Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein

Overview
NameCarboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
Smed IDSMED30012574
Length (bp)1767
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (SMED30012574) t-SNE clustered cells

Violin plots show distribution of expression levels for Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (SMED30012574) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (SMED30012574) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein (SMED30012574) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012574

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30012574SMESG000071224.1 dd_Smed_v4_13377_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012574SMESG000071224.1 SmedASXL_012954SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30012574SMESG000071224.1 dd_Smed_v4_13377_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012574SMESG000071224.1 dd_Smed_v4_13377_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012574SMESG000071224.1 dd_Smed_v4_13377_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30012574SMESG000071224.1 dd_Smed_v4_13377_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012574SMESG000071224.1 dd_Smed_v4_13377_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012574SMESG000071224.1 dd_Smed_v6_13377_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30012574SMESG000071224.1 dd_Smed_v4_13377_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Human
Match: NOS1AP (nitric oxide synthase 1 adaptor protein [Source:HGNC Symbol;Acc:HGNC:16859])

HSP 1 Score: 151.754 bits (382), Expect = 2.407e-40
Identity = 82/166 (49.40%), Postives = 110/166 (66.27%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSE 569
            Y+GS+DV RP +R+EIV+AMRRIR+EFKAK +KK++V   +S+DGV V                   +L             + +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D + + E
Sbjct:   36 YVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKV-------------------ILKKKKKKKEWTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGE 182          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Human
Match: NOS1AP (nitric oxide synthase 1 adaptor protein [Source:HGNC Symbol;Acc:HGNC:16859])

HSP 1 Score: 153.68 bits (387), Expect = 8.481e-40
Identity = 84/166 (50.60%), Postives = 118/166 (71.08%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSE 569
            Y+GS+DV RP +R+EIV+AMRRIR+EFKAK +KK++V   +S+DGV V L+ +KK  +  +   +++               + +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D + + E
Sbjct:   36 YVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQKKEWTWD--------------ESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGE 187          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Human
Match: NOS1AP (nitric oxide synthase 1 adaptor protein [Source:HGNC Symbol;Acc:HGNC:16859])

HSP 1 Score: 152.525 bits (384), Expect = 2.334e-39
Identity = 84/166 (50.60%), Postives = 116/166 (69.88%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSE 569
            Y+GS+DV RP +R+EIV+AMRRIR+EFKAK +KK++V   +S+DGV V L+ +KK         +++               + +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D + + E
Sbjct:   36 YVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKK-----KEWTWD--------------ESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGE 182          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Human
Match: LDLRAP1 (low density lipoprotein receptor adaptor protein 1 [Source:HGNC Symbol;Acc:HGNC:18640])

HSP 1 Score: 53.9138 bits (128), Expect = 3.098e-7
Identity = 39/158 (24.68%), Postives = 67/158 (42.41%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTK 557
            Y+G   V +P+      +A++RI    KA   K ++V  K+S  G+ +                               ++ T  L+ +  IYRI Y + D    K+F+YIA+   + + +C+ F   ++  A  +  TV QAF V     Q S++ K
Sbjct:   52 YLGMTLVEQPKGEELSAAAIKRIVATAKASGKKLQKVTLKVSPRGIILT------------------------------DNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEK 179          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Human
Match: ANKS1B (ankyrin repeat and sterile alpha motif domain containing 1B [Source:HGNC Symbol;Acc:HGNC:24600])

HSP 1 Score: 52.7582 bits (125), Expect = 7.699e-7
Identity = 24/65 (36.92%), Postives = 39/65 (60.00%), Query Frame = 3
Query:  339 LLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRI 533
            ++  H I  I   + D +DL  F+YI +D KS +  C+VF A     A +I+ T+GQAF+V +++
Sbjct:  154 IIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQL 218          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Celegans
Match: dyc-1 (Dystrophin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q8STF6])

