E3 ubiquitin-protein ligase TM129

Overview
NameE3 ubiquitin-protein ligase TM129
Smed IDSMED30012599
Length (bp)1370
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase TM129 (SMED30012599) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TM129 (SMED30012599) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase TM129 (SMED30012599) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TM129 (SMED30012599) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012599

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30012599h1SMcG0022056 dd_Smed_v4_8706_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012599h1SMcG0022056 dd_Smed_v4_8706_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012599h1SMcG0022056 dd_Smed_v4_8706_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012599h1SMcG0022056 dd_Smed_v4_8706_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012599h1SMcG0022056 dd_Smed_v6_8706_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Human
Match: TMEM129 (transmembrane protein 129 [Source:HGNC Symbol;Acc:HGNC:25137])

HSP 1 Score: 266.544 bits (680), Expect = 5.178e-85
Identity = 148/388 (38.14%), Postives = 213/388 (54.90%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHIL-----FWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   + T TL ++V  + F + P    A+GLTV+NL S  +G+E   FV +HL+R+  TL+ HS LP  YYV +C ++ S K L  H L      W+ +   ++ LP+ AC L +YW  + W  HP+A  + A +      W+ VA S+N E + +DKF +G  P  ++I+TD W++K   Y V  AQQ DV L+V E   + +    S D +L             VQ L I V +       F   +NS EY ++  KL AP++ A  ++I Q+LG+ F E F S V  NP      +P++   E CIGC QT+A+VKLV++C         GE    C +CYCRPMWC+ C+G+WFASRQ   +  P  W++ +  CPTCRA FC
Sbjct:    1 MDSPEVTFTLAYLVFAVCFVFTPNEFHAAGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLGYYVGMC-LAASEKRL--HALSQAPEAWRLFLLLAVTLPSIACILIYYWSRDRWACHPLARTL-ALYALPQSGWQAVASSVNTEFRRIDKFATG-APGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHEL----SPDSNL------------PVQLLTIRVASTNPAVQAFDIWLNSTEYGELCEKLRAPIRRAAHVVIHQSLGDLFLETFASLVEVNP---AYSVPSSQELEACIGCMQTRASVKLVKTC----QEAATGE----CQQCYCRPMWCLTCMGKWFASRQDPLR--PDTWLASRVPCPTCRARFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Human
Match: TMEM129 (transmembrane protein 129 [Source:HGNC Symbol;Acc:HGNC:25137])

HSP 1 Score: 266.544 bits (680), Expect = 5.178e-85
Identity = 148/388 (38.14%), Postives = 213/388 (54.90%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHIL-----FWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   + T TL ++V  + F + P    A+GLTV+NL S  +G+E   FV +HL+R+  TL+ HS LP  YYV +C ++ S K L  H L      W+ +   ++ LP+ AC L +YW  + W  HP+A  + A +      W+ VA S+N E + +DKF +G  P  ++I+TD W++K   Y V  AQQ DV L+V E   + +    S D +L             VQ L I V +       F   +NS EY ++  KL AP++ A  ++I Q+LG+ F E F S V  NP      +P++   E CIGC QT+A+VKLV++C         GE    C +CYCRPMWC+ C+G+WFASRQ   +  P  W++ +  CPTCRA FC
Sbjct:    1 MDSPEVTFTLAYLVFAVCFVFTPNEFHAAGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLGYYVGMC-LAASEKRL--HALSQAPEAWRLFLLLAVTLPSIACILIYYWSRDRWACHPLARTL-ALYALPQSGWQAVASSVNTEFRRIDKFATG-APGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHEL----SPDSNL------------PVQLLTIRVASTNPAVQAFDIWLNSTEYGELCEKLRAPIRRAAHVVIHQSLGDLFLETFASLVEVNP---AYSVPSSQELEACIGCMQTRASVKLVKTC----QEAATGE----CQQCYCRPMWCLTCMGKWFASRQDPLR--PDTWLASRVPCPTCRARFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Human
Match: TMEM129 (transmembrane protein 129 [Source:HGNC Symbol;Acc:HGNC:25137])

HSP 1 Score: 146.747 bits (369), Expect = 1.178e-40
Identity = 76/207 (36.71%), Postives = 117/207 (56.52%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHIL-----FWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTN 639
            M   + T TL ++V  + F + P    A+GLTV+NL S  +G+E   FV +HL+R+  TL+ HS LP  YYV +C ++ S K L  H L      W+ +   ++ LP+ AC L +YW  + W  HP+A  + A +      W+ VA S+N E + +DKF +G  P  ++I+TD W++K   Y V  AQQ DV L+V E   + ++ +
Sbjct:    1 MDSPEVTFTLAYLVFAVCFVFTPNEFHAAGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLGYYVGMC-LAASEKRL--HALSQAPEAWRLFLLLAVTLPSIACILIYYWSRDRWACHPLARTL-ALYALPQSGWQAVASSVNTEFRRIDKFATG-APGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHELSPD 202          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Human
Match: TMEM129 (transmembrane protein 129 [Source:HGNC Symbol;Acc:HGNC:25137])

HSP 1 Score: 50.0618 bits (118), Expect = 2.745e-7
Identity = 22/49 (44.90%), Postives = 32/49 (65.31%), Query Frame = 1
Query:   94 YPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFI 240
            + P    A+GLTV+NL S  +G+E   FV +HL+R+  TL+ HS LP +
Sbjct:    3 FTPNEFHAAGLTVQNLLSGWLGSEDAAFVPFHLRRTAATLLCHSLLPLV 51          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Celegans
Match: C34F6.7 (pep chromosome:WBcel235:X:11210107:11215470:-1 gene:WBGene00007941.1 transcript:C34F6.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C34F6.7)

HSP 1 Score: 76.2554 bits (186), Expect = 8.970e-15
Identity = 82/383 (21.41%), Postives = 145/383 (37.86%), Query Frame = 1
Query:   94 YPPVTIIAS-GLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFI---YYVY---LCNISESMKFLDFHILFWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNE---------MKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENST----CGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            +PP  ++   GLT+ +LF+ +  + Q +FV+Y  KR        +F P +   Y+V+   L   +++ +F       W +   F++L                     IA+      + DY  W      I+N          + + + F   +     + +T N++V T+ +     + ADV L V+   +  +  N+  ++ +         I+ +V +    +         F  T+  + Y  +   L  P+     I +  T  E+  E F   +  N   R          +PC  C   +  VK+ +SC      V   +  +     C  C CRP+WC  CL + F  RQ +       +    A CPTCR  FC
Sbjct:   50 FPPEELLDGLGLTLFDLFTILYNSRQHDFVEYAAKRVAFFHAFVAFYPCVIAAYFVHGNILMTAADTRRFPSVLDYPWMW---FTVLFVAL-----------------IANGYYCIRIKDYKKWPIYQYYIDNPDCVNEAQTVIADPETFRIKLSQRSFLFVTRNFLVYTSNWRFMAVKLADVRLQVDNTRM-PMLPNQDEEERI-------RSIFVKVSFRPAYITP-------FTITLRQDYYRQLNEILEVPIFVPPHINVPLTFMEELKEDFIQRIASNT--RVTHRVKASEKDPCFACGTEENMVKIERSCDGQEQRVFFHDIGARFTPPCENCICRPLWCRSCLAQIFIGRQNIDNVYRYEYHRGSAQCPTCRKNFC 395          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Fly
Match: CG14646 (gene:FBgn0037241 transcript:FBtr0078919)

