Sentrin-specific protease 7

Overview
NameSentrin-specific protease 7
Smed IDSMED30012579
Length (bp)3647
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sentrin-specific protease 7 (SMED30012579) t-SNE clustered cells

Violin plots show distribution of expression levels for Sentrin-specific protease 7 (SMED30012579) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sentrin-specific protease 7 (SMED30012579) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sentrin-specific protease 7 (SMED30012579) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012579

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012579h1SMcG0009484 SmedASXL_016525SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012579h1SMcG0009484 SmedASXL_016525SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sentrin-specific protease 7 vs. Ensembl Human
Match: SENP7 (SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:30402])

HSP 1 Score: 197.593 bits (501), Expect = 3.528e-51
Identity = 115/318 (36.16%), Postives = 171/318 (53.77%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTG--LNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD--QLFGMPNCQISEIPENQSV-----------FSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSR 2885
            RHTG V K   Y P P    L +   DL  L  GE+LND II+FYL Y+  EK + E  ERSH+F+ FFY  L RK      D P     + RH  V  WT+ ++IF+KD+I +P+NE++HW+LA+ICFPW+   +  D  Q     +       +N+++            S +       ++   K +  +PCIL+ DSL+  +    V+ +REYL+ EW+VK         F K  +    P+VP+Q N+ DCG+Y+L YVE FF+ P+  +        L +WF +  ++TKRE I++LIL     +LHL+  +
Sbjct:  576 RHTGLVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTIDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFE---LPIHLEKWFPRHVIKTKREDIRELIL-----KLHLQQQK 882          
BLAST of Sentrin-specific protease 7 vs. Ensembl Human
Match: SENP7 (SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:30402])

HSP 1 Score: 197.978 bits (502), Expect = 5.388e-51
Identity = 115/318 (36.16%), Postives = 171/318 (53.77%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTG--LNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD--QLFGMPNCQISEIPENQSV-----------FSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSR 2885
            RHTG V K   Y P P    L +   DL  L  GE+LND II+FYL Y+  EK + E  ERSH+F+ FFY  L RK      D P     + RH  V  WT+ ++IF+KD+I +P+NE++HW+LA+ICFPW+   +  D  Q     +       +N+++            S +       ++   K +  +PCIL+ DSL+  +    V+ +REYL+ EW+VK         F K  +    P+VP+Q N+ DCG+Y+L YVE FF+ P+  +        L +WF +  ++TKRE I++LIL     +LHL+  +
Sbjct:  675 RHTGLVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTIDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFE---LPIHLEKWFPRHVIKTKREDIRELIL-----KLHLQQQK 981          
BLAST of Sentrin-specific protease 7 vs. Ensembl Human
Match: SENP7 (SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:30402])

HSP 1 Score: 197.978 bits (502), Expect = 5.597e-51
Identity = 115/318 (36.16%), Postives = 171/318 (53.77%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTG--LNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD--QLFGMPNCQISEIPENQSV-----------FSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSR 2885
            RHTG V K   Y P P    L +   DL  L  GE+LND II+FYL Y+  EK + E  ERSH+F+ FFY  L RK      D P     + RH  V  WT+ ++IF+KD+I +P+NE++HW+LA+ICFPW+   +  D  Q     +       +N+++            S +       ++   K +  +PCIL+ DSL+  +    V+ +REYL+ EW+VK         F K  +    P+VP+Q N+ DCG+Y+L YVE FF+ P+  +        L +WF +  ++TKRE I++LIL     +LHL+  +
Sbjct:  707 RHTGLVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTIDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFE---LPIHLEKWFPRHVIKTKREDIRELIL-----KLHLQQQK 1013          
BLAST of Sentrin-specific protease 7 vs. Ensembl Human
Match: SENP7 (SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:30402])

HSP 1 Score: 197.593 bits (501), Expect = 5.803e-51
Identity = 115/318 (36.16%), Postives = 171/318 (53.77%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTG--LNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD--QLFGMPNCQISEIPENQSV-----------FSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSR 2885
            RHTG V K   Y P P    L +   DL  L  GE+LND II+FYL Y+  EK + E  ERSH+F+ FFY  L RK      D P     + RH  V  WT+ ++IF+KD+I +P+NE++HW+LA+ICFPW+   +  D  Q     +       +N+++            S +       ++   K +  +PCIL+ DSL+  +    V+ +REYL+ EW+VK         F K  +    P+VP+Q N+ DCG+Y+L YVE FF+ P+  +        L +WF +  ++TKRE I++LIL     +LHL+  +
Sbjct:  674 RHTGLVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTIDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFE---LPIHLEKWFPRHVIKTKREDIRELIL-----KLHLQQQK 980          
BLAST of Sentrin-specific protease 7 vs. Ensembl Human
Match: SENP7 (SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:30402])

HSP 1 Score: 197.978 bits (502), Expect = 6.090e-51
Identity = 115/318 (36.16%), Postives = 171/318 (53.77%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTG--LNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD--QLFGMPNCQISEIPENQSV-----------FSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSR 2885
            RHTG V K   Y P P    L +   DL  L  GE+LND II+FYL Y+  EK + E  ERSH+F+ FFY  L RK      D P     + RH  V  WT+ ++IF+KD+I +P+NE++HW+LA+ICFPW+   +  D  Q     +       +N+++            S +       ++   K +  +PCIL+ DSL+  +    V+ +REYL+ EW+VK         F K  +    P+VP+Q N+ DCG+Y+L YVE FF+ P+  +        L +WF +  ++TKRE I++LIL     +LHL+  +
Sbjct:  740 RHTGLVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTIDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFE---LPIHLEKWFPRHVIKTKREDIRELIL-----KLHLQQQK 1046          
BLAST of Sentrin-specific protease 7 vs. Ensembl Celegans
Match: ulp-2 (Ubiquitin-like protease 2 [Source:UniProtKB/Swiss-Prot;Acc:Q23238])

HSP 1 Score: 92.4337 bits (228), Expect = 1.274e-18
Identity = 81/291 (27.84%), Postives = 128/291 (43.99%), Query Frame = 3
Query: 2052 VLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKT-----GLNDTPESRHADVAK--------WTKKVDIFDKDFIVIPINENNHWFLAIICFPWMA--GMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLF-DSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTI---RGFNPQVPQQTNTIDCGIYVLHYVEMFFEHP-LSVYTKEYFQTSLTEWFDK--KTVETKREFIQKLILQKAE 2858
            V++   D+  L+  E+LND+++ F LNYI F  ++ E  +  H+ N F +  L R             E  H  + K        WT+K D+  KD+I+IPINE+ HW +  +  P  A   M + +     P C I        VF      + L  L   K      CI ++   L   T+AP +K               A   P ++D+  +   R  N   P Q N  DCG+YVLH++E  F +P   V   ++     +++F +  K  +  R+ +  LILQ+A+
Sbjct:  539 VVLLVKDIKTLDRKEFLNDSVMAFMLNYIAF-MLSSELMKSVHMCNTFLFVNLTRLLPPLCFSKRRPIEPEHIKIVKDNCPRVLRWTRKFDVLAKDYIIIPINEDLHWLVIAVINPSGAIVDMSNEEASRAAPKCYI--------VF-----FDPLSGLDPSKKNHMCHCIKIYLAQLYENTKAPGMKF--------------ASKNPTIYDEERVVVTRAEN--TPIQDNFYDCGLYVLHFIEGLFCYPNRPVNVNDFPNFDWSKFFPEANKMCDLMRDKVYNLILQQAD 799          
BLAST of Sentrin-specific protease 7 vs. Ensembl Celegans
Match: ulp-2 (Ubiquitin-like protease 2 [Source:UniProtKB/Swiss-Prot;Acc:Q23238])

HSP 1 Score: 92.4337 bits (228), Expect = 1.274e-18
Identity = 81/291 (27.84%), Postives = 128/291 (43.99%), Query Frame = 3
Query: 2052 VLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKT-----GLNDTPESRHADVAK--------WTKKVDIFDKDFIVIPINENNHWFLAIICFPWMA--GMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLF-DSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTI---RGFNPQVPQQTNTIDCGIYVLHYVEMFFEHP-LSVYTKEYFQTSLTEWFDK--KTVETKREFIQKLILQKAE 2858
            V++   D+  L+  E+LND+++ F LNYI F  ++ E  +  H+ N F +  L R             E  H  + K        WT+K D+  KD+I+IPINE+ HW +  +  P  A   M + +     P C I        VF      + L  L   K      CI ++   L   T+AP +K               A   P ++D+  +   R  N   P Q N  DCG+YVLH++E  F +P   V   ++     +++F +  K  +  R+ +  LILQ+A+
Sbjct:  539 VVLLVKDIKTLDRKEFLNDSVMAFMLNYIAF-MLSSELMKSVHMCNTFLFVNLTRLLPPLCFSKRRPIEPEHIKIVKDNCPRVLRWTRKFDVLAKDYIIIPINEDLHWLVIAVINPSGAIVDMSNEEASRAAPKCYI--------VF-----FDPLSGLDPSKKNHMCHCIKIYLAQLYENTKAPGMKF--------------ASKNPTIYDEERVVVTRAEN--TPIQDNFYDCGLYVLHFIEGLFCYPNRPVNVNDFPNFDWSKFFPEANKMCDLMRDKVYNLILQQAD 799          
BLAST of Sentrin-specific protease 7 vs. Ensembl Celegans
Match: ulp-2 (Ubiquitin-like protease 2 [Source:UniProtKB/Swiss-Prot;Acc:Q23238])

HSP 1 Score: 91.6633 bits (226), Expect = 1.746e-18
Identity = 81/291 (27.84%), Postives = 128/291 (43.99%), Query Frame = 3
Query: 2052 VLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKT-----GLNDTPESRHADVAK--------WTKKVDIFDKDFIVIPINENNHWFLAIICFPWMA--GMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLF-DSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTI---RGFNPQVPQQTNTIDCGIYVLHYVEMFFEHP-LSVYTKEYFQTSLTEWFDK--KTVETKREFIQKLILQKAE 2858
            V++   D+  L+  E+LND+++ F LNYI F  ++ E  +  H+ N F +  L R             E  H  + K        WT+K D+  KD+I+IPINE+ HW +  +  P  A   M + +     P C I        VF      + L  L   K      CI ++   L   T+AP +K               A   P ++D+  +   R  N   P Q N  DCG+YVLH++E  F +P   V   ++     +++F +  K  +  R+ +  LILQ+A+
Sbjct:  357 VVLLVKDIKTLDRKEFLNDSVMAFMLNYIAF-MLSSELMKSVHMCNTFLFVNLTRLLPPLCFSKRRPIEPEHIKIVKDNCPRVLRWTRKFDVLAKDYIIIPINEDLHWLVIAVINPSGAIVDMSNEEASRAAPKCYI--------VF-----FDPLSGLDPSKKNHMCHCIKIYLAQLYENTKAPGMKF--------------ASKNPTIYDEERVVVTRAEN--TPIQDNFYDCGLYVLHFIEGLFCYPNRPVNVNDFPNFDWSKFFPEANKMCDLMRDKVYNLILQQAD 617          
BLAST of Sentrin-specific protease 7 vs. Ensembl Celegans
Match: ulp-2 (Ubiquitin-like protease 2 [Source:UniProtKB/Swiss-Prot;Acc:Q23238])

HSP 1 Score: 91.6633 bits (226), Expect = 1.746e-18
Identity = 81/291 (27.84%), Postives = 128/291 (43.99%), Query Frame = 3
Query: 2052 VLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKT-----GLNDTPESRHADVAK--------WTKKVDIFDKDFIVIPINENNHWFLAIICFPWMA--GMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLF-DSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTI---RGFNPQVPQQTNTIDCGIYVLHYVEMFFEHP-LSVYTKEYFQTSLTEWFDK--KTVETKREFIQKLILQKAE 2858
            V++   D+  L+  E+LND+++ F LNYI F  ++ E  +  H+ N F +  L R             E  H  + K        WT+K D+  KD+I+IPINE+ HW +  +  P  A   M + +     P C I        VF      + L  L   K      CI ++   L   T+AP +K               A   P ++D+  +   R  N   P Q N  DCG+YVLH++E  F +P   V   ++     +++F +  K  +  R+ +  LILQ+A+
Sbjct:  357 VVLLVKDIKTLDRKEFLNDSVMAFMLNYIAF-MLSSELMKSVHMCNTFLFVNLTRLLPPLCFSKRRPIEPEHIKIVKDNCPRVLRWTRKFDVLAKDYIIIPINEDLHWLVIAVINPSGAIVDMSNEEASRAAPKCYI--------VF-----FDPLSGLDPSKKNHMCHCIKIYLAQLYENTKAPGMKF--------------ASKNPTIYDEERVVVTRAEN--TPIQDNFYDCGLYVLHFIEGLFCYPNRPVNVNDFPNFDWSKFFPEANKMCDLMRDKVYNLILQQAD 617          
BLAST of Sentrin-specific protease 7 vs. Ensembl Celegans
Match: ulp-2 (Ubiquitin-like protease 2 [Source:UniProtKB/Swiss-Prot;Acc:Q23238])