HSP 1 Score: 175.252 bits (443), Expect = 3.025e-46
Identity = 82/162 (50.62%), Postives = 107/162 (66.05%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSE 569
            Y+GSM++ RP  R+EIV+AMRR+R+EFKA+ +KK  V   +S+DGV V L+ +K+    L   +S                   LL+M HPIYRIFYVSHDSQDL+IFSYIARD  S  FKCNVFK  +K +AM++VRT+GQAF+VCH++ Q     K   E
Sbjct:   40 YVGSMEIPRPGTRIEIVAAMRRVRYEFKARGIKKRPVDITVSVDGVKVVLQRKKQKEKGLSWDES------------------KLLVMFHPIYRIFYVSHDSQDLQIFSYIARDGASNTFKCNVFKCSKKSQAMRVVRTIGQAFEVCHKVAQDQMQEKHEDE 183          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Celegans
Match: dyc-1 (Dystrophin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q8STF6])

HSP 1 Score: 175.252 bits (443), Expect = 3.025e-46
Identity = 82/162 (50.62%), Postives = 107/162 (66.05%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSE 569
            Y+GSM++ RP  R+EIV+AMRR+R+EFKA+ +KK  V   +S+DGV V L+ +K+    L   +S                   LL+M HPIYRIFYVSHDSQDL+IFSYIARD  S  FKCNVFK  +K +AM++VRT+GQAF+VCH++ Q     K   E
Sbjct:   40 YVGSMEIPRPGTRIEIVAAMRRVRYEFKARGIKKRPVDITVSVDGVKVVLQRKKQKEKGLSWDES------------------KLLVMFHPIYRIFYVSHDSQDLQIFSYIARDGASNTFKCNVFKCSKKSQAMRVVRTIGQAFEVCHKVAQDQMQEKHEDE 183          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Fly
Match: CG42673 (gene:FBgn0261555 transcript:FBtr0302711)

HSP 1 Score: 144.821 bits (364), Expect = 2.003e-37
Identity = 78/162 (48.15%), Postives = 103/162 (63.58%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSE 569
            ++G  +V RP  R EIV AMRRIR+E K + +KK +V   IS++GV V L+ R++           N  N P            + L++HPIYRIFYVSHDS DLKIFSYIARD+ +  FKC+VFK+ +K +AM+IVRTVGQAF+VCH+ N      + N E
Sbjct:   35 FVGWEEVPRPNTRAEIVQAMRRIRYECKVQNLKKRKVTIHISVNGVRVVLKKRRRK--------KKNWTNDPED----------IELLNHPIYRIFYVSHDSSDLKIFSYIARDASTDTFKCSVFKSHKKSQAMRIVRTVGQAFEVCHKFNLHKNSLEPNDE 178          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Fly
Match: CG42673 (gene:FBgn0261555 transcript:FBtr0302709)

HSP 1 Score: 146.747 bits (369), Expect = 7.523e-37
Identity = 78/162 (48.15%), Postives = 103/162 (63.58%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSE 569
            ++G  +V RP  R EIV AMRRIR+E K + +KK +V   IS++GV V L+ R++           N  N P            + L++HPIYRIFYVSHDS DLKIFSYIARD+ +  FKC+VFK+ +K +AM+IVRTVGQAF+VCH+ N      + N E
Sbjct:   35 FVGWEEVPRPNTRAEIVQAMRRIRYECKVQNLKKRKVTIHISVNGVRVVLKKRRRK--------KKNWTNDPED----------IELLNHPIYRIFYVSHDSSDLKIFSYIARDASTDTFKCSVFKSHKKSQAMRIVRTVGQAFEVCHKFNLHKNSLEPNDE 178          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Zebrafish
Match: nos1apa (nitric oxide synthase 1 (neuronal) adaptor protein a [Source:ZFIN;Acc:ZDB-GENE-081024-1])

HSP 1 Score: 154.836 bits (390), Expect = 2.157e-40
Identity = 85/170 (50.00%), Postives = 119/170 (70.00%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSEYNPT 581
            YIGS+DVARP +R+EIV+AMRRIR+EFK K +KK++V   +S+DGV V LR +KK         +++               + +++M  PIYRIFYVSHDSQDLKIFSYIARD +S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D + + + + T
Sbjct:   36 YIGSLDVARPNSRVEIVAAMRRIRYEFKVKNIKKKKVNIIVSVDGVKVALRKKKKK-----KEWTWD--------------ESKMMVMQDPIYRIFYVSHDSQDLKIFSYIARDGQSNVFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGDADKT 186          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Zebrafish
Match: nos1apa (nitric oxide synthase 1 (neuronal) adaptor protein a [Source:ZFIN;Acc:ZDB-GENE-081024-1])