HSP 1 Score: 214.927 bits (546), Expect = 7.388e-65
Identity = 124/405 (30.62%), Postives = 202/405 (49.88%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVY------LCNISESMKFLD-------------FHILFWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCA-FD--GDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M  S+    L +I+L ++  YPP      G T+E LF+  +G E  +FV YH +R++L L +HS LPF Y++       +    E ++  D             F  L WK   +FS+L      AL F W+  +W +HPI+  +    ++   ++  VA  I  E +  + +   +     +I T NWI+KT +Y+V FA Q++  LSV +   Y+++     D                +Q + I V+ +      F+  +N+ E+ +++ ++  P+     I + + + ++F + FK++V +NPI      P++   E C  C   + N K+ + CA FD  G  + +G   + C  CYCRPMWCVECL RWFA+RQ  +  D  VW+ QK +CP CRA FC
Sbjct:    1 MDESELLFNLFYILLCMVIIYPPEEFQRLGFTIEQLFARFLGEEYLDFVGYHQRRTSLNLFVHSCLPFSYFLIHRLKFSVFATQEPLEDFDLDPDFPMPQEAVAFKTLTWKTAQRFSVLAVLAMPALIFNWHQENWRRHPISKALSKYSITP-GSYSAVASEIGIEFRQPEIYKKKLNSISSVIATQNWIIKTTMYNVHFAHQSNTSLSVAKAETYNISHQDQND---------------TLQMISIIVRPMRQGVSDFHIRINALEFRNLENRVRRPIAIPSNIQLHRNVIDRFVDVFKAQVAQNPI-----FPDDATTEKCFACMLNEPNTKIHKQCADFDRNGAPLANG---ACCSNCYCRPMWCVECLARWFAARQ--SDVDREVWLEQKCTCPMCRAKFC 379          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Fly
Match: CG14646 (gene:FBgn0037241 transcript:FBtr0302339)

HSP 1 Score: 214.927 bits (546), Expect = 7.388e-65
Identity = 124/405 (30.62%), Postives = 202/405 (49.88%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVY------LCNISESMKFLD-------------FHILFWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCA-FD--GDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M  S+    L +I+L ++  YPP      G T+E LF+  +G E  +FV YH +R++L L +HS LPF Y++       +    E ++  D             F  L WK   +FS+L      AL F W+  +W +HPI+  +    ++   ++  VA  I  E +  + +   +     +I T NWI+KT +Y+V FA Q++  LSV +   Y+++     D                +Q + I V+ +      F+  +N+ E+ +++ ++  P+     I + + + ++F + FK++V +NPI      P++   E C  C   + N K+ + CA FD  G  + +G   + C  CYCRPMWCVECL RWFA+RQ  +  D  VW+ QK +CP CRA FC
Sbjct:    1 MDESELLFNLFYILLCMVIIYPPEEFQRLGFTIEQLFARFLGEEYLDFVGYHQRRTSLNLFVHSCLPFSYFLIHRLKFSVFATQEPLEDFDLDPDFPMPQEAVAFKTLTWKTAQRFSVLAVLAMPALIFNWHQENWRRHPISKALSKYSITP-GSYSAVASEIGIEFRQPEIYKKKLNSISSVIATQNWIIKTTMYNVHFAHQSNTSLSVAKAETYNISHQDQND---------------TLQMISIIVRPMRQGVSDFHIRINALEFRNLENRVRRPIAIPSNIQLHRNVIDRFVDVFKAQVAQNPI-----FPDDATTEKCFACMLNEPNTKIHKQCADFDRNGAPLANG---ACCSNCYCRPMWCVECLARWFAARQ--SDVDREVWLEQKCTCPMCRAKFC 379          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Zebrafish
Match: tmem129 (transmembrane protein 129, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:406756])

HSP 1 Score: 271.937 bits (694), Expect = 2.353e-87
Identity = 143/385 (37.14%), Postives = 214/385 (55.58%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILF--WKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   D T TL ++V  L F + P    ++G TV+++FS  +G+E   F+++H++R+TLT++ HSFLP  YY+ +C  +     +  H     W+ YF  SL++   +CALAFYW    W  HPI   +    +    +WR VA SIN E + +DKF SG  PS ++I+TD W++K   YS+  A   D  L+V +   +S++ +                +   VQ + I V ++  R   F   + S EY +++ KL+AP+++A  ++I  T+ E F E FKS V  N + +    P+    EPCIGC Q  ANVKL++ C  D      GE    C +CYCRPMWC+ C+G+WFASRQ   ++ P  W+S +  CPTCRA FC
Sbjct:    1 MDRPDATFTLAYVVFALCFVFTPNEFRSAGFTVQHMFSEWLGSEDISFIQHHIRRTTLTVLFHSFLPLGYYIGMCFAAPEQNLMYVHHASQGWQMYFGLSLVIQLLSCALAFYWSRRGWANHPICKALSVHALPQ-SSWRAVASSINTEFRRIDKFASG-SPSARVIVTDTWVMKVTTYSLHVALHQDCHLTVTDSKHHSLSPD----------------LNTPVQIVTITVGSINPRVKSFDIRLKSTEYAELQEKLHAPIRNAANVVIHLTMSELFLETFKSYVRMNVVYK---CPSGQELEPCIGCMQVNANVKLLRLCQSD-----EGE----CQQCYCRPMWCLTCMGKWFASRQ--DQQQPETWLSSRVPCPTCRAKFC 353          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Zebrafish
Match: tmem129 (transmembrane protein 129, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:406756])