HSP 1 Score: 75.485 bits (184), Expect = 3.411e-14
Identity = 73/270 (27.04%), Postives = 114/270 (42.22%), Query Frame = 3
Query: 2115 INFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKT-----GLNDTPESRHADVAK--------WTKKVDIFDKDFIVIPINENNHWFLAIICFP--WMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLF-DSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTI---RGFNPQVPQQTNTIDCGIYVLHYVEMFFEHP-LSVYTKEYFQTSLTEWFDK--KTVETKREFIQKLILQKAE 2858
            + F LNYI F  ++ E  +  H+ N F +  L R             E  H  + K        WT+K D+  KD+I+IPINE+ HW +  +  P   +  M + +     P C I        VF      + L  L   K      CI ++   L   T+AP +K               A   P ++D+  +   R  N   P Q N  DCG+YVLH++E  F +P   V   ++     +++F +  K  +  R+ +  LILQ+A+
Sbjct:    1 MAFMLNYIAF-MLSSELMKSVHMCNTFLFVNLTRLLPPLCFSKRRPIEPEHIKIVKDNCPRVLRWTRKFDVLAKDYIIIPINEDLHWLVIAVINPSGAIVDMSNEEASRAAPKCYI--------VF-----FDPLSGLDPSKKNHMCHCIKIYLAQLYENTKAPGMKF--------------ASKNPTIYDEERVVVTRAEN--TPIQDNFYDCGLYVLHFIEGLFCYPNRPVNVNDFPNFDWSKFFPEANKMCDLMRDKVYNLILQQAD 240          
BLAST of Sentrin-specific protease 7 vs. Ensembl Fly
Match: CG12717 (gene:FBgn0030420 transcript:FBtr0073704)

HSP 1 Score: 177.563 bits (449), Expect = 7.771e-46
Identity = 105/281 (37.37%), Postives = 151/281 (53.74%), Query Frame = 3
Query: 2022 FNYSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES----RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQIS---EIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLI 2843
            F Y P+    + +   D   L+ G YLND II+FYL +++   I +EQR+R+H+F+ FF+ +L  +T   +T ++    RH  V KWT+ V+IFDKDFI+IP NE +HW LAIIC+P +   +  +      N Q +   +IP  Q                        P IL+FDSL   +R   + ++R+YL  E   K        VF+K+ + G + +VPQQ N  DCG+Y+L YVE FF  P++ YT    +  L+ WFD  TV  KRE I  LI
Sbjct:  371 FTYPPTGTGGLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNN-----NVQTTLSDDIPIKQ------------------------PLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALA-HVFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKE--LSNWFDLLTVTKKREDIANLI 619          
BLAST of Sentrin-specific protease 7 vs. Ensembl Fly
Match: CG12717 (gene:FBgn0030420 transcript:FBtr0346120)

HSP 1 Score: 177.563 bits (449), Expect = 7.771e-46
Identity = 105/281 (37.37%), Postives = 151/281 (53.74%), Query Frame = 3
Query: 2022 FNYSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES----RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQIS---EIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLI 2843
            F Y P+    + +   D   L+ G YLND II+FYL +++   I +EQR+R+H+F+ FF+ +L  +T   +T ++    RH  V KWT+ V+IFDKDFI+IP NE +HW LAIIC+P +   +  +      N Q +   +IP  Q                        P IL+FDSL   +R   + ++R+YL  E   K        VF+K+ + G + +VPQQ N  DCG+Y+L YVE FF  P++ YT    +  L+ WFD  TV  KRE I  LI
Sbjct:  371 FTYPPTGTGGLSITIKDFMCLSKGSYLNDIIIDFYLRWLKNNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNEQSHWILAIICYPNLRSPVVNNN-----NVQTTLSDDIPIKQ------------------------PLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALA-HVFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKE--LSNWFDLLTVTKKREDIANLI 619          
BLAST of Sentrin-specific protease 7 vs. Ensembl Fly
Match: velo (gene:FBgn0035713 transcript:FBtr0076952)

HSP 1 Score: 127.102 bits (318), Expect = 6.085e-29
Identity = 60/124 (48.39%), Postives = 79/124 (63.71%), Query Frame = 3
Query: 2028 YSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFY---TKLQRKTGLNDTP-ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD 2387
            Y P     + +   D   L    YLND II+FYL ++R   I + QRER+H+F+ FFY   T L R   +  T  + RHA V KWTK VDIFDKDFI++PINE +HWFLAIIC+P + G +++D
Sbjct: 1319 YPPKGTGGLCIRMEDFVCLTKESYLNDIIIDFYLLWLRNTLIPEPQRERTHIFSTFFYKRLTTLTRPADMKQTAAQKRHARVQKWTKGVDIFDKDFIIVPINEQSHWFLAIICYPNLKGPVTFD 1442          

HSP 2 Score: 90.8929 bits (224), Expect = 6.223e-18
Identity = 56/133 (42.11%), Postives = 74/133 (55.64%), Query Frame = 3
Query: 2508 KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSRENNLISP 2906
            +P IL+FDSL   +R+  V  +R+YL  E+ VK+       VF+K+ + G   +VPQQ N  DCG+Y+L YVE FF  P+  Y     Q  LT WFD  TV  KRE I  LI      QL  E +++  LI P
Sbjct: 1562 QPLILIFDSLAGASRSRVVATLRDYLTCEYRVKKPDAQA-HVFNKDNMPGHCVKVPQQNNFTDCGLYLLQYVEQFFGEPIRDYRLPIKQ--LTNWFDFLTVTKKREDIANLIQ-----QLMDEGNQQQRLILP 1686          
BLAST of Sentrin-specific protease 7 vs. Ensembl Fly
Match: velo (gene:FBgn0035713 transcript:FBtr0076950)

HSP 1 Score: 127.102 bits (318), Expect = 6.085e-29
Identity = 60/124 (48.39%), Postives = 79/124 (63.71%), Query Frame = 3
Query: 2028 YSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFY---TKLQRKTGLNDTP-ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD 2387
            Y P     + +   D   L    YLND II+FYL ++R   I + QRER+H+F+ FFY   T L R   +  T  + RHA V KWTK VDIFDKDFI++PINE +HWFLAIIC+P + G +++D
Sbjct: 1319 YPPKGTGGLCIRMEDFVCLTKESYLNDIIIDFYLLWLRNTLIPEPQRERTHIFSTFFYKRLTTLTRPADMKQTAAQKRHARVQKWTKGVDIFDKDFIIVPINEQSHWFLAIICYPNLKGPVTFD 1442          

HSP 2 Score: 90.8929 bits (224), Expect = 6.223e-18
Identity = 56/133 (42.11%), Postives = 74/133 (55.64%), Query Frame = 3
Query: 2508 KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSRENNLISP 2906
            +P IL+FDSL   +R+  V  +R+YL  E+ VK+       VF+K+ + G   +VPQQ N  DCG+Y+L YVE FF  P+  Y     Q  LT WFD  TV  KRE I  LI      QL  E +++  LI P
Sbjct: 1562 QPLILIFDSLAGASRSRVVATLRDYLTCEYRVKKPDAQA-HVFNKDNMPGHCVKVPQQNNFTDCGLYLLQYVEQFFGEPIRDYRLPIKQ--LTNWFDFLTVTKKREDIANLIQ-----QLMDEGNQQQRLILP 1686          
BLAST of Sentrin-specific protease 7 vs. Ensembl Fly
Match: velo (gene:FBgn0035713 transcript:FBtr0076951)

HSP 1 Score: 124.79 bits (312), Expect = 1.026e-28
Identity = 60/124 (48.39%), Postives = 79/124 (63.71%), Query Frame = 3
Query: 2028 YSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFY---TKLQRKTGLNDTP-ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD 2387
            Y P     + +   D   L    YLND II+FYL ++R   I + QRER+H+F+ FFY   T L R   +  T  + RHA V KWTK VDIFDKDFI++PINE +HWFLAIIC+P + G +++D
Sbjct:  197 YPPKGTGGLCIRMEDFVCLTKESYLNDIIIDFYLLWLRNTLIPEPQRERTHIFSTFFYKRLTTLTRPADMKQTAAQKRHARVQKWTKGVDIFDKDFIIVPINEQSHWFLAIICYPNLKGPVTFD 320          

HSP 2 Score: 89.3521 bits (220), Expect = 9.878e-18
Identity = 56/133 (42.11%), Postives = 74/133 (55.64%), Query Frame = 3
Query: 2508 KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSRENNLISP 2906
            +P IL+FDSL   +R+  V  +R+YL  E+ VK+       VF+K+ + G   +VPQQ N  DCG+Y+L YVE FF  P+  Y     Q  LT WFD  TV  KRE I  LI      QL  E +++  LI P
Sbjct:  440 QPLILIFDSLAGASRSRVVATLRDYLTCEYRVKKPDAQA-HVFNKDNMPGHCVKVPQQNNFTDCGLYLLQYVEQFFGEPIRDYRLPIKQ--LTNWFDFLTVTKKREDIANLIQ-----QLMDEGNQQQRLILP 564          
BLAST of Sentrin-specific protease 7 vs. Ensembl Zebrafish
Match: si:dkey-100n23.3 (si:dkey-100n23.3 [Source:ZFIN;Acc:ZDB-GENE-070912-345])

HSP 1 Score: 181.415 bits (459), Expect = 4.762e-46
Identity = 107/332 (32.23%), Postives = 162/332 (48.80%), Query Frame = 3
Query: 1962 SANKPLQYIPGRHTGNVFKSFNYSPSPEHSVLMFGS-DLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES------RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAG--MISYDQLFGMPNCQISEIPE-------------NQSVFSQKTRVERLRSLRTQKNIE---------PKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQ 2864
            +A    ++ P +H G   +   + P P    L   + DL  L+ GE+LND II+FYL Y+  +K  Q    RSH+F+ FFY +L R+   N+   S      RH  V  WT+ VDIF+KDF+ +P+N+  HW+L +ICFP +     +  D    +      ++ E             ++   +  +R++   SLR     E          +PCIL+ DSL+        KL+REYL+ EW+ KR    G   F    + G + +VP Q N+ DCG+Y+L Y E F + P+  +        L  WF ++ V  KR+ I+ LIL    FQ
Sbjct:  646 AATPGAEWTPYKHCGPTRRLIQFPPPPSKGALTVTTEDLECLDSGEFLNDVIIDFYLKYLLVQKAPQASVARSHIFSSFFYKQLTRRDNANEDSTSTPAQVRRHQRVRTWTRHVDIFEKDFLFVPVNQEAHWYLVVICFPGLEDPQYVKRDDSASVQGNGGEDVGESENETQGDHRSNSDEDKSTDDSRIKSSTSLRQPDCTENTCKKDVVLKRPCILIMDSLKLSIHERIFKLLREYLQVEWETKRM---GTRDFSAERMVGSHCKVPLQDNSSDCGLYLLQYAESFLQDPVVHFD---LPLRLERWFPRQQVRGKRDEIRDLILHLYRFQ 971          
BLAST of Sentrin-specific protease 7 vs. Ensembl Zebrafish
Match: senp7b (SUMO specific peptidase 7b [Source:ZFIN;Acc:ZDB-GENE-060531-45])

HSP 1 Score: 173.326 bits (438), Expect = 1.339e-43
Identity = 102/303 (33.66%), Postives = 159/303 (52.48%), Query Frame = 3
Query: 2022 FNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRK--TGLNDTPES----RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMA--GMISYDQLFGMPNCQISEIPENQSVFSQK----------TRVERLRSLR---------TQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLIL 2846
              Y P P +  + +   DL  L  GE+LND II+FYL Y+  E+  ++  ERSH+F+ FFY +L RK  +G  +T  +    RH  V  WT+ VDIF KD++ IP+N   HW+L +ICFP +    ++ + Q   +   +     E  S  SQ+          +++   RS           T++ I  +PCIL+ DSL+         L+REYL+ EW+V++ +      F   +I G   +VP Q N+ DCG+Y+L YVE F ++P+  +        L +WF +  V  KRE +++L+L
Sbjct:  571 IQYPPPPSKGGITVTTEDLECLKDGEFLNDVIIDFYLKYLLLERADKDIAERSHIFSSFFYKQLTRKDTSGPEETGSTSAYRRHQRVRTWTRHVDIFSKDYLFIPVNHEAHWYLVLICFPALERPQIVEWRQKSSVSQDESQTTKERPSGESQRESSQQPKGNPSKINESRSHNLPDCTVHSCTKETICKRPCILIMDSLKLSYHQRTYTLLREYLQVEWEVRKGSCRS---FSNESITGSLCRVPLQDNSSDCGLYLLQYVESFLQNPVVDFA---LPLRLDQWFPRSQVRKKREDLRELVL 867          
BLAST of Sentrin-specific protease 7 vs. Ensembl Zebrafish
Match: senp6b (SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GENE-030131-6330])

HSP 1 Score: 158.303 bits (399), Expect = 4.321e-40
Identity = 101/323 (31.27%), Postives = 163/323 (50.46%), Query Frame = 3
Query: 2028 YSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKL-----QRKTGLNDTP--ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD--------------------------QLFGMPNC---------QISEIPENQSVFSQKTRVERLR------SLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQ 2849
            Y PSP +  + +   D   L+ GE+LND I++FYL Y+  ++  ++   + H+F+ FF+  L     +R +G       E RH  V  WT+ V++F+KDF+ +PIN+ +HW+LA+ICFP   G IS                             LF  P            I ++ ++  + S     + L+       L    ++  KPCIL+ DSL    R+  V+++++YL+ EW VK  ++     F+K  + G++P VP+Q N  DCGIY+L YVE F + P   +   +    L  WF ++TV+ KR  I++LIL+
Sbjct:  233 YPPSPAKGGITVTEEDFYCLDEGEFLNDVIVDFYLRYLVCKQQEKKDTTQYHVFSSFFFKHLTQGNQKRHSGATSLSPQECRHDRVKTWTRNVNLFEKDFVFVPINQMSHWYLAVICFP---GQISQTSGLDLSLNERRHSRQYLCAPSPPNPMSLFYSPESSKQLSRWSQSIDDLDQSFEILSDDEAEDDLQVVTNRSVLNRGSDVSKKPCILIMDSLTSSGRSSEVQILQQYLQEEWRVKMGSQQS---FEK--MHGWSPIVPKQDNYTDCGIYLLQYVESFLKDPPQAF---HHNMDLKGWFSQRTVKRKRLQIKELILK 544          
BLAST of Sentrin-specific protease 7 vs. Ensembl Zebrafish
Match: senp6b (SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GENE-030131-6330])