HSP 1 Score: 155.992 bits (393), Expect = 6.666e-40
Identity = 85/170 (50.00%), Postives = 119/170 (70.00%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSEYNPT 581
            YIGS+DVARP +R+EIV+AMRRIR+EFK K +KK++V   +S+DGV V LR +KK         +++               + +++M  PIYRIFYVSHDSQDLKIFSYIARD +S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D + + + + T
Sbjct:   36 YIGSLDVARPNSRVEIVAAMRRIRYEFKVKNIKKKKVNIIVSVDGVKVALRKKKKK-----KEWTWD--------------ESKMMVMQDPIYRIFYVSHDSQDLKIFSYIARDGQSNVFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGDADKT 186          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Zebrafish
Match: si:dkey-34e4.1 (si:dkey-34e4.1 [Source:ZFIN;Acc:ZDB-GENE-070705-456])

HSP 1 Score: 136.732 bits (343), Expect = 8.338e-37
Identity = 83/170 (48.82%), Postives = 117/170 (68.82%), Query Frame = 3
Query:   87 IGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPTIDEEN 596
            +GS+DV RP +R+EIV+AMRRIR+EFKAK+VKK++V   +S+DGV V LR   K P    + +                  + +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S +F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++ +  +  ++ + +   D ++
Sbjct:   38 VGSLDVPRPNSRMEIVAAMRRIRYEFKAKSVKKKKVAIVVSVDGVKVVLR---KKPKACEMKE-------------WTWDESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGSSNSFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHAELNADEQPDGPADGQS 191          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Zebrafish
Match: si:dkey-34e4.1 (si:dkey-34e4.1 [Source:ZFIN;Acc:ZDB-GENE-070705-456])

HSP 1 Score: 145.591 bits (366), Expect = 1.283e-36
Identity = 89/183 (48.63%), Postives = 123/183 (67.21%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPTID-------EENSTETR 611
            Y+GS+DV RP +R+EIV+AMRRIR+EFKAK+VKK++V   +S+DGV V LR + K     R   +++               + +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S +F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++ +  +  ++ + +   D       EE S E R
Sbjct:   38 YVGSLDVPRPNSRMEIVAAMRRIRYEFKAKSVKKKKVAIVVSVDGVKVVLRKKPK-----RKEWTWD--------------ESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGSSNSFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHAELNADEQPDGPADGQSDQSGEEPSPEGR 201          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Zebrafish
Match: nos1apb (nitric oxide synthase 1 (neuronal) adaptor protein b [Source:ZFIN;Acc:ZDB-GENE-100824-1])

HSP 1 Score: 142.124 bits (357), Expect = 1.634e-36
Identity = 82/149 (55.03%), Postives = 107/149 (71.81%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHR 530
            +IGS+D+ RP++R+EI++AMRRIR+EFK K +KK++V   +S+DGV V LR +KK         S++       + PV        L   PI+RIFYVSHDSQDLKIFSYIARD KS  F+CNVFK+ RK +AM+IVRTVGQAF+VCH+
Sbjct:   36 FIGSLDIVRPKSRIEILAAMRRIRYEFKIKNIKKKKVSLIVSVDGVKVVLRKKKKK-----FEYSWD-------ESPVT-------LAQDPIFRIFYVSHDSQDLKIFSYIARDKKSNVFRCNVFKSKRKSQAMRIVRTVGQAFEVCHK 165          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Xenopus
Match: ENSXETT00000019712.1 (carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein-like [Source:NCBI gene;Acc:100488020])