HSP 1 Score: 214.927 bits (546), Expect = 3.692e-66
Identity = 116/316 (36.71%), Postives = 169/316 (53.48%), Query Frame = 1
Query:  241 YYVYLCNISESMKFLDFHILF--WKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            YY+ +C  +     +  H     W+ YF  SL++   +CALAFYW    W  HPI   +    +    +WR VA SIN E + +DKF SG  PS ++I+TD W++K   YS+  A   D  L+V +   +S++ +                +   VQ + I V ++  R   F   + S EY +++ KL+AP+++A  ++I  T+ E F E FKS V  N + +    P+    EPCIGC Q  ANVKL++ C  D      GE    C +CYCRPMWC+ C+G+WFASRQ   ++ P  W+S +  CPTCRA FC
Sbjct:    2 YYIGMCFAAPEQNLMYVHHASQGWQMYFGLSLVIQLLSCALAFYWSRRGWANHPICKALSVHALPQ-SSWRAVASSINTEFRRIDKFASGS-PSARVIVTDTWVMKVTTYSLHVALHQDCHLTVTDSKHHSLSPD----------------LNTPVQIVTITVGSINPRVKSFDIRLKSTEYAELQEKLHAPIRNAANVVIHLTMSELFLETFKSYVRMNVVYK---CPSGQELEPCIGCMQVNANVKLLRLCQSD-----EGE----CQQCYCRPMWCLTCMGKWFASRQ--DQQQPETWLSSRVPCPTCRAKFC 285          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Xenopus
Match: brd2 (bromodomain containing 2 [Source:Xenbase;Acc:XB-GENE-481598])

HSP 1 Score: 275.404 bits (703), Expect = 1.710e-88
Identity = 146/385 (37.92%), Postives = 216/385 (56.10%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILF--WKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   + T TL ++V  + F + P    ++G+TV+NL S  +G+E   FV YH++RST TL+ HS LP  Y++ +C  +   +  + +     WK +   ++LLP     LAFYW    W  HP+A  + A       +WR VA SIN E + +DKF +G  PS ++I+TD W++K   Y V  AQQ D+ L+V +   + ++ +           SN+      VQ++ I V ++  R   F   +NS EY +++ KL+AP+++A  ++I QTL + F E FKS V  N +     + +N   EPCIGC QT AN+KLV+ C       N GE    C +CYCRPMWC+ C+G+WFASRQ   ++ P  W+S    CPTCRA FC
Sbjct:    1 MESPEVTFTLAYVVFSVCFVFTPNEFHSAGITVQNLLSGWLGSEDVAFVHYHIRRSTATLLTHSLLPMGYFIGMCFAAPEKELYNVYKAADGWKVFVLITVLLPVTTSILAFYWSQKRWGNHPLAKTL-AHHALPQSSWRAVASSINTEFRRIDKFATG-APSARVIVTDTWVMKVTTYRVDVAQQQDIHLTVTDSRQHELSPD-----------SNTP-----VQFITIRVASVNPRVKPFDIRLNSTEYGELREKLHAPIRNAANVVIHQTLSDMFLETFKSLVEANQV---YELSSNQELEPCIGCMQTNANIKLVKYC----QEANEGE----CQQCYCRPMWCLTCMGKWFASRQ--DQQHPETWLSSHVPCPTCRAKFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Mouse
Match: Tmem129 (transmembrane protein 129 [Source:MGI Symbol;Acc:MGI:1915616])

HSP 1 Score: 264.233 bits (674), Expect = 2.632e-84
Identity = 147/385 (38.18%), Postives = 215/385 (55.84%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLC-NISESMKFLDFHIL-FWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   + T TL ++V  + F + P    ++GLTV+NL S  +G+E   FV YHL+R++ TL+ HS LP  YY+ +C   SE   +        W+ +   ++ LP  +C L +YW  + W +HP+A  + A +      W+ VA SIN E + +DKF +G  P  ++I+TD W++K   Y V  AQQ DV L+V E    S   + S D +L             VQ L I V +    +  F   +NS+EY ++  KL+AP++ A  ++I+Q+LG+ F E F S V  NP      +P+N   EPCIGC QT+A+VKLV++C         GE    C +CYCRPMWC+ C+G+WFASRQ    + P  W++ +  CPTCRA FC
Sbjct:    1 MDSPEVTFTLAYLVFAVCFVFTPNEFYSAGLTVQNLLSGWLGSEDAAFVPYHLRRTSATLLCHSLLPLGYYMGMCFAASEKQLYSPGQAPEAWQLFLLLAVTLPLLSCTLIYYWSWDRWTRHPLAQTL-ALYALPQSGWQAVASSINTEFRRIDKFATG-APGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTE----SRQHDLSPDSNL------------PVQLLTIRVASTSPGTQPFDIRLNSSEYGELCEKLHAPIRSAANVVIRQSLGDLFLETFASHVEVNPA---YSVPSNQELEPCIGCMQTRASVKLVKTCQEPAV----GE----CQQCYCRPMWCLTCMGKWFASRQ--DPQRPDTWLASRVPCPTCRARFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Mouse
Match: Tmem129 (transmembrane protein 129 [Source:MGI Symbol;Acc:MGI:1915616])