HSP 1 Score: 158.303 bits (399), Expect = 5.438e-40
Identity = 101/323 (31.27%), Postives = 163/323 (50.46%), Query Frame = 3
Query: 2028 YSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKL-----QRKTGLNDTP--ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD--------------------------QLFGMPNC---------QISEIPENQSVFSQKTRVERLR------SLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQ 2849
            Y PSP +  + +   D   L+ GE+LND I++FYL Y+  ++  ++   + H+F+ FF+  L     +R +G       E RH  V  WT+ V++F+KDF+ +PIN+ +HW+LA+ICFP   G IS                             LF  P            I ++ ++  + S     + L+       L    ++  KPCIL+ DSL    R+  V+++++YL+ EW VK  ++     F+K  + G++P VP+Q N  DCGIY+L YVE F + P   +   +    L  WF ++TV+ KR  I++LIL+
Sbjct:  249 YPPSPAKGGITVTEEDFYCLDEGEFLNDVIVDFYLRYLVCKQQEKKDTTQYHVFSSFFFKHLTQGNQKRHSGATSLSPQECRHDRVKTWTRNVNLFEKDFVFVPINQMSHWYLAVICFP---GQISQTSGLDLSLNERRHSRQYLCAPSPPNPMSLFYSPESSKQLSRWSQSIDDLDQSFEILSDDEAEDDLQVVTNRSVLNRGSDVSKKPCILIMDSLTSSGRSSEVQILQQYLQEEWRVKMGSQQS---FEK--MHGWSPIVPKQDNYTDCGIYLLQYVESFLKDPPQAF---HHNMDLKGWFSQRTVKRKRLQIKELILK 560          
BLAST of Sentrin-specific protease 7 vs. Ensembl Zebrafish
Match: senp6b (SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GENE-030131-6330])

HSP 1 Score: 159.073 bits (401), Expect = 1.230e-39
Identity = 101/323 (31.27%), Postives = 163/323 (50.46%), Query Frame = 3
Query: 2028 YSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKL-----QRKTGLNDTP--ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD--------------------------QLFGMPNC---------QISEIPENQSVFSQKTRVERLR------SLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQ 2849
            Y PSP +  + +   D   L+ GE+LND I++FYL Y+  ++  ++   + H+F+ FF+  L     +R +G       E RH  V  WT+ V++F+KDF+ +PIN+ +HW+LA+ICFP   G IS                             LF  P            I ++ ++  + S     + L+       L    ++  KPCIL+ DSL    R+  V+++++YL+ EW VK  ++     F+K  + G++P VP+Q N  DCGIY+L YVE F + P   +   +    L  WF ++TV+ KR  I++LIL+
Sbjct:  367 YPPSPAKGGITVTEEDFYCLDEGEFLNDVIVDFYLRYLVCKQQEKKDTTQYHVFSSFFFKHLTQGNQKRHSGATSLSPQECRHDRVKTWTRNVNLFEKDFVFVPINQMSHWYLAVICFP---GQISQTSGLDLSLNERRHSRQYLCAPSPPNPMSLFYSPESSKQLSRWSQSIDDLDQSFEILSDDEAEDDLQVVTNRSVLNRGSDVSKKPCILIMDSLTSSGRSSEVQILQQYLQEEWRVKMGSQQS---FEK--MHGWSPIVPKQDNYTDCGIYLLQYVESFLKDPPQAF---HHNMDLKGWFSQRTVKRKRLQIKELILK 678          
BLAST of Sentrin-specific protease 7 vs. Ensembl Xenopus
Match: tspan9 (tetraspanin 9 [Source:Xenbase;Acc:XB-GENE-956624])

HSP 1 Score: 201.83 bits (512), Expect = 1.125e-52
Identity = 122/338 (36.09%), Postives = 175/338 (51.78%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVLMF-GSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKT-GLNDTPES------RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGM------ISYDQLFGMPNCQISEIPENQSVFS------------------------------QKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLE 2876
            RH G++ K   Y P P    L     DL  L +GE+LND II+FYL Y+  E+  +   ERSH+F+ FFY  L RK    N++  S      RH  V  WT+ VDIF KDFI +P+NEN+HW+LA+ICFPW+              L G P  + S    +  VF+                              +K+RV+ L    T   +  +PC+L+FDSL+  +    V+++REYLK EW+VKR        F ++ +R F P+VP+Q N+ DCG+++L YVE F + P+  +        L +WF    V++KRE I+ LIL     +LHL+
Sbjct:  532 RHAGSLLKLIVYPPPPTKGGLCVTNEDLDCLEHGEFLNDVIIDFYLKYLLLERFPKHFAERSHIFSSFFYKCLTRKEIAANESCASLPAAQRRHQRVKTWTRHVDIFTKDFIFVPVNENSHWYLAVICFPWLESAEFEERNFDSTNLCGKPPKEASNTTCSVIVFNDHLEKEEETIVDDSSSDDSTRPSPHSGSNKKKSRVKVL----TCDFVLSRPCLLIFDSLKSGSVQTTVQVLREYLKVEWEVKRKTMRE---FSRSNMRDFYPKVPKQNNSTDCGLFLLQYVESFVQQPIENFDSPIH---LEDWFPLTVVKSKREEIRDLIL-----KLHLQ 854          
BLAST of Sentrin-specific protease 7 vs. Ensembl Xenopus
Match: ENSXETT00000010046.1 (sentrin-specific protease 6-like [Source:NCBI gene;Acc:101730522])

HSP 1 Score: 112.849 bits (281), Expect = 1.399e-26
Identity = 59/129 (45.74%), Postives = 80/129 (62.02%), Query Frame = 3
Query: 2004 GNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKL--QRKTGLNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWM 2366
            G V K F Y P P +  + +   DL  LN GE+LND II+FYL Y+  EK+ ++  +R H+F+ FFY +L  + +  L DT      + RH  V  WT+ VDIF KDFI +P+NE  HWFLA+ICFP +
Sbjct:   25 GPVEKLFVYPPPPAKGGISVTNEDLHCLNEGEFLNDVIIDFYLKYLVLEKLRKDA-DRIHIFSSFFYKRLNQRERRNLQDTANLTLQQRRHGRVKTWTRHVDIFQKDFIFVPLNEAAHWFLAVICFPGL 152          
BLAST of Sentrin-specific protease 7 vs. Ensembl Xenopus
Match: ENSXETT00000010018.1 (sentrin-specific protease 6-like [Source:NCBI gene;Acc:101730522])

HSP 1 Score: 113.235 bits (282), Expect = 6.424e-26
Identity = 59/129 (45.74%), Postives = 80/129 (62.02%), Query Frame = 3
Query: 2004 GNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKL--QRKTGLNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWM 2366
            G V K F Y P P +  + +   DL  LN GE+LND II+FYL Y+  EK+ ++  +R H+F+ FFY +L  + +  L DT      + RH  V  WT+ VDIF KDFI +P+NE  HWFLA+ICFP +
Sbjct:  109 GPVEKLFVYPPPPAKGGISVTNEDLHCLNEGEFLNDVIIDFYLKYLVLEKLRKDA-DRIHIFSSFFYKRLNQRERRNLQDTANLTLQQRRHGRVKTWTRHVDIFQKDFIFVPLNEAAHWFLAVICFPGL 236          
BLAST of Sentrin-specific protease 7 vs. Ensembl Xenopus
Match: septin2 (septin 2 [Source:Xenbase;Acc:XB-GENE-480201])

HSP 1 Score: 114.775 bits (286), Expect = 4.158e-25
Identity = 59/129 (45.74%), Postives = 80/129 (62.02%), Query Frame = 3
Query: 2004 GNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKL--QRKTGLNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWM 2366
            G V K F Y P P +  + +   DL  LN GE+LND II+FYL Y+  EK+ ++  +R H+F+ FFY +L  + +  L DT      + RH  V  WT+ VDIF KDFI +P+NE  HWFLA+ICFP +
Sbjct:  668 GPVEKLFVYPPPPAKGGISVTNEDLHCLNEGEFLNDVIIDFYLKYLVLEKLRKDA-DRIHIFSSFFYKRLNQRERRNLQDTANLTLQQRRHGRVKTWTRHVDIFQKDFIFVPLNEAAHWFLAVICFPGL 795          

HSP 2 Score: 107.842 bits (268), Expect = 5.564e-23
Identity = 51/113 (45.13%), Postives = 78/113 (69.03%), Query Frame = 3
Query: 2508 KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLIL 2846
            +PCILL DSL+  +R+  VK +REYL+ EW+V++ +K     F K+ ++G +P+VPQQ N  DCG+Y+L YVE FFE+P+  +       +L +WF ++ ++TKRE I+ LIL
Sbjct:  976 QPCILLMDSLKGPSRSTVVKTLREYLEVEWEVRKGSKRS---FSKDFMKGSSPRVPQQNNFSDCGVYILQYVESFFENPIQSFD---LPMNLMDWFPQQRMKTKREEIRNLIL 1082          
BLAST of Sentrin-specific protease 7 vs. Ensembl Xenopus
Match: septin2 (septin 2 [Source:Xenbase;Acc:XB-GENE-480201])

HSP 1 Score: 114.775 bits (286), Expect = 4.320e-25
Identity = 59/129 (45.74%), Postives = 80/129 (62.02%), Query Frame = 3
Query: 2004 GNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKL--QRKTGLNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWM 2366
            G V K F Y P P +  + +   DL  LN GE+LND II+FYL Y+  EK+ ++  +R H+F+ FFY +L  + +  L DT      + RH  V  WT+ VDIF KDFI +P+NE  HWFLA+ICFP +
Sbjct:  662 GPVEKLFVYPPPPAKGGISVTNEDLHCLNEGEFLNDVIIDFYLKYLVLEKLRKDA-DRIHIFSSFFYKRLNQRERRNLQDTANLTLQQRRHGRVKTWTRHVDIFQKDFIFVPLNEAAHWFLAVICFPGL 789          

HSP 2 Score: 107.842 bits (268), Expect = 5.784e-23
Identity = 51/113 (45.13%), Postives = 78/113 (69.03%), Query Frame = 3
Query: 2508 KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLIL 2846
            +PCILL DSL+  +R+  VK +REYL+ EW+V++ +K     F K+ ++G +P+VPQQ N  DCG+Y+L YVE FFE+P+  +       +L +WF ++ ++TKRE I+ LIL
Sbjct:  970 QPCILLMDSLKGPSRSTVVKTLREYLEVEWEVRKGSKRS---FSKDFMKGSSPRVPQQNNFSDCGVYILQYVESFFENPIQSFD---LPMNLMDWFPQQRMKTKREEIRNLIL 1076          
BLAST of Sentrin-specific protease 7 vs. Ensembl Mouse
Match: Senp7 (SUMO1/sentrin specific peptidase 7 [Source:MGI Symbol;Acc:MGI:1913565])

HSP 1 Score: 199.134 bits (505), Expect = 1.968e-51
Identity = 116/322 (36.02%), Postives = 171/322 (53.11%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTG--LNDTPE-----SRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMI-----------------SYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSR 2885
            R+TG V K   Y P P    L +   DL  L  GE+LND II+FYL Y+  EK + E  ERSH+F+ FFY  L RK      D P+      RH  V  WT+ ++IF+KD+I +P+NE++HW+LA+ICFPW+   +                  +D      +   +      +  SQ T V    ++   K +  +PCIL+ DSL+  +    V+ +REYL+ EW+VKR        F K  +    P+VP+Q N+ DCG+Y+L YVE FF+ P+  +        L +WF +  ++TKRE I++LIL     +LHL+  +
Sbjct:  727 RNTGPVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLLLEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPDLSVAQRRHRRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDCPQTVSQQFQGQQSQHDHKMTDNDPHTTSTVSTSAEDSQSTEV----NMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHRE---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFE---LPIHLEKWFPRHVIKTKREDIRELIL-----KLHLQQQK 1033          
BLAST of Sentrin-specific protease 7 vs. Ensembl Mouse
Match: Senp7 (SUMO1/sentrin specific peptidase 7 [Source:MGI Symbol;Acc:MGI:1913565])

HSP 1 Score: 198.749 bits (504), Expect = 1.994e-51
Identity = 116/322 (36.02%), Postives = 171/322 (53.11%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTG--LNDTPE-----SRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMI-----------------SYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSR 2885
            R+TG V K   Y P P    L +   DL  L  GE+LND II+FYL Y+  EK + E  ERSH+F+ FFY  L RK      D P+      RH  V  WT+ ++IF+KD+I +P+NE++HW+LA+ICFPW+   +                  +D      +   +      +  SQ T V    ++   K +  +PCIL+ DSL+  +    V+ +REYL+ EW+VKR        F K  +    P+VP+Q N+ DCG+Y+L YVE FF+ P+  +        L +WF +  ++TKRE I++LIL     +LHL+  +
Sbjct:  700 RNTGPVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLLLEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPDLSVAQRRHRRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDCPQTVSQQFQGQQSQHDHKMTDNDPHTTSTVSTSAEDSQSTEV----NMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHRE---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFE---LPIHLEKWFPRHVIKTKREDIRELIL-----KLHLQQQK 1006          
BLAST of Sentrin-specific protease 7 vs. Ensembl Mouse
Match: Senp6 (SUMO/sentrin specific peptidase 6 [Source:MGI Symbol;Acc:MGI:1922075])