HSP 1 Score: 164.851 bits (416), Expect = 8.172e-46
Identity = 87/175 (49.71%), Postives = 124/175 (70.86%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSEYNPTIDEEN 596
            YIGS+DV RP +R+EIV+AMRRIR+EFKAK +KK++V   +S+DGV V +R ++K     R   +++               + +L+MH P+YRIFYVSHDSQDLKIFSYIARD  S +FKCNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D +++   + + +E N
Sbjct:   36 YIGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVVMRKKQK-----RKEWTWD--------------ESKMLMMHDPVYRIFYVSHDSQDLKIFSYIARDGASNSFKCNVFKSKKKSQAMQIVRTVGQAFEVCHKMSLQHAQQNADGQADGASDKSQEEAN 191          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Xenopus
Match: ski (SKI proto-oncogene [Source:Xenbase;Acc:XB-GENE-494028])

HSP 1 Score: 156.762 bits (395), Expect = 3.901e-41
Identity = 86/177 (48.59%), Postives = 120/177 (67.80%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSEYNPTIDEENST 602
            YIGS+DV RP +R+EIV+AMR+IR+EFKAK +KK++V   +S+DGV V LR +K+    L   +S                   +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K  AM++VRTVGQAF+VCH+++    +++ D + ++E + + D E  +
Sbjct:   36 YIGSLDVPRPNSRVEIVAAMRQIRYEFKAKNIKKKKVNILVSVDGVKVILRKKKRKKNDLAWDES------------------KMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSHAMRVVRTVGQAFEVCHKLSLQHTEQNGDGREDAESDRSTDSEGPS 194          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Xenopus
Match: ski (SKI proto-oncogene [Source:Xenbase;Acc:XB-GENE-494028])

HSP 1 Score: 158.688 bits (400), Expect = 9.961e-41
Identity = 86/175 (49.14%), Postives = 119/175 (68.00%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSEYNPTIDEEN 596
            YIGS+DV RP +R+EIV+AMR+IR+EFKAK +KK++V   +S+DGV V LR +K+    L   +S                   +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K  AM++VRTVGQAF+VCH+++    +++ D + ++E + + D E 
Sbjct:   36 YIGSLDVPRPNSRVEIVAAMRQIRYEFKAKNIKKKKVNILVSVDGVKVILRKKKRKKNDLAWDES------------------KMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSHAMRVVRTVGQAFEVCHKLSLQHTEQNGDGREDAESDRSTDSEG 192          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Xenopus
Match: ski (SKI proto-oncogene [Source:Xenbase;Acc:XB-GENE-494028])

HSP 1 Score: 121.709 bits (304), Expect = 2.292e-28
Identity = 69/152 (45.39%), Postives = 98/152 (64.47%), Query Frame = 3
Query:  153 RFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSEYNPTIDEEN 596
            ++EFKAK +KK++V   +S+DGV V LR +K+    L   +S                   +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K  AM++VRTVGQAF+VCH+++    +++ D + ++E + + D E 
Sbjct:   35 KYEFKAKNIKKKKVNILVSVDGVKVILRKKKRKKNDLAWDES------------------KMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSHAMRVVRTVGQAFEVCHKLSLQHTEQNGDGREDAESDRSTDSEG 168          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Xenopus
Match: znf238.2 (zinc finger protein 238, gene 2 [Source:Xenbase;Acc:XB-GENE-1219066])

HSP 1 Score: 55.0694 bits (131), Expect = 1.547e-7
Identity = 41/162 (25.31%), Postives = 69/162 (42.59%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSE 569
            Y+G   V +P+      +A++RI    KA   K ++V  K+S  G+ +                 ++L             A+  L+ +  IYRI Y + D    K+F+YIA+  ++   +C+ F   ++  A  +  TV QAF V     Q S + K   E
Sbjct:   51 YLGMTLVEQPKGEELSATAVKRIVATAKASGKKLQKVILKVSPRGIIL-----------------YDL-------------ASNQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNETLECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSRENKEKRE 182          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Mouse
Match: Nos1ap (nitric oxide synthase 1 (neuronal) adaptor protein [Source:MGI Symbol;Acc:MGI:1917979])