HSP 1 Score: 81.6481 bits (200), Expect = 7.298e-19
Identity = 35/75 (46.67%), Postives = 47/75 (62.67%), Query Frame = 1
Query:  958 QTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            QT+A+VKLV++C               C +CYCRPMWC+ C+G+WFASRQ    + P  W++ +  CPTCRA FC
Sbjct:    2 QTRASVKLVKTC--------QEPAVGECQQCYCRPMWCLTCMGKWFASRQ--DPQRPDTWLASRVPCPTCRARFC 66          
BLAST of E3 ubiquitin-protein ligase TM129 vs. UniProt/SwissProt
Match: sp|Q08DK0|TM129_BOVIN (E3 ubiquitin-protein ligase TM129 OS=Bos taurus OX=9913 GN=TMEM129 PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 8.969e-90
Identity = 150/385 (38.96%), Postives = 213/385 (55.32%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLC-NISESMKFLDFHIL-FWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   + T TL ++V  + F + P    ++GLTV+NL S  +G+E   FV YHL+R+  TL+ HS LP  YYV +C   SE   +        W+ +   +L+LP  AC L +YW  +HW  HP+A  + A +      W+ VA S+N E + +DKF +G VP  ++I+TD W++K   Y V  AQQ DV L+V E   +               +S  SH+   VQ L I V +       F+  +NS EY ++  KL AP++ A  ++I Q+LG+ F E F S V  NP      +P++   E CIGC QTQA+VKLV++C      V  GE    C +CYCRPMWC+ C+G+WFASRQ    + P  W++ +  CPTCRA FC
Sbjct:    1 MDSPEVTFTLAYLVFAVCFVFTPTEFHSAGLTVQNLLSGWLGSEDAAFVPYHLRRTAATLLCHSLLPLGYYVGMCFAASEKQLYYPSQTPETWRAFLLLALMLPAIACTLIYYWSRDHWACHPLARTL-ALYALPRSGWQAVASSVNTEFRRIDKFATG-VPGARVIVTDTWVMKVTTYRVHVAQQQDVRLTVTEAQQH--------------ELSPDSHL--PVQLLTIRVASANPAVPAFHIRLNSTEYGELCEKLRAPIRSAANVVIHQSLGDLFLETFASLVEVNP---AYSVPSSQDLEACIGCMQTQASVKLVKTC----QEVAVGE----CQQCYCRPMWCLTCMGKWFASRQ--DPQRPDTWLASRVPCPTCRARFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. UniProt/SwissProt
Match: sp|Q6IR55|TM129_XENLA (E3 ubiquitin-protein ligase TM129 OS=Xenopus laevis OX=8355 GN=tmem129 PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.667e-88
Identity = 145/379 (38.26%), Postives = 216/379 (56.99%), Query Frame = 1
Query:   52 TCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILF--WKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            T TL ++V  + F + P    ++G+TV+NL S  +G+E   FV YH++RS+ TL+ HS LP  Y++ +C  +   +  + H     WK +   ++LLP     LAFYW    W+ HP+A  + A       +WR VA SIN E + +DKF +G  PS ++I+TD W++K   Y V  AQQ D+ L+V +   + ++ +           SN+      VQ++ I V ++  R   F   +NS EY +++ KL+AP+++A  I+I QTLG+ F + F+S V  N       + +N   EPCIGC QT AN+KLV+ C       N GE    C +CYCRPMWC+ C+G+WFASRQ   ++ P  W+S +  CPTCRA FC
Sbjct:    7 TFTLAYVVFSVCFVFTPNEFHSAGITVQNLLSGWLGSEDVAFVHYHIRRSSATLLAHSLLPMGYFIGMCFAAPEKELYNVHKAADGWKVFVLMAVLLPIATSILAFYWSQKRWSNHPLAKTL-AHHALPQSSWRAVASSINTEFRRIDKFATG-APSARVIVTDTWVMKVTTYKVDVAQQQDIHLTVTDSRQHELSPD-----------SNTP-----VQFITIRVASINPRVKPFDIRLNSTEYGELREKLHAPIRNAANIVIHQTLGDMFLDTFRSLVEAN---HTYEISSNQELEPCIGCMQTNANIKLVKYC----QEANEGE----CQQCYCRPMWCLTCMGKWFASRQ--DQQHPETWLSSQVPCPTCRAKFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. UniProt/SwissProt
Match: sp|Q5ZI25|TM129_CHICK (Transmembrane protein 129 OS=Gallus gallus OX=9031 GN=TMEM129 PE=2 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 6.015e-88
Identity = 143/379 (37.73%), Postives = 215/379 (56.73%), Query Frame = 1
Query:   52 TCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILF--WKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            T TL ++V  + F +PP  + ++GLTV++L +  +G+E   FV+YHL+RST TL+ HS LP  YY  +C  +       F++    WK +F F++LLP  +  +A+YW    WN HP+A  + A +      WR VA SIN E + +DKF +G  P  ++I+TD W++K   Y +  AQQ D+ L+V +   + +    + D ++             VQ+L I V ++      F   +NS EY +++ KL AP+ +A  ++I Q+L + F E F S V  N   +   +P+    EPCIGC QT AN+KL+++C       N GE    C +CYCRPMWC+ C+G+WFASRQ   ++ P  W+S    CPTCRA FC
Sbjct:    7 TFTLAYLVFAVCFVFPPDEVRSAGLTVQSLLAAWLGSEDAAFVQYHLRRSTGTLLAHSLLPLGYYFGMCFAAPEKHLCFFYLASKEWKTFFFFAVLLPAVSSTMAYYWSRKGWNNHPLARTL-AVYALPQSGWRAVASSINTEFRRIDKFATG-APGARVIVTDTWVIKVTTYCLHVAQQQDIHLTVTDSRQHEL----TPDSNM------------PVQFLTIRVASVNPYVKAFDIRLNSAEYGELREKLRAPISNAANVVIHQSLSDLFLETFTSLVEMN---QTYSVPSTQELEPCIGCMQTIANIKLIKNC----QEPNEGE----CQQCYCRPMWCLTCMGKWFASRQ--DQQHPETWLSSHVPCPTCRAKFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. UniProt/SwissProt
Match: sp|Q0IJ33|TM129_XENTR (E3 ubiquitin-protein ligase TM129 OS=Xenopus tropicalis OX=8364 GN=tmem129 PE=2 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 9.059e-88
Identity = 146/385 (37.92%), Postives = 216/385 (56.10%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILF--WKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   + T TL ++V  + F + P    ++G+TV+NL S  +G+E   FV YH++RST TL+ HS LP  Y++ +C  +   +  + +     WK +   ++LLP     LAFYW    W  HP+A  + A       +WR VA SIN E + +DKF +G  PS ++I+TD W++K   Y V  AQQ D+ L+V +   + ++ +           SN+      VQ++ I V ++  R   F   +NS EY +++ KL+AP+++A  ++I QTL + F E FKS V  N +     + +N   EPCIGC QT AN+KLV+ C       N GE    C +CYCRPMWC+ C+G+WFASRQ   ++ P  W+S    CPTCRA FC
Sbjct:    1 MESPEVTFTLAYVVFSVCFVFTPNEFHSAGITVQNLLSGWLGSEDVAFVHYHIRRSTATLLTHSLLPMGYFIGMCFAAPEKELYNVYKAADGWKVFVLITVLLPVTTSILAFYWSQKRWGNHPLAKTL-AHHALPQSSWRAVASSINTEFRRIDKFATG-APSARVIVTDTWVMKVTTYRVDVAQQQDIHLTVTDSRQHELSPD-----------SNTP-----VQFITIRVASVNPRVKPFDIRLNSTEYGELREKLHAPIRNAANVVIHQTLSDMFLETFKSLVEANQV---YELSSNQELEPCIGCMQTNANIKLVKYC----QEANEGE----CQQCYCRPMWCLTCMGKWFASRQ--DQQHPETWLSSHVPCPTCRAKFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. UniProt/SwissProt
Match: sp|Q6PD82|TM129_DANRE (E3 ubiquitin-protein ligase TM129 OS=Danio rerio OX=7955 GN=tmem129 PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 1.085e-85
Identity = 143/385 (37.14%), Postives = 213/385 (55.32%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILF--WKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   D T TL ++V  L F + P    ++G TV+++FS  +G+E   F+++H++R+TLT++ HSFLP  YY+ +C  +     +  H     W+ YF  SL++   +CALAFYW    W  HPI   +    +    +WR VA SIN E + +DKF SG  PS ++I+TD W++K   YS+  A   D  L+V +   +S++ +                +   VQ + I V ++  R   F   + S EY +++ KL+AP+++A  ++I  T+ E F E FKS V  N + +    P+    EPCIGC Q  ANVKL+  C  D      GE    C +CYCRPMWC+ C+G+WFASRQ   ++ P  W+S +  CPTCRA FC
Sbjct:    1 MDRPDATFTLAYVVFALCFVFTPNEFRSAGFTVQHMFSEWLGSEDISFIQHHIRRTTLTVLFHSFLPLGYYIGMCFAAPEQNLMYVHHASQGWQMYFGLSLVIQLLSCALAFYWSRRGWANHPICKALSVHALPQ-SSWRAVASSINTEFRRIDKFASG-SPSARVIVTDTWVMKVTTYSLHVALHQDCHLTVTDSKHHSLSPD----------------LNTPVQIVTITVGSINPRVKSFDIRLKSTEYAELQEKLHAPIRNAANVVIHLTMSELFLETFKSYVRMNVVYK---CPSGQELEPCIGCMQVNANVKLLCLCQSD-----EGE----CQQCYCRPMWCLTCMGKWFASRQ--DQQQPETWLSSRVPCPTCRAKFC 353          
BLAST of E3 ubiquitin-protein ligase TM129 vs. TrEMBL
Match: A0A4X2M2D7 (Uncharacterized protein OS=Vombatus ursinus OX=29139 GN=TMEM129 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 7.941e-88
Identity = 150/385 (38.96%), Postives = 220/385 (57.14%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHIL--FWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   + T TL +IV  + F + P    ++GLTV+NL S  +G E   FV+YHL+R+T+T+++HS LP  YY+ +C  +   +   F+     WK +   S+  PT  C +A+YW  N W++HP+A  + A        WR VA SIN E + +DKF +G +   ++I+TD W++K   Y +  AQQ DV L+V E   + +    S D +L             VQ+L I V ++      F   +NS EY +++ KL AP+++A  ++I Q+LG+ F E F S V  NP P +I  P+N   EPCIGC Q  AN+KLV++C       + GE    C +CYCRPMWC+ C+G+WFASRQ   ++ P  W+S +  CPTCRA FC
Sbjct:    1 MDSPEVTFTLAYIVFSVCFVFTPNEFHSAGLTVQNLLSGWLGIEDVAFVQYHLRRTTVTMLVHSLLPLGYYLGMCFAAAEKRLYYFNQAPEGWKLFLLLSVSFPTVTCTIAYYWSRNRWDRHPLARTL-ALHALPQSGWRAVASSINTEFRRIDKFATGAL-GARVIVTDTWVMKVTTYHIHVAQQQDVHLTVTESRQHEL----SPDSNL------------PVQFLTIRVASINPLVKAFDIRLNSTEYGELREKLRAPIRNAANVVIHQSLGDLFLETFTSLVEINP-PYSI--PSNQELEPCIGCMQISANIKLVKNC----QESDEGE----CQQCYCRPMWCLTCMGKWFASRQ--DQQHPETWLSSQVPCPTCRAKFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. TrEMBL
Match: L5K4W8 (Transmembrane protein 129 OS=Pteropus alecto OX=9402 GN=PAL_GLEAN10022935 PE=4 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 2.361e-87
Identity = 144/385 (37.40%), Postives = 211/385 (54.81%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHIL--FWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   + T TL ++V  + F + P    ++GLTV+NL S  +G+E   FV YHL+R+  TL+ HS LP  YYV +C  +   +          W+ +   ++ LPT AC L +YW  + W +HP+A  + A +      WR VA S+N E + +DKF +G  P  ++I+TD W++K   Y V  AQQ DV L+V E   + +    S D +L             VQ L I V         F   +NS EY ++  KL AP++ A  ++I+Q+LG+ F E F S V +NP+     +P++   E CIGC QT+A+VKLV++C             S C +CYCRPMWC+ C+G+WFASRQ   ++ P  W++ +  CPTCRA FC
Sbjct:    1 MDSPEVTFTLAYLVFAVCFVFTPTEFHSAGLTVQNLLSGWLGSEDAAFVPYHLRRTAATLLCHSLLPLGYYVGMCFAASEKRLYSPGQAPEAWRLFLLLAVTLPTIACTLIYYWSRDRWARHPLARTL-ALYALPQSGWRAVASSVNTEFRRIDKFATG-APGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESQQHEL----SPDSNL------------PVQLLTIRVAGASPAVQAFDIRLNSTEYGELCEKLRAPIRSAANVVIRQSLGDLFLETFASMVEENPV---YSVPSSQELEACIGCMQTRASVKLVKTC--------QEVAESECQRCYCRPMWCLTCMGKWFASRQ--DQQRPDTWLASRVPCPTCRARFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. TrEMBL
Match: L8II37 (Transmembrane protein 129 OS=Bos mutus OX=72004 GN=M91_07420 PE=4 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 5.023e-87
Identity = 148/385 (38.44%), Postives = 213/385 (55.32%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLC-NISESMKFLDFHIL-FWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   + T TL ++V  + F + P    ++GLTV+NL S  +G+E   FV YHL+R+  TL+ HS LP  YYV +C   SE   +        W+ +   +L+LP  AC L +YW  +HW +HP+A  + A +      W+ VA S+N E + +DKF +G VP  ++I+TD W++K   Y V  AQQ DV L+V E   +               +S  SH+   VQ L I V +       F+  +NS EY ++  KL AP++ A  ++I Q+LG+ F E F S V  NP      +P++   E CIGC QT+A+VKLV++C         GE    C +CYCRPMWC+ C+G+WFASRQ    + P  W++ +  CPTCRA FC
Sbjct:    1 MDSPEVTFTLAYLVFAVCFVFTPTEFHSAGLTVQNLLSGWLGSEDAAFVPYHLRRTAATLLCHSLLPLGYYVGMCFAASEKQLYYPSQTPETWRAFLLLALMLPAIACTLIYYWSRDHWARHPLARTL-ALYALPRSGWQAVASSVNTEFRRIDKFATG-VPGARVIVTDTWVMKVTTYRVHVAQQQDVRLTVTEAQQH--------------ELSPDSHL--PVQLLTIRVASANPAVPAFHIRLNSTEYGELCEKLRAPIRSAANVVIHQSLGDLFLETFASLVEVNP---AYSVPSSQDLEACIGCMQTRASVKLVKTC----QEAAVGE----CQQCYCRPMWCLTCMGKWFASRQ--DPQRPDTWLASRVPCPTCRARFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. TrEMBL
Match: A0A1L8HT77 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18005025mg PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 8.994e-87
Identity = 147/379 (38.79%), Postives = 216/379 (56.99%), Query Frame = 1
Query:   52 TCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILF--WKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            T TL ++V  + F + P    ++G+TV+NL S  +G+E   FV YH++RST TL+ HS LP  Y++ LC  +   +  + H     WK +   ++LLP     LAFYW    W+ HP+A  + A       +WR VA SIN E + +DKF +G  PS ++I+TD W++K   Y V  AQQ D+ L+V +   + ++ +           SN+      VQ++ I V ++  R   F   +NS EY +++ KL+AP+++A  I+I QTLG+ F + F+S V  N       + +N   EPCIGC QT AN+KLV+ C       N GE    C +CYCRPMWC+ C+G+WFASRQ   ++ P  W+S +  CPTCRA FC
Sbjct:    7 TFTLAYVVFSVCFVFTPNEFHSAGITVQNLLSGWLGSEDVAFVHYHIRRSTATLLAHSLLPMGYFIGLCFAAPEKELYNVHKAADGWKVFVLMAVLLPIATSILAFYWSQKRWSNHPLAKTL-AHHALPQSSWRAVASSINTEFRRIDKFATG-APSARVIVTDTWVMKVTTYKVDVAQQQDIHLTVTDSRQHELSPD-----------SNTP-----VQFITIRVASINPRVKPFDIRLNSTEYGELREKLHAPIRNAANIVIHQTLGDMFLDTFRSLVEAN---HTYEISSNQELEPCIGCMQTNANIKLVKYC----QEANEGE----CQQCYCRPMWCLTCMGKWFASRQ--DQQHPETWLSSQVPCPTCRAKFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. TrEMBL
Match: A0A151P9P5 (E3 ubiquitin-protein ligase TM129 OS=Alligator mississippiensis OX=8496 GN=TMEM129 PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 9.390e-87
Identity = 145/379 (38.26%), Postives = 216/379 (56.99%), Query Frame = 1
Query:   52 TCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHIL--FWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            T TL ++VL + F +PP    A+GLTV+ L    +G+E   FV++HL+RST TL+ H+ LP  YY+ +C  +   +   F++    WK +F  +++ PT    LA+YW  N W+ HP+A  +    +    +WR VA SIN E + +DKF +G  P  ++I+TD W++K   Y +  AQQ D+ L+V +   + +    S D ++             VQ+L I V ++      F   +NS EY +++ KL AP+++A  ++I Q+L + F E F S V  N   +    P+N   EPCIGC QT AN+KLV+SC       N GE    C +CYCRPMWC+ C+G+WFASRQ   ++ P  W+S +  CPTCRA FC
Sbjct:    7 TFTLAYVVLSVCFVFPPHEFRAAGLTVQGLLGAWLGSEDAAFVQHHLRRSTGTLLAHALLPLGYYIGMCFAAPEKQLCYFYLAPEGWKIFFFLAVVFPTITSILAYYWSWNGWDNHPLARTLAVHALPQ-SSWRAVASSINTEFRRIDKFATG-APGARVIVTDTWVIKVTTYCLHVAQQQDIHLTVTDSRQHEL----SPDSNM------------PVQFLTINVASINPYVKAFDIRLNSTEYGELREKLRAPIRNAANVVIHQSLSDLFLETFTSLVEMN---QTYPAPSNQELEPCIGCMQTNANIKLVKSC----QEPNEGE----CQQCYCRPMWCLTCMGKWFASRQ--DQQHPETWLSSQVPCPTCRAKFC 354          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Cavefish
Match: tmem129 (transmembrane protein 129 [Source:NCBI gene;Acc:103037548])