HSP 1 Score: 115.546 bits (288), Expect = 1.576e-25
Identity = 57/130 (43.85%), Postives = 80/130 (61.54%), Query Frame = 3
Query: 2004 GNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES--------RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWM 2366
            G V K   Y P P +  + +   DL  L+ GE+LND II+FYL Y+  EK+ +E  +R H+F+ FFY +L ++   N  PE+        RH  V  WT+ VDIF+KDFI +P+NE  HWFLA++CFP +
Sbjct:  503 GPVEKLIVYPPPPAKGGISVTNEDLHCLSEGEFLNDVIIDFYLKYLVLEKLKKEDADRIHIFSSFFYKRLNQRERRN--PETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLNEAAHWFLAVVCFPGL 630          

HSP 2 Score: 108.612 bits (270), Expect = 2.417e-23
Identity = 55/119 (46.22%), Postives = 79/119 (66.39%), Query Frame = 3
Query: 2508 KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQ 2864
            +PCILL DSL+  +R+  VK++REYL+ EW+VK+ +K     F K+ ++G NP+VPQQ N  DCG+YVL YVE FFE+P+  +       +L  WF    ++TKRE I+ +IL+  E Q
Sbjct:  823 QPCILLMDSLRGPSRSNVVKILREYLEVEWEVKKGSKRS---FSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPVLNFE---LPMNLMNWFPPPRMKTKREEIRNIILKLQESQ 935          
BLAST of Sentrin-specific protease 7 vs. Ensembl Mouse
Match: Senp6 (SUMO/sentrin specific peptidase 6 [Source:MGI Symbol;Acc:MGI:1922075])

HSP 1 Score: 115.546 bits (288), Expect = 1.806e-25
Identity = 57/130 (43.85%), Postives = 80/130 (61.54%), Query Frame = 3
Query: 2004 GNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES--------RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWM 2366
            G V K   Y P P +  + +   DL  L+ GE+LND II+FYL Y+  EK+ +E  +R H+F+ FFY +L ++   N  PE+        RH  V  WT+ VDIF+KDFI +P+NE  HWFLA++CFP +
Sbjct:  676 GPVEKLIVYPPPPAKGGISVTNEDLHCLSEGEFLNDVIIDFYLKYLVLEKLKKEDADRIHIFSSFFYKRLNQRERRN--PETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLNEAAHWFLAVVCFPGL 803          

HSP 2 Score: 108.997 bits (271), Expect = 2.162e-23
Identity = 55/119 (46.22%), Postives = 79/119 (66.39%), Query Frame = 3
Query: 2508 KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQ 2864
            +PCILL DSL+  +R+  VK++REYL+ EW+VK+ +K     F K+ ++G NP+VPQQ N  DCG+YVL YVE FFE+P+  +       +L  WF    ++TKRE I+ +IL+  E Q
Sbjct:  996 QPCILLMDSLRGPSRSNVVKILREYLEVEWEVKKGSKRS---FSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPVLNFE---LPMNLMNWFPPPRMKTKREEIRNIILKLQESQ 1108          
BLAST of Sentrin-specific protease 7 vs. Ensembl Mouse
Match: Senp6 (SUMO/sentrin specific peptidase 6 [Source:MGI Symbol;Acc:MGI:1922075])

HSP 1 Score: 115.546 bits (288), Expect = 1.974e-25
Identity = 57/130 (43.85%), Postives = 80/130 (61.54%), Query Frame = 3
Query: 2004 GNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES--------RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWM 2366
            G V K   Y P P +  + +   DL  L+ GE+LND II+FYL Y+  EK+ +E  +R H+F+ FFY +L ++   N  PE+        RH  V  WT+ VDIF+KDFI +P+NE  HWFLA++CFP +
Sbjct:  669 GPVEKLIVYPPPPAKGGISVTNEDLHCLSEGEFLNDVIIDFYLKYLVLEKLKKEDADRIHIFSSFFYKRLNQRERRN--PETTNLSIQQKRHGRVKTWTRHVDIFEKDFIFVPLNEAAHWFLAVVCFPGL 796          

HSP 2 Score: 108.997 bits (271), Expect = 2.343e-23
Identity = 55/119 (46.22%), Postives = 79/119 (66.39%), Query Frame = 3
Query: 2508 KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQ 2864
            +PCILL DSL+  +R+  VK++REYL+ EW+VK+ +K     F K+ ++G NP+VPQQ N  DCG+YVL YVE FFE+P+  +       +L  WF    ++TKRE I+ +IL+  E Q
Sbjct:  989 QPCILLMDSLRGPSRSNVVKILREYLEVEWEVKKGSKRS---FSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPVLNFE---LPMNLMNWFPPPRMKTKREEIRNIILKLQESQ 1101          
BLAST of Sentrin-specific protease 7 vs. UniProt/SwissProt
Match: sp|D3ZF42|SENP7_RAT (Sentrin-specific protease 7 OS=Rattus norvegicus OX=10116 GN=Senp7 PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 2.398e-52
Identity = 121/322 (37.58%), Postives = 172/322 (53.42%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTG--LNDTPE-----SRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEIPENQSVFSQK-------------TRVERLRSLRTQ----KNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSR 2885
            R+TG V K   Y P P    L +   DL  L  GE+LND II+FYL Y+  EK + E  ERSH+F+ FFY  L RK      D P+      RH  V  WT+ ++IF+KD+I +P+NE++HW+LA+ICFPW+   +  D     P     E  + QS    K             T  E  +S  T     K +  +PCIL+ DSL+  +    V+ +REYL+ EW+VKR        F K  +    P+VP+Q N+ DCG+Y+L YVE FF+ P+  +        L +WF +  ++TKRE I++LIL     +LHL+  +
Sbjct:  727 RNTGPVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLLLEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPDLSVAQRRHRRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYED----FPQTVSQEFQDQQSQHDNKTIDNDPHTTSTVFTSAEESQSTETSMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHRE---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFE---LPIHLEKWFPRHVIKTKREDIRELIL-----KLHLQQQK 1033          
BLAST of Sentrin-specific protease 7 vs. UniProt/SwissProt
Match: sp|A7MBJ2|SENP7_BOVIN (Sentrin-specific protease 7 OS=Bos taurus OX=9913 GN=SENP7 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 8.967e-52
Identity = 118/318 (37.11%), Postives = 170/318 (53.46%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTG--LNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPN-CQISEIPENQSVFSQKTRVERLRSLRTQKNIEP------------KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSR 2885
            RHTG V K   Y P P    L +   DL  L  GE+LND II+FYL Y+  EK + E  ERSH+F+ FFY  L RK      D P     + RH  V  WT+ ++IF+KD+I +P+NE++HW+LA+ICFPW+  ++  D    +P   Q  E   +              S  T+ +  P            +PCIL+ DSL+  +    V+ +REYL+ EW+VKR        F K  +    P+VP+Q N+ DCG+Y+L YVE FF+ P+  +        L +WF +  ++TKRE I++LIL     +LHL+  +
Sbjct:  737 RHTGPVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEVVYEDFPQTIPQYSQAEESHHDSRTIDNDLHTSSALSSGTEDSQSPEMNVTVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHRE---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFE---LPIHLEKWFPRHVIKTKREDIRELIL-----KLHLQQQK 1043          
BLAST of Sentrin-specific protease 7 vs. UniProt/SwissProt
Match: sp|Q8BUH8|SENP7_MOUSE (Sentrin-specific protease 7 OS=Mus musculus OX=10090 GN=Senp7 PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.377e-50
Identity = 116/322 (36.02%), Postives = 171/322 (53.11%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTG--LNDTPE-----SRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMI-----------------SYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSR 2885
            R+TG V K   Y P P    L +   DL  L  GE+LND II+FYL Y+  EK + E  ERSH+F+ FFY  L RK      D P+      RH  V  WT+ ++IF+KD+I +P+NE++HW+LA+ICFPW+   +                  +D      +   +      +  SQ T V    ++   K +  +PCIL+ DSL+  +    V+ +REYL+ EW+VKR        F K  +    P+VP+Q N+ DCG+Y+L YVE FF+ P+  +        L +WF +  ++TKRE I++LIL     +LHL+  +
Sbjct:  727 RNTGPVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLLLEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPDLSVAQRRHRRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDCPQTVSQQFQGQQSQHDHKMTDNDPHTTSTVSTSAEDSQSTEV----NMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHRE---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFE---LPIHLEKWFPRHVIKTKREDIRELIL-----KLHLQQQK 1033          
BLAST of Sentrin-specific protease 7 vs. UniProt/SwissProt
Match: sp|Q9BQF6|SENP7_HUMAN (Sentrin-specific protease 7 OS=Homo sapiens OX=9606 GN=SENP7 PE=1 SV=4)

HSP 1 Score: 197.978 bits (502), Expect = 2.925e-50
Identity = 115/318 (36.16%), Postives = 171/318 (53.77%), Query Frame = 3
Query: 1995 RHTGNVFKSFNYSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTG--LNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYD--QLFGMPNCQISEIPENQSV-----------FSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSR 2885
            RHTG V K   Y P P    L +   DL  L  GE+LND II+FYL Y+  EK + E  ERSH+F+ FFY  L RK      D P     + RH  V  WT+ ++IF+KD+I +P+NE++HW+LA+ICFPW+   +  D  Q     +       +N+++            S +       ++   K +  +PCIL+ DSL+  +    V+ +REYL+ EW+VK         F K  +    P+VP+Q N+ DCG+Y+L YVE FF+ P+  +        L +WF +  ++TKRE I++LIL     +LHL+  +
Sbjct:  740 RHTGLVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTIDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFE---LPIHLEKWFPRHVIKTKREDIRELIL-----KLHLQQQK 1046          
BLAST of Sentrin-specific protease 7 vs. UniProt/SwissProt
Match: sp|O13769|ULP2_SCHPO (Ubiquitin-like-specific protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ulp2 PE=1 SV=2)