HSP 1 Score: 152.14 bits (383), Expect = 1.716e-39
Identity = 84/166 (50.60%), Postives = 116/166 (69.88%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSE 569
            Y+GS+DV RP +R+EIV+AMRRIR+EFKAK +KK++V   +S+DGV V L+ +KK         +++               + +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D + + E
Sbjct:   36 YVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKK-----KEWTWD--------------ESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGE 182          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Mouse
Match: Nos1ap (nitric oxide synthase 1 (neuronal) adaptor protein [Source:MGI Symbol;Acc:MGI:1917979])

HSP 1 Score: 125.176 bits (313), Expect = 3.167e-32
Identity = 72/147 (48.98%), Postives = 101/147 (68.71%), Query Frame = 3
Query:  141 MRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSE 569
            MRRIR+EFKAK +KK++V   +S+DGV V L+ +KK  +  +   +++               + +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D + + E
Sbjct:    1 MRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQKKEWTWD--------------ESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGE 133          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Mouse
Match: Ldlrap1 (low density lipoprotein receptor adaptor protein 1 [Source:MGI Symbol;Acc:MGI:2140175])

HSP 1 Score: 56.6102 bits (135), Expect = 3.366e-8
Identity = 40/154 (25.97%), Postives = 65/154 (42.21%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKS 545
            Y+G   V RP+      +A++RI    KA   K ++V  K+S  G+ +                               +S T  L+ +  IYRI Y + D    K+F+YIA+  ++ + +C+ F   ++  A  +  TV QAF V     Q S
Sbjct:   51 YLGMTLVERPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGIILT------------------------------DSLTSQLIENVSIYRISYCTADKMHDKVFAYIAQSQQNESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVS 174          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Mouse
Match: Anks1b (ankyrin repeat and sterile alpha motif domain containing 1B [Source:MGI Symbol;Acc:MGI:1924781])

HSP 1 Score: 53.1434 bits (126), Expect = 3.669e-7
Identity = 25/71 (35.21%), Postives = 42/71 (59.15%), Query Frame = 3
Query:  321 NSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRI 533
            ++A   ++  H I  I   + D +DL  F+YI +D KS +  C+VF A     A +I+ T+GQAF+V +++
Sbjct:  124 DAANKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQL 194          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Mouse
Match: Anks1b (ankyrin repeat and sterile alpha motif domain containing 1B [Source:MGI Symbol;Acc:MGI:1924781])

HSP 1 Score: 53.1434 bits (126), Expect = 3.669e-7
Identity = 25/71 (35.21%), Postives = 42/71 (59.15%), Query Frame = 3
Query:  321 NSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRI 533
            ++A   ++  H I  I   + D +DL  F+YI +D KS +  C+VF A     A +I+ T+GQAF+V +++
Sbjct:  124 DAANKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQL 194          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. UniProt/SwissProt
Match: sp|Q8STF6|DYC1_CAEEL (Dystrophin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=dyc-1 PE=1 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 3.848e-45
Identity = 82/162 (50.62%), Postives = 107/162 (66.05%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSE 569
            Y+GSM++ RP  R+EIV+AMRR+R+EFKA+ +KK  V   +S+DGV V L+ +K+    L   +S                   LL+M HPIYRIFYVSHDSQDL+IFSYIARD  S  FKCNVFK  +K +AM++VRT+GQAF+VCH++ Q     K   E
Sbjct:   40 YVGSMEIPRPGTRIEIVAAMRRVRYEFKARGIKKRPVDITVSVDGVKVVLQRKKQKEKGLSWDES------------------KLLVMFHPIYRIFYVSHDSQDLQIFSYIARDGASNTFKCNVFKCSKKSQAMRVVRTIGQAFEVCHKVAQDQMQEKHEDE 183          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. UniProt/SwissProt
Match: sp|O75052|CAPON_HUMAN (Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein OS=Homo sapiens OX=9606 GN=NOS1AP PE=1 SV=3)

HSP 1 Score: 153.68 bits (387), Expect = 4.073e-39
Identity = 84/166 (50.60%), Postives = 118/166 (71.08%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSE 569
            Y+GS+DV RP +R+EIV+AMRRIR+EFKAK +KK++V   +S+DGV V L+ +KK  +  +   +++               + +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D + + E
Sbjct:   36 YVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKLLLLQKKEWTWD--------------ESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGE 187          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. UniProt/SwissProt
Match: sp|Q9D3A8|CAPON_MOUSE (Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein OS=Mus musculus OX=10090 GN=Nos1ap PE=1 SV=3)