HSP 1 Score: 262.307 bits (669), Expect = 1.128e-83
Identity = 139/377 (36.87%), Postives = 209/377 (55.44%), Query Frame = 1
Query:   58 TLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILF--WKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            TL +IV  +   + P    ++GLTV+NLFS  IG+E   F+++HL+R+ LTL++H  LP  YYV +C  +        H     W+ YF  S  L  F+ AL FYW  N W+ HPI+  + + F     +WR+VA SIN E + ++KF +G  P  ++I+TD W++K  +Y +    Q D  L+V +   + ++ + SG                 VQ L + V ++      F   +NS EY +++ KL++P+++A  +++  TL E F E FKS+V  N + R+    +    EPCIGC Q  ANVKLV+ C  +G+          C +CYCRPMWC+ C+G+WFASRQ   +  P  W+S   +CPTCRA FC
Sbjct:    7 TLGYIVFTVCVLFTPNEFRSAGLTVQNLFSSWIGSEDIGFIQFHLRRTALTLLIHCALPLGYYVGMCLAAPEENLFSIHSASSGWQLYFGLSATLQLFSVALVFYWSRNGWSNHPISHTL-SKFALPQSSWRSVASSINTEFRRIEKFATG-PPDARVIVTDTWVMKVTVYRLHVTLQQDAHLTVIDSKQHDLSPD-SGTP---------------VQILTLRVASINPNIKSFDIRLNSTEYAELREKLHSPIRNAANVVVHLTLSELFLETFKSQVEMNQVYRHT---SGQELEPCIGCMQVSANVKLVRLCRDEGE----------CQQCYCRPMWCLVCMGKWFASRQ--DQTRPETWLSSTVACPTCRAKFC 350          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Sea Lamprey
Match: tmem129 (transmembrane protein 129, E3 ubiquitin protein ligase [Source:NCBI gene;Acc:406756])