HSP 1 Score: 149.828 bits (377), Expect = 5.888e-36
Identity = 93/245 (37.96%), Postives = 134/245 (54.69%), Query Frame = 3
Query: 2028 YSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQ--EQRERSHLFNVFFYTKLQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMP-NCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSV 2753
            Y  S  +S+ +  +DLT LN GE+LND I++FYL Y+  +  TQ       +H+FN FFY +L  K    D     H  V KWT+KVD+F K +I++PINE  HW+LAIIC        + D+L  MP + ++ E  E      ++    + R      N    P IL+FDSL ++ +   +  +REYL     ++ A +   +      IRGF+ +VPQQ+N  DCGIY LH+VE+F E P  V
Sbjct:  339 YPFSGTNSIAITNTDLTRLNEGEFLNDTIVDFYLRYLYCKLQTQNPSLANDTHIFNTFFYNRLTSKD--KDGKRLGHRGVRKWTQKVDLFHKKYIIVPINETFHWYLAIIC--------NIDRL--MPVDTKLEEQDEIVMSSVEQPSASKTRQAELTSN---SPAILIFDSLANLHKGA-LNYLREYL-----LEEAFERKNVHLKSTDIRGFHAKVPQQSNFSDCGIYALHFVELFLETPEQV 562          
BLAST of Sentrin-specific protease 7 vs. TrEMBL
Match: A0A1I8GLY7 (ULP_PROTEASE domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 2.826e-78
Identity = 144/314 (45.86%), Postives = 195/314 (62.10%), Query Frame = 3
Query: 1989 PGRHTGNVFKSFNYSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKT----GLNDTPES----RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSRENNLISP 2906
            P R TG V + F+YSP   + + +  +DL  LN  EYLND  I+FYL Y+  E +T EQR+ +H+FN FF+ +L +K     G +++  S    RH  VAKWT+KVD+F KDFI+IPINEN HWFLA+ICFPWM GM++Y    G    Q++      S+     R+    +LR        PC+L+FDSL   TR+PNV  IREYL+ EWD+K+ +  GP VFDK TIRG+ P VP Q NT+DCG YVLHY E+FF+ P+  +T+ YFQ  ++ WF ++ +  KR  IQ LI+  A         R+NN + P
Sbjct:  575 PPRLTGQVIEKFSYSPGGTNGITITNADLMCLNPCEYLNDVAIDFYLKYMYHEMLTPEQRKSTHIFNCFFFKRLSQKLDPPPGKDESAASLAIRRHETVAKWTRKVDLFTKDFILIPINENCHWFLAVICFPWMVGMVNYT---GSAEAQVN------SLLPFDVRMASDGTLRM-------PCVLMFDSLMGSTRSPNVLAIREYLQVEWDIKKRSMKGPKVFDKETIRGYCPCVPLQPNTVDCGPYVLHYAELFFKRPVREFTRNYFQLEMSSWFRQEEINHKRAEIQDLIVSLA---------RKNNALGP 863          
BLAST of Sentrin-specific protease 7 vs. TrEMBL
Match: A0A267GXT2 (ULP_PROTEASE domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011870g2 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 2.183e-77
Identity = 144/314 (45.86%), Postives = 195/314 (62.10%), Query Frame = 3
Query: 1989 PGRHTGNVFKSFNYSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKT----GLNDTPES----RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSRENNLISP 2906
            P R TG V + F+YSP   + + +  +DL  LN  EYLND  I+FYL Y+  E +T EQR+ +H+FN FF+ +L +K     G +++  S    RH  VAKWT+KVD+F KDFI+IPINEN HWFLA+ICFPWM GM++Y    G    Q++      S+     R+    +LR        PC+L+FDSL   TR+PNV  IREYL+ EWD+K+ +  GP VFDK TIRG+ P VP Q NT+DCG YVLHY E+FF+ P+  +T+ YFQ  ++ WF ++ +  KR  IQ LI+  A         R+NN + P
Sbjct:  717 PPRLTGQVIEKFSYSPGGTNGITITNADLMCLNPCEYLNDVAIDFYLKYMYHEMLTPEQRKSTHIFNCFFFKRLSQKLDPPPGKDESAASLAIRRHETVAKWTRKVDLFTKDFILIPINENCHWFLAVICFPWMVGMVNYT---GSAEAQVN------SLLPFDVRMASDGTLRM-------PCVLMFDSLMGSTRSPNVLAIREYLQVEWDIKKRSMKGPKVFDKETIRGYCPCVPLQPNTVDCGPYVLHYAELFFKRPVREFTRNYFQLEMSSWFRQEEINHKRAEIQDLIVSLA---------RKNNALGP 1005          
BLAST of Sentrin-specific protease 7 vs. TrEMBL
Match: A0A1I8GD96 (ULP_PROTEASE domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016695g2 PE=4 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 2.582e-77
Identity = 144/314 (45.86%), Postives = 195/314 (62.10%), Query Frame = 3
Query: 1989 PGRHTGNVFKSFNYSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKT----GLNDTPES----RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSRENNLISP 2906
            P R TG V + F+YSP   + + +  +DL  LN  EYLND  I+FYL Y+  E +T EQR+ +H+FN FF+ +L +K     G +++  S    RH  VAKWT+KVD+F KDFI+IPINEN HWFLA+ICFPWM GM++Y    G    Q++      S+     R+    +LR        PC+L+FDSL   TR+PNV  IREYL+ EWD+K+ +  GP VFDK TIRG+ P VP Q NT+DCG YVLHY E+FF+ P+  +T+ YFQ  ++ WF ++ +  KR  IQ LI+  A         R+NN + P
Sbjct:  716 PPRLTGQVIEKFSYSPGGTNGITITNADLMCLNPCEYLNDVAIDFYLKYMYHEMLTPEQRKSTHIFNCFFFKRLSQKLDPPPGKDESAASLAIRRHETVAKWTRKVDLFTKDFILIPINENCHWFLAVICFPWMVGMVNYT---GSAEAQVN------SLLPFDVRMASDGTLRM-------PCVLMFDSLMGSTRSPNVLAIREYLQVEWDIKKRSMKGPKVFDKETIRGYCPCVPLQPNTVDCGPYVLHYAELFFKRPVREFTRNYFQLEMSSWFRQEEINHKRAEIQDLIVSLA---------RKNNALGP 1004          
BLAST of Sentrin-specific protease 7 vs. TrEMBL
Match: A0A4E0RHH0 (Sentrin-specific protease 7 OS=Fasciola hepatica OX=6192 GN=D915_008307 PE=4 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 8.409e-77
Identity = 140/331 (42.30%), Postives = 195/331 (58.91%), Query Frame = 3
Query: 2022 FNYSP-SPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKL---------------------QRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLF---GMPNCQISEIPEN-QSVFSQ--------------------------KTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAE 2858
            F+Y P     SV++  +DL  L  G  +ND IINFYL Y+ FE+++  QR  +++FN FFY++L                        + L     +RHA+VAKWT++VD+F KD+I+IPINE +HWFL ++C+PWMAGM+SY  L+       CQ++E   N  S+  Q                          + R +RL  LR+ + I   PCILLFDSL   TR  N+ +IR+YL+ EWD +RA +DGPL F+K+TIRGF+P+VP Q+N +DCGIY+LHYVEMFF+ P+  YTK YFQ  +  WF + TV  KR  I  +I++  E
Sbjct:  204 FDYQPPGSTDSVILTSTDLDCLTPGALINDAIINFYLKYLYFEQLSDLQRACAYVFNCFFYSRLAGVAQTTPSANTRSQLTKPNSDSVSSLAPASLARHANVAKWTRRVDLFCKDYIIIPINEASHWFLGLVCYPWMAGMVSYTALYQAEAFDMCQLTERFANVDSLIGQLNVDDQTMCNAPLERLPSDMVGSAFDRWRRQRLVWLRS-RGINAMPCILLFDSLPCQTRVSNLHVIRDYLQAEWDTRRAEQDGPLSFNKDTIRGFSPRVPSQSNLVDCGIYLLHYVEMFFKQPVKSYTKGYFQHEMASWFSEATVGEKRMEIYNVIMRLHE 533          
BLAST of Sentrin-specific protease 7 vs. TrEMBL
Match: A0A1I8F267 (ULP_PROTEASE domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 2.200e-74
Identity = 136/308 (44.16%), Postives = 181/308 (58.77%), Query Frame = 3
Query: 2010 VFKSFNYSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES--------------RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLF-----------GMPNCQISE--IPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVT-RAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQ 2849
            + + F Y P   + + +  +DL  L  G YLND II+FYL YI  E +T EQR R+HLFN FFY +L    G+     +              RHA VAKWT+KVD+F KDFI+IPINEN HWFL +ICFP +AG + Y+ +              PN   +E   P N S   Q  +     ++R+       PC+L+FDSL     R PNVK+IREYL+ EWD+K+ A  GP  FDK T+RGF+P VPQQ N +DCG YVLHY EMF++ P+  +TK YFQ  +  WF+   ++ KR  +Q+LI+Q
Sbjct:  293 LIEKFTYRPGGSNGITITDTDLACLRSGNYLNDVIIDFYLKYILHELLTPEQRARTHLFNSFFYKRLAHCAGIEAAEAAAAAVAVDASVAAERRHASVAKWTRKVDLFSKDFIIIPINENYHWFLVVICFPMLAGCVDYNDMLNAERAAQTEATAGPNGTTAESTAPSNSSQ-DQAPQPLPAGAVRSDDGTLQLPCVLVFDSLSGTAHRGPNVKIIREYLQVEWDIKKRAGLGPKRFDKGTMRGFSPHVPQQPNFVDCGPYVLHYAEMFYKRPIPEFTKAYFQEHMRNWFNTAEIQNKRAEMQQLIVQ 599          
BLAST of Sentrin-specific protease 7 vs. Ensembl Cavefish
Match: senp7b (sentrin-specific protease 7-like [Source:NCBI gene;Acc:103027137])

HSP 1 Score: 186.037 bits (471), Expect = 7.765e-48
Identity = 109/309 (35.28%), Postives = 161/309 (52.10%), Query Frame = 3
Query: 2022 FNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES------RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWM--AGMISYDQLFG--------MPNCQISEIPENQS-VFSQKTR--------------VERLRSLRTQK-NIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQ 2849
              Y P P +  + +   DL  L  GE+LND II+FYL Y++ E+  QE   RSH+F+ FFY +L RK  +++          RH  V  WT+ VDIF KDF+ IP+N+  HW+L +ICFP +  A  + +  L           P  Q S  P +Q    S + R              +     L  Q+ N+  +PCIL+ DSL+         L+REYL+ EW+V+R     P  F+ N+I+G + +VP Q N+ DCG+Y+L YVE F ++P+  +        L  WF ++ V  KRE ++ L+LQ
Sbjct:  561 IQYPPPPSKGGITVTSEDLECLKDGEFLNDVIIDFYLKYLQQERADQEVASRSHIFSSFFYKQLTRKDNISEEEAGGTAQYRRHRRVKTWTRHVDIFSKDFLFIPVNQEAHWYLVVICFPGLLQAESVPWKNLASSEASGTTNKPQLQDSSKPGSQGPTLSTEQRQTGSTEGPKCNSPDLPDCTVLSCQRQNVTRRPCILIMDSLKLSYHLRIYTLLREYLQVEWEVRRGT---PRTFNDNSIKGSHCKVPLQDNSSDCGLYLLQYVESFLQNPVVHFD---LPLRLERWFPRQQVRRKREELRDLVLQ 863          
BLAST of Sentrin-specific protease 7 vs. Ensembl Cavefish
Match: si:dkey-100n23.3 (SUMO specific peptidase 7 [Source:NCBI gene;Acc:103030654])

HSP 1 Score: 179.104 bits (453), Expect = 3.243e-45
Identity = 102/322 (31.68%), Postives = 161/322 (50.00%), Query Frame = 3
Query: 1980 QYIPGRHTGNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES------RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWM-------------AGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLR------------TQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQ 2849
            ++ P +H G   +   + P P + ++ +   DL  L+ GE+LND II+FYL Y+  +K  Q   +RSH+F+ FFY +L R+   N+   S      RH  V  WT+ VDIF+KDF+ +P+N+  HW+L ++CFP M             A   + +        +  E  +N S   + +     + +             T+K +  +PCIL+ DSL+        KL+REYL+ EW+ KR    G   F    + G + +VP Q N+ DCG+Y+L Y E F + P+  +        L  WF ++ V  KRE I+ L+L+
Sbjct:  709 EWAPYKHRGPTRRLIQFPPPPCKRAITVTTEDLECLDSGEFLNDVIIDFYLKYLLVQKAPQASVKRSHVFSSFFYKQLTRRDNANEDSSSTPAQLRRHQRVRTWTRHVDIFEKDFLFVPVNQEAHWYLVVVCFPGMDEPQWVKREGQDSAEDTTENSSDSTAGTETQEGSKNNSEGEKSSDENSSKPVSISGPPNCTERTCTRKTVCKRPCILIMDSLKLSVHERIFKLLREYLQVEWETKRG---GHRDFSAEKMVGSHCRVPLQDNSSDCGLYLLQYAESFLQDPVVNF---ELPLRLECWFPRQQVREKREEIRDLVLR 1024          
BLAST of Sentrin-specific protease 7 vs. Ensembl Cavefish
Match: senp6b (sentrin-specific protease 6-like [Source:NCBI gene;Acc:103045568])

HSP 1 Score: 167.548 bits (423), Expect = 1.151e-42
Identity = 102/297 (34.34%), Postives = 152/297 (51.18%), Query Frame = 3
Query: 2070 DLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMIS------------YDQLFGMPN------------------CQISEIPENQSVFSQKTRVERLRSLRTQKNI----EPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLI 2843
            DL  L+ GE+LND I++FYL Y+  EK+  +   R H+ + FFY  L ++ G  DTP     E RH  V  WT+ +D+F+KDFI +PIN+ +HW+LA+ICFP  A   S            Y      PN                    I E+ E     S     + ++   T +N+      +PCIL+ DSL   ++   VK+++EYL+ EW VK+  +     F   ++ G++ QVPQQ N  DCG+Y+L Y E    +P  +    +    L+EWF +  V+ KRE I++LI
Sbjct:  356 DLRCLDEGEFLNDVIVDFYLKYLVCEKLETKDTSRCHVVSSFFYKSLTQE-GHQDTPGLSVQEKRHNRVKTWTRHLDLFEKDFIFVPINQLSHWYLAVICFPGQASPCSTMDSSGNEESMEYTPSPSHPNPMSLFYRQPASEHLSRQSVSIGEMDEGFCFVSDHDSDDDIQYNGTSRNVFNIASKQPCILIMDSLSCRSKPTVVKILQEYLEMEWLVKKGTRRS---FANGSMNGWSLQVPQQDNHTDCGVYLLQYAESLIMNPPQIL---HPGVDLSEWFPQTLVKKKREKIKRLI 645          
BLAST of Sentrin-specific protease 7 vs. Ensembl Cavefish
Match: senp6a (SUMO specific peptidase 6 [Source:NCBI gene;Acc:103024689])

HSP 1 Score: 119.398 bits (298), Expect = 1.034e-26
Identity = 60/133 (45.11%), Postives = 83/133 (62.41%), Query Frame = 3
Query: 2001 TGNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLN--DTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGM 2375
            TG V K   Y P P +  + +   DL  LN GE+LND II+FYL Y+  EK+ +E   RSH+F+ FFY +L ++   N  DT      + +H  V  WT+ VD+F KDFI +PINE+ HW+LA+ICFP + G+
Sbjct:  690 TGPVIKLIVYPPPPAKGGISVTNEDLHCLNDGEFLNDVIIDFYLKYLFIEKLKKEDALRSHVFSSFFYKRLNQRERRNAQDTANLPIQKRKHNRVKTWTRHVDLFQKDFIFVPINESAHWYLAVICFPGLDGI 822          

HSP 2 Score: 111.694 bits (278), Expect = 2.313e-24
Identity = 56/126 (44.44%), Postives = 86/126 (68.25%), Query Frame = 3
Query: 2508 KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQ-KAEFQLHLESS 2882
            +PCIL+ DSL+   R+  VK +REYL+ EW+VK+ ++     F K  ++G +P+VPQQ N  DCG+YVL YVE FFE+PL  +   +   +L +WF ++ ++TKR+ I+ LIL+ +++ QL  ESS
Sbjct:  975 QPCILIMDSLRGPARSTVVKTLREYLEVEWEVKKGSRRS---FGKEVMKGSSPRVPQQDNFSDCGVYVLQYVESFFENPLPSF---HLPMNLLDWFPQQRMKTKRDEIKDLILKIQSQQQLDRESS 1094          
BLAST of Sentrin-specific protease 7 vs. Ensembl Cavefish
Match: senp6a (SUMO specific peptidase 6 [Source:NCBI gene;Acc:103024689])

