Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A3P7LUS47.719e-12040.98Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A0R3TJX92.212e-11539.88Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of acid-sensing ion channel 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic4a9.480e-823.01acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
asic4b1.031e-632.81acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
asic1c1.072e-634.18acid-sensing ion channel 1C-like [Source:NCBI gene... [more]
asic1c1.076e-634.18acid-sensing ion channel 1C-like [Source:NCBI gene... [more]
ENSAMXT00000038299.11.157e-634.38acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of acid-sensing ion channel 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asic1a2.311e-1420.90acid-sensing (proton-gated) ion channel 1a [Source... [more]
asic1b1.890e-634.62acid-sensing (proton-gated) ion channel 1b [Source... [more]
back to top
BLAST of acid-sensing ion channel 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of acid-sensing ion channel 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO413136.703e-1521.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494523.942e-1321.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398772.533e-1023.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394135.654e-924.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486585.665e-923.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of acid-sensing ion channel 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic4a2.790e-822.57acid sensing ion channel subunit family member 4 [... [more]
ENSORLT00000031246.12.813e-737.50acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
ENSORLT00000021925.23.826e-734.18acid-sensing ion channel 1C [Source:NCBI gene;Acc:... [more]
ENSORLT00000008662.23.988e-737.50acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
ENSORLT00000031708.14.136e-737.50acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
back to top
BLAST of acid-sensing ion channel 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072895.10.000e+099.47SMESG000072895.1[more]
SMESG000028094.10.000e+055.16SMESG000028094.1[more]
SMESG000024270.12.580e-14841.40SMESG000024270.1[more]
SMESG000047581.16.793e-13339.05SMESG000047581.1[more]
SMESG000009914.11.795e-12738.87SMESG000009914.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012641 ID=SMED30012641|Name=acid-sensing ion channel 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2163bp
CATTTTGAAAAATGCATTCCTCTGAATGCGCGCCAAATATTCTGCCGAAG
TCCAGTTTCCTTGGAAAGTCATGGAGAACTCAAAAGTATATCAACATCAC
CTTGAATTTCTGCCAACGAAGTACGATTCACGGACTGAACCAACTGGCAT
TTCCAAAATCAGTTCAACAGAGATATTTCTGGATCTTTATCTGTTTGTCG
GCCTCAATTGGGATGGTTATCAACAATTATTATCTCATTGATAAGTTCCT
TGAGCGTCCAGTGCTCACCAATGTCTTACAGGACCACACGGCGTTCGTTT
ATCCCGACGTTTCGTTCTGTTTCACGAATCCCATTTACTTCCCTCCTGCC
AAATCTCCCTACCGGCGCTTCATCATGGCCCAATACAAGAAATACATTCA
ATTCAAAAAGTACCCGTCAAACTTCCTAACTGTGAAAATAAAGTTCGCGG
ATTTCCTCTACATGACTCGCAACAATACTTATACGCATCCTTTATGGTCA
GTTTTGGTCGAGTGCCGGTATCAAGACTTGCAGTGCAGCTTCCAGGATCT
GATACTGAGGCATTTGTTTGCTTACGGAGCATGCTATACGTTCAATTATT
CTCGGTTCGAATCGAGCGCAGGCAACAAGTACCGCTATGGAAACAAGGAA
CTGGATTTCATTATATACAAGGCCGTTGACATCCCAATTGCAAACTTTGG
GGACCCCTTTGACAATATCATGATGCCAAGCGGAATCTTGTTGATGATCC
ACGACAGAAATACCTGGCCCAAGCTCCAGGAGAGCTACATACTTGACGAG
TACAGCCAAGTCAATCTGAAAATCATCAACAAACAGCATTTGAATATCGG
AAAGACATGCCGGACAGTAAAGAATAAATTCATTTACTATGACGTATTCA
TCAAGCAGAATATCTCGGTTTATGGAAAGTACAGCGATTGCGTCTACCAA
AACGTACAGGAAGCCGTAGCTAAGCATTGTCAATGCCAGTGGCAGGAAAT
GCAAGTGTTGTCCCATTACTATAACCTTCCATTCTGTATAGATCATGTCG
TTCCGCCCCGACTGAACTTTTCCTGCTTGGACACCGCATATGGCGACCTC
AACAACGGCAGCCTTGATTATTGCTATCTCGATGACTGTGAGCACACTAC
ATATGAGACCGTGATTTCCCAGAGCCATTTCCCCGCGCTTGTCGACAGGA
AGACCAACATTCAATGGATGAAACATTTGGTCGAAATAGAAACCCGTGAA
ACTGAATTCTATGGGTTTTCTGATTTGAAGTTCAACGCGCTAAAATGGGA
CAAGATCCAGAACGCAAACTTAACAATCGCAAACATATCTGTGGCCTTTA
AAAGTGGAAGGTATGACTTGATGGACCTTGAATTTGTCGAGAGAAATTTC
ATGATGGTAAAAATTGTCCCAACCTCCTTTTTTATGGACATGATAGAAGA
AACAGAAGGTTATCCTTTCAGTCGACTTTTGGGAGATATTGGCGGTTCTG
TGGGCCTCTGGCTAGGAGCGAGTCTTATTACAGTCTTTGAGGTGTTTGAT
CTGTTATCCGATTTGCTTGAAACGTATTTTGCAATTAAACAAAAAGAAGA
CCGTGTCAAAATCTTCAGAAAACGATTAGCGACCAATCACGAAATAACTT
CAGAATCATTTTTACCCAAAACTCTCGATGAGAAATCAGATTTCCATCAA
TCAAATGTGTGAATGCTTTTTTCCGGCAGTTTTCATTTGTTTTTGGTAAT
TGCCATTGTATGATGTCCCTGCAATGTGTCCAGGTACTTCATCTTTACTT
TTGTTCTCTTTTAAATTCCCTTTGCTTACTTTTGTTTTTTCATTTTACCT
CACTGCTCTTTGAGCCCGCCCTGCGGTGAGAAAAAAGTCGCTTTCCACAG
AGAGATTTTCCACTGTTTTCAAAAGGGATCAAAATTGACTTGTTGAGTTT
TATTTAATAAAAAGTATTGGTGTTGTCTACGACTCAATGTGGCCTTGGAA
AGGATGCTGGAATGCCGGTCAATATATATAGTAACAGCTCATAGGGTAAG
GTTAATGAGTAGAATATTGTGAGGTTATCAGCCCAAGGGTACCCCTATGT
GTGTATTACATAACCTTTGGGTTGGTAATGATGGCGTAATGACGAGCACT
ATGTAAAATTCAG
back to top