HSP 1 Score: 261.922 bits (668), Expect = 3.403e-84
Identity = 145/388 (37.37%), Postives = 218/388 (56.19%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHIL--FWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNP---IPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            M   +   TL +++  + F   P    ++G+TV+ LFS  +G+E  +FV+YH +R+T T+V+H+ LP  YY+ +       +   FH     W+ Y   SL++P     L F+W  N W  HP+A  + A  VS   +WR  AVS+N E + +DKF +G  P  ++I+TD+W+VK   Y V  AQQ D+ L++ E   +S++   S                  +Q+L I V ++      F   +NS EY +++ KL+AP+++A+ ++I QTL + F EAFK++V  N    +P  +G P     EPCIGC Q  A VKL + C  DG+    GE    C  C+CRPMWC+ C+G+WFASRQ   ++ P VW+S +A CPTCRA FC
Sbjct:    1 MESPEMVFTLAYLLFCVCFLLTPTEFRSAGITVQGLFSGWLGSEDLDFVRYHTRRTTTTMVVHALLPLGYYIGMGFTVPKAQLFYFHKASDSWRMYLLVSLIVPACLGTLGFFWSRNGWGNHPLARAL-ARHVSSSMSWRIAAVSLNTEFRRIDKFATG-PPEARVIVTDSWVVKVTPYKVNVAQQRDIHLTLIESRQHSLSPETS----------------SAIQFLTIRVVSITPGVPAFDIRLNSTEYGELREKLHAPIRNARNVVIHQTLSDLFLEAFKTQVELNDCYYMP--VGQPQE--TEPCIGCMQVPATVKLHKQC--DGNA--EGE----CQTCFCRPMWCLTCMGKWFASRQ--DQQHPEVWLSSRAPCPTCRARFC 356          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Nematostella
Match: EDO49123 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGW0])