HSP 1 Score: 119.398 bits (298), Expect = 1.149e-26
Identity = 60/133 (45.11%), Postives = 83/133 (62.41%), Query Frame = 3
Query: 2001 TGNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLN--DTP-----ESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGM 2375
            TG V K   Y P P +  + +   DL  LN GE+LND II+FYL Y+  EK+ +E   RSH+F+ FFY +L ++   N  DT      + +H  V  WT+ VD+F KDFI +PINE+ HW+LA+ICFP + G+
Sbjct:  683 TGPVIKLIVYPPPPAKGGISVTNEDLHCLNDGEFLNDVIIDFYLKYLFIEKLKKEDALRSHVFSSFFYKRLNQRERRNAQDTANLPIQKRKHNRVKTWTRHVDLFQKDFIFVPINESAHWYLAVICFPGLDGI 815          

HSP 2 Score: 111.694 bits (278), Expect = 2.528e-24
Identity = 56/126 (44.44%), Postives = 86/126 (68.25%), Query Frame = 3
Query: 2508 KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQ-KAEFQLHLESS 2882
            +PCIL+ DSL+   R+  VK +REYL+ EW+VK+ ++     F K  ++G +P+VPQQ N  DCG+YVL YVE FFE+PL  +   +   +L +WF ++ ++TKR+ I+ LIL+ +++ QL  ESS
Sbjct:  968 QPCILIMDSLRGPARSTVVKTLREYLEVEWEVKKGSRRS---FGKEVMKGSSPRVPQQDNFSDCGVYVLQYVESFFENPLPSF---HLPMNLLDWFPQQRMKTKRDEIKDLILKIQSQQQLDRESS 1087          
BLAST of Sentrin-specific protease 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003093.1 (pep scaffold:Pmarinus_7.0:GL476956:247988:252088:1 gene:ENSPMAG00000002830.1 transcript:ENSPMAT00000003093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.082e-11
Identity = 40/118 (33.90%), Postives = 61/118 (51.69%), Query Frame = 3
Query: 2073 LTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEI 2426
            L HLN+   LND +INFY++ I  E+   E +   H FN FFY +++          +    V +WTK+VD+F  D  ++PI+ + HW LA I F      ++Y    G  N ++  I
Sbjct:   42 LQHLNW---LNDEVINFYMSLI-MERGKGEGKATVHAFNTFFYPRVK---------SAGFQGVKRWTKRVDVFQFDLALVPIHLDVHWCLAAINFK--KKTLTYYDSMGNSNNEVCNI 144          
BLAST of Sentrin-specific protease 7 vs. Ensembl Yeast
Match: ULP2 (Peptidase that deconjugates Smt3/SUMO-1 peptides from proteins; plays a role in chromosome cohesion at centromeric regions and recovery from checkpoint arrest induced by DNA damage or DNA replication defects; potential Cdc28p substrate; human homolog PML implicated in promyelocytic leukemia can partially complement yeast null mutant [Source:SGD;Acc:S000001293])

HSP 1 Score: 90.5077 bits (223), Expect = 8.955e-19
Identity = 76/287 (26.48%), Postives = 129/287 (44.95%), Query Frame = 3
Query: 2001 TGNVFK-SFNYSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQE--QRERSHLFNVFFYTKLQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLS---------VYTKEYFQTSLTEWFDKKTVETKRE 2825
            T  +FK S  Y  +   S  +   D   L   +++ND+I++F+  +     I +   +RE+ HL + FFYTKL         P   +++V KW    D+F K ++VIPIN + HWF  II    +  ++ + Q             +N ++ S +  +             P   IL FDSL+  T +  +  I+E+L     +  A     +  DK  I+     VPQQ N  DCG++V+  +  FFE+P+          + +K +    + ++FDK    + R+
Sbjct:  424 TPELFKPSLCYKFNDGSSYTITNQDFKCLFNKDWVNDSILDFFTKFYIESSIEKSIIKREQVHLMSSFFYTKLIS------NPADYYSNVKKWVNNTDLFSKKYVVIPINISYHWFSCIITN--LDAILDFHQ----------NKDKNDAINSDEISINN-----------PLVNILTFDSLRQ-THSREIDPIKEFL-----ISYALDKYSIQLDKTQIKMKTCPVPQQPNMSDCGVHVILNIRKFFENPVETIDVWKNSKIKSKHFTAKMINKYFDKNERNSARK 675          
BLAST of Sentrin-specific protease 7 vs. Ensembl Nematostella
Match: EDO38314 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD74])

HSP 1 Score: 113.235 bits (282), Expect = 2.920e-29
Identity = 56/115 (48.70%), Postives = 76/115 (66.09%), Query Frame = 3
Query: 2028 YSPSPEHSVL-MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLN---DTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFP 2360
            Y P P+   + +  ++L  L  GE+LND II+FYL YI  EK+T   RER+H+F+ FFY +L ++          E  H+ V  WTK VDIF KDFIV+PINE++HW+LAI+CFP
Sbjct:   17 YPPPPQQGGINITTANLDCLQEGEFLNDVIIDFYLKYIFHEKLTDFDRERTHIFSSFFYKRLTQRASSETNLSVIERMHSQVKTWTKYVDIFQKDFIVVPINESSHWYLAIVCFP 131          
BLAST of Sentrin-specific protease 7 vs. Ensembl Nematostella
Match: EDO48885 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHN4])

HSP 1 Score: 75.8702 bits (185), Expect = 2.650e-15
Identity = 71/248 (28.63%), Postives = 99/248 (39.92%), Query Frame = 3
Query: 1989 PGRHTGNVFKSFNYSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTE-WDVKRAAKDGPLVFDKNTIRGFNPQ-VPQQTNTIDCGIYVLHYVE 2726
            PG    N+ + FN + +          DL  L+   +LND +INFY N I           + H FN FFY KL  KTG        HA + +WT+KVDIF  D I++PI+   HW LA I                               F +KT                   +L +DSL+  T    +  +++YLK E  D K+        FD        P+ +P+Q N  DCG++   Y E
Sbjct:   11 PGNPGDNLTEGFNLTITR--------GDLATLSNLNWLNDEVINFYFNMIAARSKEDPVFPKVHFFNSFFYPKLI-KTG--------HASLKRWTRKVDIFTVDLILVPIHLGMHWCLAAI------------------------------DFRKKT-------------------VLYYDSLKG-TNIQCLDALQKYLKDESLDKKKVP------FDTTGWTAACPKDIPEQLNGCDCGVFTCTYAE 185          
BLAST of Sentrin-specific protease 7 vs. Ensembl Medaka
Match: senp7b (sentrin-specific protease 7 [Source:NCBI gene;Acc:101175292])

HSP 1 Score: 180.644 bits (457), Expect = 2.121e-46
Identity = 92/274 (33.58%), Postives = 152/274 (55.47%), Query Frame = 3
Query: 2070 DLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKT-------GLNDTPES--RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWM-----AGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQ 2849
            DL  L+ GE+ ND II+FYL Y+  E +     E +H+F+ FF+ +L R+        G    P+   RH  V  WT+ +DIF KDF+ +P+N+++HWFL +ICFP +       + S  Q+  +P+ Q  E                LR   +++ +  +PCIL+ DSL+  +     +L+R+YL+ EW+V+R     P +F  ++++GF+ +VPQQ N+ DCG+++L +   F ++P+  +        L  WF ++ V  KRE I+ LIL+
Sbjct:  523 DLACLDAGEFFNDVIIDFYLKYLVVEGVASAVAETTHIFSSFFFRQLSRRRTAGEDEDGAASVPDRHRRHQRVKTWTRHLDIFTKDFLFVPVNQDSHWFLVVICFPGLEEPRQEQLESAGQVVSLPSAQPPEC--------------TLRGC-SRRTVMKRPCILVMDSLKTSSHDGVCRLLRDYLQVEWEVRRRT---PRLFSADSMKGFSCRVPQQDNSSDCGVFLLQFAHSFLQNPVVNFE---LPPRLENWFPRQQVRRKREEIRNLILE 775          
BLAST of Sentrin-specific protease 7 vs. Ensembl Medaka
Match: si:dkey-100n23.3 (uncharacterized LOC101170552 [Source:NCBI gene;Acc:101170552])

HSP 1 Score: 180.259 bits (456), Expect = 1.073e-45
Identity = 106/318 (33.33%), Postives = 166/318 (52.20%), Query Frame = 3
Query: 1983 YIPGRHTGNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES-------RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFP---------WMAGMISYDQLFGMP------------NCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAA-KDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLIL 2846
            +IP +H G   +   + P P +  + +   DL  L+ G+YLND II+FYL Y+          ER H+F+ FFY +L R+   ++   S       RH  V  WT+ VDIF+KDF+ +P+N+  HW+L IICFP         W AG  S ++  G                +   +P++ S  S  + V        ++ ++ +PCILL DSL+       VKL+R+YL++EW+V+R + +D    F  + ++  N +VP Q N+ DCG+Y+L YVE F + P+  +        L +WF ++ V  KR+ I+ LIL
Sbjct:  692 WIPYKHQGVARRLIQFPPPPIKGGITVTMEDLQCLDSGKYLNDVIIDFYLKYLLL-NTPSALSERCHVFSSFFYKQLTRRDNASEGTNSDACQRQRRHQRVKTWTRHVDIFEKDFLFVPVNQEAHWYLVIICFPGLDEPKVESWTAGSPS-EETVGRSEADAEMICSNSVEAEAENVPKDPSKDSPTSPVSCTEQTCCRQTVQRRPCILLMDSLKISLHERVVKLLRDYLQSEWEVRRGSLRD----FGPDQMKSSNCKVPLQDNSSDCGLYLLQYVECFLKDPVVHFD---LPLQLQQWFPRQQVRRKRDEIRDLIL 1000          
BLAST of Sentrin-specific protease 7 vs. Ensembl Medaka
Match: si:dkey-100n23.3 (uncharacterized LOC101170552 [Source:NCBI gene;Acc:101170552])

HSP 1 Score: 180.259 bits (456), Expect = 1.073e-45
Identity = 106/318 (33.33%), Postives = 166/318 (52.20%), Query Frame = 3
Query: 1983 YIPGRHTGNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES-------RHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFP---------WMAGMISYDQLFGMP------------NCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAA-KDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLIL 2846
            +IP +H G   +   + P P +  + +   DL  L+ G+YLND II+FYL Y+          ER H+F+ FFY +L R+   ++   S       RH  V  WT+ VDIF+KDF+ +P+N+  HW+L IICFP         W AG  S ++  G                +   +P++ S  S  + V        ++ ++ +PCILL DSL+       VKL+R+YL++EW+V+R + +D    F  + ++  N +VP Q N+ DCG+Y+L YVE F + P+  +        L +WF ++ V  KR+ I+ LIL
Sbjct:  692 WIPYKHQGVARRLIQFPPPPIKGGITVTMEDLQCLDSGKYLNDVIIDFYLKYLLL-NTPSALSERCHVFSSFFYKQLTRRDNASEGTNSDACQRQRRHQRVKTWTRHVDIFEKDFLFVPVNQEAHWYLVIICFPGLDEPKVESWTAGSPS-EETVGRSEADAEMICSNSVEAEAENVPKDPSKDSPTSPVSCTEQTCCRQTVQRRPCILLMDSLKISLHERVVKLLRDYLQSEWEVRRGSLRD----FGPDQMKSSNCKVPLQDNSSDCGLYLLQYVECFLKDPVVHFD---LPLQLQQWFPRQQVRRKRDEIRDLIL 1000          
BLAST of Sentrin-specific protease 7 vs. Ensembl Medaka
Match: senp6a (SUMO specific peptidase 6a [Source:ZFIN;Acc:ZDB-GENE-080204-25])

HSP 1 Score: 149.058 bits (375), Expect = 2.314e-38
Identity = 108/365 (29.59%), Postives = 169/365 (46.30%), Query Frame = 3
Query: 1986 IPGRHTGNVFKSFNYSPSP-EHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPES----------------RHADV-------------AKWTKKV--------DIFDKDFIVI-----------------------PINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQ-LHLESSRENN 2894
            +P   +G + K   Y P P +  + +   DL  LN GE+LND II+FYL Y+  EK+ ++  +R H+F+ FFY +L ++   N T  +                RH D+             A W   V         +FDK+ +                         P++ +    L  I   + +G       F        +        ++      + SL ++  I  +PCIL+ DSL+  TR+  VK +REYL+ EW+V++  +     F K  ++G +P VPQQ N  DCG+YVL YVE FFE+P   +   +   +L+EWF ++ ++TKRE I++LIL   E Q L+LES +E  
Sbjct:    4 LPPSFSGPIVKLMVYPPPPAKGGITVTNEDLHCLNDGEFLNDVIIDFYLKYLVLEKLKKDDAQRIHVFSSFFYKRLNQRERRNATDTTSLPIQKRKHNRVKTWTRHVDLFQKDFIFVPINESAHWYLAVICFPGLEGPVFDKNPLYCGPTPASGSVADFQSEDSIPDHCRPLSPDGDCELHRISLCYGSGKEDDTYTFSDDQSSCQDECSEDGTLAEDGVPSDVSSLASKPTILKQPCILIMDSLRGPTRSTVVKTLREYLEVEWEVRKGTQRS---FSKEVMKGSSPCVPQQDNFSDCGVYVLQYVESFFENPPPRF---HLPMNLSEWFPQQRMKTKREEIKELILTLQEQQELNLESKQEGT 362          
BLAST of Sentrin-specific protease 7 vs. Ensembl Medaka
Match: ENSORLT00000017171.2 (sentrin-specific protease 2 [Source:NCBI gene;Acc:101165680])