protein sequence of SMED30012641-orf-1

>SMED30012641-orf-1 ID=SMED30012641-orf-1|Name=SMED30012641-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=243bp
MFHPLNVGLPVDKRGEMALGNHGLICSVLTVIEIAIIKAAVVEVAICGVQ
AGKVQSGRNDMIYTEWKVIVMGQHLHFLPLALTMLSYGFLYVLVDAIAVL
SINRDILLDEYVIVNEFILYCPACLSDIQMLFVDDFQIDLAVLVKYVALL
ELGPGISVVDHQQDSAWHHDIVKGVPKVCNWDVNGLVYNEIQFLVSIAVL
VACARFEPRIIERIACSVSKQMPQYQILEAALQVLIPALDQN*
back to top

protein sequence of SMED30012641-orf-2

>SMED30012641-orf-2 ID=SMED30012641-orf-2|Name=SMED30012641-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=567bp
MHSSECAPNILPKSSFLGKSWRTQKYINITLNFCQRSTIHGLNQLAFPKS
VQQRYFWIFICLSASIGMVINNYYLIDKFLERPVLTNVLQDHTAFVYPDV
SFCFTNPIYFPPAKSPYRRFIMAQYKKYIQFKKYPSNFLTVKIKFADFLY
MTRNNTYTHPLWSVLVECRYQDLQCSFQDLILRHLFAYGACYTFNYSRFE
SSAGNKYRYGNKELDFIIYKAVDIPIANFGDPFDNIMMPSGILLMIHDRN
TWPKLQESYILDEYSQVNLKIINKQHLNIGKTCRTVKNKFIYYDVFIKQN
ISVYGKYSDCVYQNVQEAVAKHCQCQWQEMQVLSHYYNLPFCIDHVVPPR
LNFSCLDTAYGDLNNGSLDYCYLDDCEHTTYETVISQSHFPALVDRKTNI
QWMKHLVEIETRETEFYGFSDLKFNALKWDKIQNANLTIANISVAFKSGR
YDLMDLEFVERNFMMVKIVPTSFFMDMIEETEGYPFSRLLGDIGGSVGLW
LGASLITVFEVFDLLSDLLETYFAIKQKEDRVKIFRKRLATNHEITSESF
LPKTLDEKSDFHQSNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
GO:0045177apical part of cell
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
GO:0005248voltage-gated sodium channel activity
GO:0005261cation channel activity
GO:0015280ligand-gated sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0098655cation transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 179..195
score: 42.59
coord: 241..259
score: 24.42
coord: 372..392
score: 23.24
coord: 316..333
score: 22.22
coord: 165..176
score: 25.0
coord: 93..109
score: 29.65
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 33..514
e-value: 1.4E-50
score: 172.6
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 30..529
NoneNo IPR availableTMHMMTMhelixcoord: 54..76