HSP 1 Score: 224.942 bits (572), Expect = 1.424e-69
Identity = 130/373 (34.85%), Postives = 200/373 (53.62%), Query Frame = 1
Query:   58 TLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILFWKFYFQFSLLL----PTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPT 1164
            TL + ++ + F  PP   +++GLT++N+ S  +G+E  +FV YHL+R+  T+++HS LP  YY+ L  IS+ +    F            LLL      +  AL  YW  + W+ HP+   +     S    WR VA SIN E + + KF S ++ + K+ ITD+WIVK   Y V  A + DV LS+            S D D+    S S      +Q+L I V+++      F   + S +Y D+K +L AP+++A+ +II Q+L ++F +AF+S V +N       + +    EPCIGC Q QA++KL + C  +G +         C  CYCRPMWC++C+G+WFASRQ   ++ P  W+S    CPT
Sbjct:   11 TLAYGLVAMCFVAPPKEFVSAGLTIQNILSSYLGSEDMDFVGYHLRRTASTVLVHSCLPLGYYIGLGMISKKLNM--FEPGRADIMINMCLLLCVGIAVYGVALVRYWSWDRWSHHPLCKVL----ASHGGPWRAVASSINIEFRRITKFTS-IIGATKLFITDSWIVKCTAYKVHVAHKPDVHLSIIA----------SEDHDISPENSVS------LQFLNILVESINPTVEPFVIRLLSTDYGDLKDRLQAPIRNARNVIIHQSLSDRFLDAFRSLVEQN---ERFHLGDAEEPEPCIGCMQQQADIKLHKLCDDEGSS-------GDCVSCYCRPMWCLDCMGKWFASRQ--DQQRPETWLSSTCPCPT 348          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Nematostella
Match: EDO29361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3V3])

HSP 1 Score: 93.9745 bits (232), Expect = 1.174e-23
Identity = 40/82 (48.78%), Postives = 53/82 (64.63%), Query Frame = 1
Query:  937 EPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            EPCIGC Q QA++KL + C  +G +         C  CYCRPMWC++C+G+WFASRQ   ++ P  W+S    CPTCR+ FC
Sbjct:    4 EPCIGCMQQQADIKLHKLCDDEGSS-------GDCVSCYCRPMWCLDCMGKWFASRQ--DQQRPETWLSSTCPCPTCRSVFC 76          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Medaka
Match: tmem129 (transmembrane protein 129 [Source:NCBI gene;Acc:101168527])

HSP 1 Score: 251.906 bits (642), Expect = 1.627e-79
Identity = 134/386 (34.72%), Postives = 213/386 (55.18%), Query Frame = 1
Query:   31 IMTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHIL--FWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            IM   + + TL ++VL   F + P    A+GLTV+N+F+  +G+E   F++YH+KR+++T ++HS LP  YY+ +C  +        H +   W+ +   SL L   + AL  YW   HW+ HPI+  ++A   +    W  +A SIN E + +DKF +G VP   +I+TD+W++K   Y V  A Q++  ++V +   + ++ + SG                 V+ L + V ++      F   VNS++Y D + KL+AP++ +  ++I QT+ E F E F+++V  N + R   +P     E CIGC Q  A +KLV+ C   G      ++   C +C+CRPMWC+ CLGRWFASRQ   ++ P  W+S K  CPTCR+ FC
Sbjct:    7 IMESPELSFTLAYVVLAFCFVFTPNEFRAAGLTVQNVFASWLGSEDVGFIQYHVKRTSVTALVHSALPLGYYLGMCVAAPEKNLALIHQVSGSWRIFLLLSLCLHFLSLALVIYWSRRHWHNHPISRALQAHARAPNSRWGAMASSINTEFRRIDKFATG-VPGASVIVTDSWVLKVTTYHVHVALQSECHVTVTQSRRHQLSPD-SGSP---------------VEILTLRVDSINPAVKAFTIRVNSSDYADFREKLHAPIRVSPNVVIHQTISELFLETFRAQVELNQVYR---LPAGQELESCIGCMQVPAGIKLVRLCQTAGP-----DQEVECQQCFCRPMWCLMCLGRWFASRQ--DQQRPETWLSSKVPCPTCRSKFC 365          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Planmine SMEST
Match: SMESG000022818.1 (SMESG000022818.1)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 382/383 (99.74%), Postives = 383/383 (100.00%), Query Frame = 1
Query:   34 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILFWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILFWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPG+WMSQKASCPTCRATFC
Sbjct:    1 MTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILFWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGIWMSQKASCPTCRATFC 383          
BLAST of E3 ubiquitin-protein ligase TM129 vs. Planmine SMEST
Match: SMESG000022818.1 (SMESG000022818.1)