HSP 1 Score: 70.4774 bits (171), Expect = 7.653e-12
Identity = 58/220 (26.36%), Postives = 86/220 (39.09%), Query Frame = 3
Query: 2070 DLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNP-QVPQQTNTIDCGIYVLHYVE 2726
            DL  L  G +LND +INFYL+ I      +  R + + F+ FF+ KL+             A V +WTK VD+F  D I++P++   HW +A+I F                                  R + ++S  +        C LL                  Y+K E    +A K   L   K TI      ++PQQ N  DCG++V  Y +
Sbjct:  413 DLATLQEGGWLNDEVINFYLSLIMERSSGEPSRLKVYSFSTFFFPKLRGGGQAGGH-----AAVKRWTKTVDLFLFDLILVPLHLGVHWAMAVIDF----------------------------------RSKTVKSYDSMGQRHDDICSLLL----------------HYIKEE---HKAKKGKELDSAKWTIGSLKACEIPQQKNGSDCGVFVCKYAD 574          
BLAST of Sentrin-specific protease 7 vs. Planmine SMEST
Match: SMESG000052086.1 (SMESG000052086.1)

HSP 1 Score: 1743.78 bits (4515), Expect = 0.000e+0
Identity = 942/943 (99.89%), Postives = 942/943 (99.89%), Query Frame = 3
Query:  108 MEDIPPVKRLTLGLTSKLHIFKAFEMLFENQKHKTVTKNNFEVRDYLKSISVKSKEVDESEKSVASNIELNNESXXXXXXXXXXRLLMLTDTINNEKHPIKYFVSINSIVQYKPKFQNLASWMDKRKISSNDSVENISICEPKKIKLDWKAETEIVFTYPDIFYQSTNFLTVDTKKLTFYIQAQGLYEIELGLNDVKTVHIYKEQAFIKFVIKPTVLIDLKHLSDSMRNQPGKPLKLSVKRGSNRDIMVIFTKSLITNSDLTVLRTIFGLDKVNFYNKEDEGKDFLMNLFYSAPKYKEFLKNNTCVTWDSLSKSQIPSINTS-TVAQNLSQIYPGKFPLTSNRPPITVNSSPTPFNKSHHFSNSSPINKFQGNASSLVVNKSTIHGHVSALQPKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXQPCTSFPGGISSIPVNTFSLAVNSSSLPNNNPQKGVVQLVAPIMNHMSNLMLHPQQTGVSVNNCSNQVINTVLCSPASFITNYAVIATSMPNNRLDPYPNLFNRMINESSSIRPLALQVNNFPMSVTXXXXXXXXXXXXXXKGLQINDFGSLFQRQSQVNGLNSSLXXXXXXXXXGXXXXXXXXXXXXXXXXXXDESANKPLQYIPGRHTGNVFKSFNYSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSRENNLISPKPGHDDSGP 2933
            MEDIPPVKRLTLGLTSKLHIFKAFEMLFENQKHKTVTKNNFEVRDYLKSISVKSKEVDESEKSVASNIELNNESKKIIKKPKQKRLLMLTDTINNEKHPIKYFVSINSIVQYKPKFQNLASWMDKRKISSNDSVENISICEPKKIKLDWKAETEIVFTYPDIFYQSTNFLTVDTKKLTFYIQAQGLYEIELGLNDVKTVHIYKEQAFIKFVIKPTVLIDLKHLSDSMRNQPGKPLKLSVKRGSNRDIMVIFTKSLITNSDLTVLRTIFGLDKVNFYNKEDEGKDFLMNLFYSAPKYKEFLKNNTCVTWDSLSKSQIPSINTS TVAQNLSQIYPGKFPLTSNRPPITVNSSPTPFNKSHHFSNSSPINKFQGNASSLVVNKSTIHGHVSALQPKDNTLLTTSNSLCLPASSSSHSFPPNTSSLQPCTSFPGGISSIPVNTFSLAVNSSSLPNNNPQKGVVQLVAPIMNHMSNLMLHPQQTGVSVNNCSNQVINTVLCSPASFITNYAVIATSMPNNRLDPYPNLFNRMINESSSIRPLALQVNNFPMSVTSQNNVPLSLNNNQNKGLQINDFGSLFQRQSQVNGLNSSLPPIPTPIPIGNHNYNNQNNNNHISNENNDESANKPLQYIPGRHTGNVFKSFNYSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSRENNLISPKPGHDDSGP
Sbjct:    1 MEDIPPVKRLTLGLTSKLHIFKAFEMLFENQKHKTVTKNNFEVRDYLKSISVKSKEVDESEKSVASNIELNNESKKIIKKPKQKRLLMLTDTINNEKHPIKYFVSINSIVQYKPKFQNLASWMDKRKISSNDSVENISICEPKKIKLDWKAETEIVFTYPDIFYQSTNFLTVDTKKLTFYIQAQGLYEIELGLNDVKTVHIYKEQAFIKFVIKPTVLIDLKHLSDSMRNQPGKPLKLSVKRGSNRDIMVIFTKSLITNSDLTVLRTIFGLDKVNFYNKEDEGKDFLMNLFYSAPKYKEFLKNNTCVTWDSLSKSQIPSINTSSTVAQNLSQIYPGKFPLTSNRPPITVNSSPTPFNKSHHFSNSSPINKFQGNASSLVVNKSTIHGHVSALQPKDNTLLTTSNSLCLPASSSSHSFPPNTSSLQPCTSFPGGISSIPVNTFSLAVNSSSLPNNNPQKGVVQLVAPIMNHMSNLMLHPQQTGVSVNNCSNQVINTVLCSPASFITNYAVIATSMPNNRLDPYPNLFNRMINESSSIRPLALQVNNFPMSVTSQNNVPLSLNNNQNKGLQINDFGSLFQRQSQVNGLNSSLPPIPTPIPIGNHNYNNQNNNNHISNENNDESANKPLQYIPGRHTGNVFKSFNYSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLILQKAEFQLHLESSRENNLISPKPGHDDSGP 943          
BLAST of Sentrin-specific protease 7 vs. Planmine SMEST
Match: SMESG000058418.1 (SMESG000058418.1)

HSP 1 Score: 303.523 bits (776), Expect = 1.223e-90
Identity = 144/279 (51.61%), Postives = 189/279 (67.74%), Query Frame = 3
Query: 2028 YSPSPEHSVLMFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLN-----DTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICFPWMAGMISYDQLFGMPNC-QISEIPENQSVFSQKTRVERLRSLRTQK-NIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLI 2843
            YSPS  HS+ +  SDL  L    Y+NDNIIN Y+ YI  E +T+ QR+R+H+FN FF TKL    GL      DTP  RH  V+KWTK VDIFDKDFI+IP+ EN HWFL I+CFPWMAG+I Y+QL       Q S IPEN++ F+ K R E+L +L+ +   + P PCIL+FDSL    R   V +IR+YLK+EWD KR+  DG L+FDK+T+RG+ P++PQQ N  DCG+Y+LHY+E FF  P+  +T ++FQ SL +WF K  ++ KR  I  +I
Sbjct:  256 YSPSQSHSIEITSSDLLCLKPRTYINDNIINLYITYIYNEIMTENQRQRTHIFNCFFNTKL---IGLTNSCNLDTPSVRHERVSKWTKNVDIFDKDFIIIPVIENQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGII 531          
BLAST of Sentrin-specific protease 7 vs. Planmine SMEST
Match: SMESG000043668.1 (SMESG000043668.1)