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 365/366 (99.73%), Postives = 366/366 (100.00%), Query Frame = 1
Query:   85 MFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILFWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFC 1182
            MFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILFWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPG+WMSQKASCPTCRATFC
Sbjct:    1 MFTYPPVTIIASGLTVENLFSFIIGTEQKEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILFWKFYFQFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSINNEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECNVYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVNSNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGMPNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMWCVECLGRWFASRQLVAKKDPGIWMSQKASCPTCRATFC 366          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TMEM1295.178e-8538.14transmembrane protein 129 [Source:HGNC Symbol;Acc:... [more]
TMEM1295.178e-8538.14transmembrane protein 129 [Source:HGNC Symbol;Acc:... [more]
TMEM1291.178e-4036.71transmembrane protein 129 [Source:HGNC Symbol;Acc:... [more]
TMEM1292.745e-744.90transmembrane protein 129 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C34F6.78.970e-1521.41pep chromosome:WBcel235:X:11210107:11215470:-1 gen... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG146467.388e-6530.62gene:FBgn0037241 transcript:FBtr0078919[more]
CG146467.388e-6530.62gene:FBgn0037241 transcript:FBtr0302339[more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tmem1292.353e-8737.14transmembrane protein 129, E3 ubiquitin protein li... [more]
tmem1293.692e-6636.71transmembrane protein 129, E3 ubiquitin protein li... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
brd21.710e-8837.92bromodomain containing 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tmem1292.632e-8438.18transmembrane protein 129 [Source:MGI Symbol;Acc:M... [more]
Tmem1297.298e-1946.67transmembrane protein 129 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08DK0|TM129_BOVIN8.969e-9038.96E3 ubiquitin-protein ligase TM129 OS=Bos taurus OX... [more]
sp|Q6IR55|TM129_XENLA1.667e-8838.26E3 ubiquitin-protein ligase TM129 OS=Xenopus laevi... [more]
sp|Q5ZI25|TM129_CHICK6.015e-8837.73Transmembrane protein 129 OS=Gallus gallus OX=9031... [more]
sp|Q0IJ33|TM129_XENTR9.059e-8837.92E3 ubiquitin-protein ligase TM129 OS=Xenopus tropi... [more]
sp|Q6PD82|TM129_DANRE1.085e-8537.14E3 ubiquitin-protein ligase TM129 OS=Danio rerio O... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4X2M2D77.941e-8838.96Uncharacterized protein OS=Vombatus ursinus OX=291... [more]
L5K4W82.361e-8737.40Transmembrane protein 129 OS=Pteropus alecto OX=94... [more]
L8II375.023e-8738.44Transmembrane protein 129 OS=Bos mutus OX=72004 GN... [more]
A0A1L8HT778.994e-8738.79Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A151P9P59.390e-8738.26E3 ubiquitin-protein ligase TM129 OS=Alligator mis... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem1291.128e-8336.87transmembrane protein 129 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem1293.403e-8437.37transmembrane protein 129, E3 ubiquitin protein li... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO491231.424e-6934.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293611.174e-2348.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem1291.627e-7934.72transmembrane protein 129 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TM129 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000022818.10.000e+099.74SMESG000022818.1[more]
SMESG000022818.10.000e+099.73SMESG000022818.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012599 ID=SMED30012599|Name=E3 ubiquitin-protein ligase TM129|organism=Schmidtea mediterranea sexual|type=transcript|length=1370bp
TATATAAATCTTATATGAATGAATTTATATATTATGACTGGATCTGATTG
GACTTGTACATTAATATTTATCGTGCTTGTATTAATGTTTACTTATCCAC
CTGTAACTATAATTGCATCTGGATTAACCGTAGAAAATTTATTTTCCTTT
ATAATCGGAACCGAGCAAAAAGAATTTGTTAAATATCACTTAAAACGGTC
AACTCTAACATTAGTTCTGCATTCTTTCTTGCCTTTTATTTATTATGTAT
ACCTTTGTAATATCTCTGAGTCTATGAAATTTTTGGATTTTCATATTTTA
TTTTGGAAATTTTACTTTCAATTTAGTTTATTGTTGCCCACTTTCGCTTG
TGCATTGGCCTTTTATTGGTATCATAACCATTGGAATAAACATCCTATAG
CCTCCAATATTAAAGCATCATTTGTAAGTGATTATGATAACTGGAGAAAT
GTTGCTGTTAGTATTAACAATGAAATGAAAAATCTCGATAAGTTCGTGTC
AGGAGTCGTTCCATCGAAAAAAATTATCATAACTGACAATTGGATAGTTA
AAACTAATTTGTATTCTGTTAAATTCGCTCAGCAAGCTGATGTGGAACTG
TCTGTTGAAGAATGCAATGTTTATTCAGTCAATACAAACCGCAGTGGCGA
TGATGATTTGGTGGGAAACATTTCCAATTCCAGTCATATCTATGGAGAAG
TTCAATATTTGAAAATAGCAGTGAAAAATTTGCTAAATAGGTCAATTTAT
TTCTATTTCACTGTAAACAGTAATGAATATGAAGATATTAAAGGCAAATT
AAATGCGCCATTGAAACACGCAAAAGGAATTATCATTCAACAGACTTTGG
GAGAAAAATTTGCTGAAGCATTCAAAAGTGAGGTCATTAAAAATCCGATT
CCCAGAAACATTGGAATGCCGAACAATTACCTGGCAGAACCTTGTATTGG
CTGTTCACAGACTCAGGCCAATGTCAAACTCGTACAGTCGTGTGCATTCG
ACGGTGATACTGTAAACCACGGCGAAGAAAACTCCACCTGCGGAAAGTGT
TATTGTCGGCCAATGTGGTGTGTAGAATGCCTCGGTCGGTGGTTTGCTTC
TCGGCAGTTGGTGGCCAAAAAAGATCCCGGCGTTTGGATGAGTCAAAAGG
CTTCCTGTCCAACTTGTAGAGCAACGTTTTGTCTGCTGGACGTTGTGGTT
TTGAAAGATTAATGAATAGATAATTTAATTTATATTCCTTTCATCACGAT
GATTATAATTTGTATAAAAGATCTTTTATAGATTATTTTCCAGTCAGTGC
TGTGGTTATTTCATTTGAATTATATTTAAAATTCATTACATATTGATTAT
TGTGCATTTATATTAATTTA
back to top

protein sequence of SMED30012599-orf-1

>SMED30012599-orf-1 ID=SMED30012599-orf-1|Name=SMED30012599-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=398bp
MNLYIMTGSDWTCTLIFIVLVLMFTYPPVTIIASGLTVENLFSFIIGTEQ
KEFVKYHLKRSTLTLVLHSFLPFIYYVYLCNISESMKFLDFHILFWKFYF
QFSLLLPTFACALAFYWYHNHWNKHPIASNIKASFVSDYDNWRNVAVSIN
NEMKNLDKFVSGVVPSKKIIITDNWIVKTNLYSVKFAQQADVELSVEECN
VYSVNTNRSGDDDLVGNISNSSHIYGEVQYLKIAVKNLLNRSIYFYFTVN
SNEYEDIKGKLNAPLKHAKGIIIQQTLGEKFAEAFKSEVIKNPIPRNIGM
PNNYLAEPCIGCSQTQANVKLVQSCAFDGDTVNHGEENSTCGKCYCRPMW
CVECLGRWFASRQLVAKKDPGVWMSQKASCPTCRATFCLLDVVVLKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0061630ubiquitin protein ligase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR018801TM129
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006986response to unfolded protein
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018801E3 ubiquitin-protein ligase TM129PFAMPF10272Tmpp129coord: 23..394
e-value: 6.4E-110
score: 367.8
IPR018801E3 ubiquitin-protein ligase TM129PANTHERPTHR31322FAMILY NOT NAMEDcoord: 8..396
NoneNo IPR availableTMHMMTMhelixcoord: 63..82
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 95..117