HSP 1 Score: 125.561 bits (314), Expect = 2.239e-30
Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1
Query: 3073 TCQILEQSLNYHNPLTGIETVDDLKPVPVDDSEQPNNNILIKKHSVKSNSAFNQKKLTSS 3252
            TCQILEQSLNYHNPLTGIETVDDLKPVPVDDSEQPNNNILIKKHSVKSNSAFNQKKLTSS
Sbjct:  337 TCQILEQSLNYHNPLTGIETVDDLKPVPVDDSEQPNNNILIKKHSVKSNSAFNQKKLTSS 396          
BLAST of Sentrin-specific protease 7 vs. Planmine SMEST
Match: SMESG000033662.1 (SMESG000033662.1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.091e-10
Identity = 37/95 (38.95%), Postives = 50/95 (52.63%), Query Frame = 3
Query: 2067 SDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAII 2351
            +DL  L   ++L DNIINFYL  I F   +  Q     +   FFY KL R +G        ++ V +WTKK  +FD   ++IPI+  NHW L  I
Sbjct:  262 TDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKL-RSSG--------YSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSI 347          
BLAST of Sentrin-specific protease 7 vs. Planmine SMEST
Match: SMESG000033662.1 (SMESG000033662.1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.126e-10
Identity = 37/95 (38.95%), Postives = 50/95 (52.63%), Query Frame = 3
Query: 2067 SDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTKLQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAII 2351
            +DL  L   ++L DNIINFYL  I F   +  Q     +   FFY KL R +G        ++ V +WTKK  +FD   ++IPI+  NHW L  I
Sbjct:  259 TDLISLQPRQWLTDNIINFYLELIYFRNNSNNQYPSVQILTTFFYPKL-RSSG--------YSGVKRWTKKRPVFDSQLVLIPIHLGNHWCLVSI 344          
The following BLAST results are available for this feature:
BLAST of Sentrin-specific protease 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SENP73.528e-5136.16SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:... [more]
SENP75.388e-5136.16SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:... [more]
SENP75.597e-5136.16SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:... [more]
SENP75.803e-5136.16SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:... [more]
SENP76.090e-5136.16SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Sentrin-specific protease 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ulp-21.274e-1827.84Ubiquitin-like protease 2 [Source:UniProtKB/Swiss... [more]
ulp-21.274e-1827.84Ubiquitin-like protease 2 [Source:UniProtKB/Swiss... [more]
ulp-21.746e-1827.84Ubiquitin-like protease 2 [Source:UniProtKB/Swiss... [more]
ulp-21.746e-1827.84Ubiquitin-like protease 2 [Source:UniProtKB/Swiss... [more]
ulp-23.411e-1427.04Ubiquitin-like protease 2 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Sentrin-specific protease 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG127177.771e-4637.37gene:FBgn0030420 transcript:FBtr0073704[more]
CG127177.771e-4637.37gene:FBgn0030420 transcript:FBtr0346120[more]
velo6.085e-2948.39gene:FBgn0035713 transcript:FBtr0076952[more]
velo6.085e-2948.39gene:FBgn0035713 transcript:FBtr0076950[more]
velo1.026e-2848.39gene:FBgn0035713 transcript:FBtr0076951[more]
back to top
BLAST of Sentrin-specific protease 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-100n23.34.762e-4632.23si:dkey-100n23.3 [Source:ZFIN;Acc:ZDB-GENE-070912-... [more]
senp7b1.339e-4333.66SUMO specific peptidase 7b [Source:ZFIN;Acc:ZDB-GE... [more]
senp6b4.321e-4031.27SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GE... [more]
senp6b5.438e-4031.27SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GE... [more]
senp6b1.230e-3931.27SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Sentrin-specific protease 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan91.125e-5236.09tetraspanin 9 [Source:Xenbase;Acc:XB-GENE-956624][more]
ENSXETT00000010046.11.399e-2645.74sentrin-specific protease 6-like [Source:NCBI gene... [more]
ENSXETT00000010018.16.424e-2645.74sentrin-specific protease 6-like [Source:NCBI gene... [more]
septin24.158e-2545.74septin 2 [Source:Xenbase;Acc:XB-GENE-480201][more]
septin24.320e-2545.74septin 2 [Source:Xenbase;Acc:XB-GENE-480201][more]
back to top
BLAST of Sentrin-specific protease 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Senp71.968e-5136.02SUMO1/sentrin specific peptidase 7 [Source:MGI Sym... [more]
Senp71.994e-5136.02SUMO1/sentrin specific peptidase 7 [Source:MGI Sym... [more]
Senp61.576e-2543.85SUMO/sentrin specific peptidase 6 [Source:MGI Symb... [more]
Senp61.806e-2543.85SUMO/sentrin specific peptidase 6 [Source:MGI Symb... [more]
Senp61.974e-2543.85SUMO/sentrin specific peptidase 6 [Source:MGI Symb... [more]
back to top
BLAST of Sentrin-specific protease 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D3ZF42|SENP7_RAT2.398e-5237.58Sentrin-specific protease 7 OS=Rattus norvegicus O... [more]
sp|A7MBJ2|SENP7_BOVIN8.967e-5237.11Sentrin-specific protease 7 OS=Bos taurus OX=9913 ... [more]
sp|Q8BUH8|SENP7_MOUSE1.377e-5036.02Sentrin-specific protease 7 OS=Mus musculus OX=100... [more]
sp|Q9BQF6|SENP7_HUMAN2.925e-5036.16Sentrin-specific protease 7 OS=Homo sapiens OX=960... [more]
sp|O13769|ULP2_SCHPO5.888e-3637.96Ubiquitin-like-specific protease 2 OS=Schizosaccha... [more]
back to top
BLAST of Sentrin-specific protease 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GLY72.826e-7845.86ULP_PROTEASE domain-containing protein OS=Macrosto... [more]
A0A267GXT22.183e-7745.86ULP_PROTEASE domain-containing protein OS=Macrosto... [more]
A0A1I8GD962.582e-7745.86ULP_PROTEASE domain-containing protein OS=Macrosto... [more]
A0A4E0RHH08.409e-7742.30Sentrin-specific protease 7 OS=Fasciola hepatica O... [more]
A0A1I8F2672.200e-7444.16ULP_PROTEASE domain-containing protein OS=Macrosto... [more]
back to top
BLAST of Sentrin-specific protease 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
senp7b7.765e-4835.28sentrin-specific protease 7-like [Source:NCBI gene... [more]
si:dkey-100n23.33.243e-4531.68SUMO specific peptidase 7 [Source:NCBI gene;Acc:10... [more]
senp6b1.151e-4234.34sentrin-specific protease 6-like [Source:NCBI gene... [more]
senp6a1.034e-2645.11SUMO specific peptidase 6 [Source:NCBI gene;Acc:10... [more]
senp6a1.149e-2645.11SUMO specific peptidase 6 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Sentrin-specific protease 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003093.11.082e-1133.90pep scaffold:Pmarinus_7.0:GL476956:247988:252088:1... [more]
back to top
BLAST of Sentrin-specific protease 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ULP28.955e-1926.48Peptidase that deconjugates Smt3/SUMO-1 peptides f... [more]
back to top
BLAST of Sentrin-specific protease 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO383142.920e-2948.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488852.650e-1528.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sentrin-specific protease 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
senp7b2.121e-4633.58sentrin-specific protease 7 [Source:NCBI gene;Acc:... [more]
si:dkey-100n23.31.073e-4533.33uncharacterized LOC101170552 [Source:NCBI gene;Acc... [more]
si:dkey-100n23.31.073e-4533.33uncharacterized LOC101170552 [Source:NCBI gene;Acc... [more]
senp6a2.314e-3829.59SUMO specific peptidase 6a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSORLT00000017171.27.653e-1226.36sentrin-specific protease 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Sentrin-specific protease 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052086.10.000e+099.89SMESG000052086.1[more]
SMESG000058418.11.223e-9051.61SMESG000058418.1[more]
SMESG000043668.12.239e-30100.00SMESG000043668.1[more]
SMESG000033662.12.091e-1038.95SMESG000033662.1[more]
SMESG000033662.12.126e-1038.95SMESG000033662.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012579 ID=SMED30012579|Name=Sentrin-specific protease 7|organism=Schmidtea mediterranea sexual|type=transcript|length=3647bp
TTTTTGTTTTAAAATTCTTCGAAGTTTCAAATAAATTTAAATTTTCAATT
TAATTTTCTTAATAAAAAGAAAATTTATAAAATTATTTTCAACCAAAGCG
ATATAAAATGGAAGATATTCCACCCGTTAAACGTTTAACGCTGGGCTTAA
CTTCTAAATTACATATATTTAAAGCTTTTGAGATGTTGTTTGAAAATCAA
AAGCATAAAACTGTTACCAAAAATAATTTTGAAGTAAGAGATTATCTAAA
ATCAATCTCAGTAAAATCCAAAGAAGTGGATGAAAGTGAAAAATCAGTTG
CTTCTAATATCGAACTAAATAATGAAAGTAAAAAGATTATTAAAAAACCC
AAACAAAAACGTTTGTTGATGTTAACTGACACGATTAATAATGAAAAACA
CCCCATAAAATACTTTGTCTCAATTAATTCTATTGTACAATACAAACCAA
AATTCCAAAATCTCGCTTCATGGATGGACAAGCGAAAAATTTCGTCGAAC
GATAGCGTTGAAAATATTTCTATTTGTGAACCGAAAAAAATCAAATTGGA
TTGGAAAGCCGAAACGGAAATTGTGTTTACTTATCCTGACATATTTTATC
AATCTACAAATTTCTTAACAGTTGATACTAAAAAGCTAACGTTTTATATT
CAAGCTCAAGGGTTATATGAAATCGAATTGGGATTGAATGACGTGAAAAC
CGTCCATATATATAAAGAGCAAGCATTTATTAAATTTGTCATTAAACCAA
CAGTTCTCATTGATTTAAAACATTTATCAGACAGTATGAGAAATCAACCA
GGAAAACCATTAAAATTGTCTGTAAAACGAGGATCTAATAGAGATATAAT
GGTAATATTCACAAAGAGTTTGATTACAAACAGTGATTTAACTGTGCTGA
GAACAATTTTTGGCCTAGATAAAGTTAATTTTTATAACAAAGAGGACGAA
GGAAAAGACTTTTTGATGAATCTATTTTACAGCGCACCTAAATACAAGGA
ATTTCTAAAAAACAATACATGTGTAACATGGGATTCTTTATCTAAATCAC
AAATTCCATCAATAAATACCTCAACTGTCGCACAAAATCTTTCTCAAATT
TACCCCGGCAAATTCCCATTAACATCAAACAGACCTCCGATTACAGTGAA
TTCATCACCAACTCCCTTTAATAAGTCTCATCATTTTAGTAACTCATCAC
CGATTAATAAGTTCCAAGGAAATGCATCTTCATTAGTTGTCAATAAATCC
ACAATCCACGGACATGTATCTGCACTGCAGCCCAAAGACAATACGTTATT
AACCACGTCTAATTCACTTTGTTTGCCTGCTAGTTCTTCGTCACATTCTT
TCCCACCAAATACTTCTTCTCTACAACCGTGCACTTCATTTCCTGGTGGA
ATATCTTCAATTCCTGTTAATACATTTTCATTGGCAGTTAATTCCTCTTC
GTTACCGAATAATAATCCCCAGAAAGGTGTTGTTCAATTGGTAGCTCCAA
TTATGAATCACATGTCAAACTTGATGTTGCATCCACAGCAAACCGGTGTT
TCCGTCAACAATTGTTCAAATCAAGTGATCAATACCGTTCTATGTTCTCC
GGCTTCTTTCATTACCAACTATGCTGTTATTGCAACATCTATGCCCAATA
ATAGATTAGATCCCTATCCAAATCTGTTTAATCGAATGATTAATGAGTCT
TCATCAATTCGTCCATTAGCATTGCAAGTCAATAATTTCCCCATGTCAGT
TACATCACAAAACAATGTTCCATTATCACTGAATAACAATCAGAACAAGG
GCTTGCAAATTAATGATTTCGGATCTCTATTCCAACGACAAAGTCAAGTA
AACGGATTGAACAGTAGTTTACCACCTATACCAACCCCAATACCGATTGG
GAATCACAATTACAACAACCAAAACAACAACAATCATATCAGTAATGAAA
ACAATGATGAATCTGCAAATAAACCACTACAATACATTCCCGGCAGACAT
ACTGGCAACGTGTTCAAATCTTTTAATTACTCGCCATCGCCTGAACACAG
TGTCCTTATGTTTGGATCTGATCTTACCCACCTCAATTACGGAGAATATC
TCAACGATAACATCATCAATTTCTATCTCAATTATATCAGATTCGAGAAA
ATCACACAAGAACAGCGGGAAAGATCTCATCTGTTTAATGTGTTTTTCTA
TACGAAATTACAACGAAAAACCGGCCTCAATGACACACCGGAAAGCCGGC
ACGCCGATGTGGCGAAATGGACGAAAAAGGTTGACATATTCGACAAGGAT
TTTATCGTAATTCCAATAAACGAAAACAATCACTGGTTCTTAGCGATAAT
TTGCTTTCCATGGATGGCTGGAATGATCAGCTATGATCAATTGTTCGGGA
TGCCCAATTGCCAGATTTCGGAAATTCCAGAAAATCAATCAGTATTCTCA
CAGAAAACTCGAGTCGAACGATTGAGGTCTTTGCGAACACAGAAAAATAT
CGAACCGAAACCGTGCATTCTATTATTCGACTCTCTACAGCATGTTACCC
GTGCACCGAATGTTAAATTGATTAGAGAATATCTCAAAACCGAATGGGAC
GTCAAGCGTGCAGCAAAAGACGGTCCATTGGTCTTTGATAAAAATACCAT
CCGAGGTTTCAATCCCCAAGTCCCTCAGCAAACCAACACAATCGACTGTG
GAATCTATGTTCTCCATTATGTGGAAATGTTTTTTGAGCATCCGTTATCA
GTCTATACGAAGGAATATTTTCAAACGTCCTTAACCGAATGGTTCGATAA
GAAAACAGTAGAGACCAAAAGAGAATTTATTCAGAAATTAATCCTACAAA
AAGCTGAATTTCAGCTGCATTTAGAATCGAGTAGAGAAAATAATTTGATT
TCACCCAAGCCAGGACATGATGATTCTGGCCCCGACATTCAGATTCTGTG
AGATACCGCTGCTGCTACTATCGATACTGCTAGTGGAGGGCCGTGTTGTT
GATGGTGATGATGATGATGATGAGAGGACTAGTAGTAACGATAACAACAG
TAGTAACACGATTATTGTCAATACTTGTCAGATTCTCGAACAATCTCTCA
ACTATCATAATCCATTAACTGGTATTGAGACCGTTGACGATCTCAAACCT
GTCCCAGTCGACGACAGTGAACAACCGAATAATAACATATTGATTAAAAA
ACATTCAGTTAAATCAAATTCAGCATTTAACCAAAAGAAATTGACGTCGT
CCTGAAATATATTATCGATCACTGTTATATATGCACATGCGTACACTGTG
TGTGTATATGTGTATGTATATATATATATTTATGAGATGCTGATGATGAT
GAGGAGGATGATGAGGATATCTGTTGCATATTCAATACAGTTTTACCTTA
GTGGATATTAAATTGCTTCTATTGTAAATTATGTTGTTCAATAAAACAAG
AAGTCTTTTAATTTTATTTTGCCCATGATTTGTATTGTTTGCAATGTGCC
TTTTGAATTTTAATAAATTAATTCTAGTTTTTACTTTTAAATGTGGAATT
GAATTTTGAGAAAAATTTTACCAGTTCGGGTTTTTATTGTACTTTAATTA
ATGGAGCACCTTTTTAGTACTTGCCAAGTTTTCGGAAAATAAATTCG
back to top

protein sequence of SMED30012579-orf-1

>SMED30012579-orf-1 ID=SMED30012579-orf-1|Name=SMED30012579-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=948bp
MEDIPPVKRLTLGLTSKLHIFKAFEMLFENQKHKTVTKNNFEVRDYLKSI
SVKSKEVDESEKSVASNIELNNESKKIIKKPKQKRLLMLTDTINNEKHPI
KYFVSINSIVQYKPKFQNLASWMDKRKISSNDSVENISICEPKKIKLDWK
AETEIVFTYPDIFYQSTNFLTVDTKKLTFYIQAQGLYEIELGLNDVKTVH
IYKEQAFIKFVIKPTVLIDLKHLSDSMRNQPGKPLKLSVKRGSNRDIMVI
FTKSLITNSDLTVLRTIFGLDKVNFYNKEDEGKDFLMNLFYSAPKYKEFL
KNNTCVTWDSLSKSQIPSINTSTVAQNLSQIYPGKFPLTSNRPPITVNSS
PTPFNKSHHFSNSSPINKFQGNASSLVVNKSTIHGHVSALQPKDNTLLTT
SNSLCLPASSSSHSFPPNTSSLQPCTSFPGGISSIPVNTFSLAVNSSSLP
NNNPQKGVVQLVAPIMNHMSNLMLHPQQTGVSVNNCSNQVINTVLCSPAS
FITNYAVIATSMPNNRLDPYPNLFNRMINESSSIRPLALQVNNFPMSVTS
QNNVPLSLNNNQNKGLQINDFGSLFQRQSQVNGLNSSLPPIPTPIPIGNH
NYNNQNNNNHISNENNDESANKPLQYIPGRHTGNVFKSFNYSPSPEHSVL
MFGSDLTHLNYGEYLNDNIINFYLNYIRFEKITQEQRERSHLFNVFFYTK
LQRKTGLNDTPESRHADVAKWTKKVDIFDKDFIVIPINENNHWFLAIICF
PWMAGMISYDQLFGMPNCQISEIPENQSVFSQKTRVERLRSLRTQKNIEP
KPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRG
FNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKT
VETKREFIQKLILQKAEFQLHLESSRENNLISPKPGHDDSGPDIQIL*
back to top

protein sequence of SMED30012579-orf-2

>SMED30012579-orf-2 ID=SMED30012579-orf-2|Name=SMED30012579-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp
MMILAPTFRFCEIPLLLLSILLVEGRVVDGDDDDDERTSSNDNNSSNTII
VNTCQILEQSLNYHNPLTGIETVDDLKPVPVDDSEQPNNNILIKKHSVKS
NSAFNQKKLTSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR003653Peptidase_C48_C
Vocabulary: molecular function
TermDefinition
GO:0008234cysteine-type peptidase activity
GO:0008233peptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003653Ulp1 protease family, C-terminal catalytic domainPFAMPF02902Peptidase_C48coord: 664..900
e-value: 2.1E-37
score: 129.0
IPR003653Ulp1 protease family, C-terminal catalytic domainPROSITEPS50600ULP_PROTEASEcoord: 650..876
score: 26.722
NoneNo IPR availablePANTHERPTHR46896FAMILY NOT NAMEDcoord: 782..922
coord: 520..769
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 641..915