HSP 1 Score: 152.14 bits (383), Expect = 1.201e-38
Identity = 84/166 (50.60%), Postives = 116/166 (69.88%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSE 569
            Y+GS+DV RP +R+EIV+AMRRIR+EFKAK +KK++V   +S+DGV V L+ +KK         +++               + +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D + + E
Sbjct:   36 YVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKK-----KEWTWD--------------ESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGE 182          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. UniProt/SwissProt
Match: sp|O54960|CAPON_RAT (Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein OS=Rattus norvegicus OX=10116 GN=Nos1ap PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.324e-38
Identity = 84/166 (50.60%), Postives = 116/166 (69.88%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSE 569
            Y+GS+DV RP +R+EIV+AMRRIR+EFKAK +KK++V   +S+DGV V L+ +KK         +++               + +L+M  PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D + + E
Sbjct:   36 YVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKK-----KEWTWD--------------ESKMLVMQDPIYRIFYVSHDSQDLKIFSYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGE 182          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. UniProt/SwissProt
Match: sp|Q8SXX4|CAPON_DROME (Capon-like protein OS=Drosophila melanogaster OX=7227 GN=CG42673 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 7.541e-36
Identity = 78/162 (48.15%), Postives = 103/162 (63.58%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSE 569
            ++G  +V RP  R EIV AMRRIR+E K + +KK +V   IS++GV V L+ R++           N  N P            + L++HPIYRIFYVSHDS DLKIFSYIARD+ +  FKC+VFK+ +K +AM+IVRTVGQAF+VCH+ N      + N E
Sbjct:   35 FVGWEEVPRPNTRAEIVQAMRRIRYECKVQNLKKRKVTIHISVNGVRVVLKKRRRK--------KKNWTNDPED----------IELLNHPIYRIFYVSHDSSDLKIFSYIARDASTDTFKCSVFKSHKKSQAMRIVRTVGQAFEVCHKFNLHKNSLEPNDE 178          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. TrEMBL
Match: A0A267DPF3 (PID domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025230g2 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.075e-48
Identity = 92/166 (55.42%), Postives = 118/166 (71.08%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPT 581
            +IGS+DV RPQ+R+EIV+AMRRIRFEFKAKA+KK +V   IS+DGV V  R  ++  + L                     +T  LLMHHPIYRIFYVSHDSQDLKIFSYIARDS+   FKC+VFKA +K +AM+IVRT+GQAF+VCH+++  S++ +S +  N T
Sbjct:   35 FIGSLDVPRPQSRVEIVAAMRRIRFEFKAKAIKKRKVTISISVDGVSVICRRARRRALWL--------------------DSTSQLLMHHPIYRIFYVSHDSQDLKIFSYIARDSQRNAFKCSVFKAYKKAQAMRIVRTIGQAFEVCHQLSLGSKEGRSAAASNAT 180          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. TrEMBL
Match: A0A4Z2CYB0 (Dystrophin-like protein isoform 2 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_006431 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.223e-48
Identity = 98/198 (49.49%), Postives = 131/198 (66.16%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSF-------------NLLN----------GPSSDH-PVNNSATGLL------------------LMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN-QKSE 548
            ++G MD+ RPQNRLEIVS+MRRIR+EFK K +KK++V  KIS DGV+V LR + K  I+  +S++F              +L           G + D+  ++ +++GLL                  L++HPIYRIFYVSHDSQDLKIFSYIARDS+++ F+CNVFKA +K++AM+IVRTVGQAFDVCHR+  QK E
Sbjct:    1 FVGGMDIPRPQNRLEIVSSMRRIRYEFKEKGIKKQKVLIKISADGVFVYLRKKPKFGIRWPVSRTFISSSQIPGNRVFSEILTTDTTSIKESTGATGDYDAISAASSGLLGLGLRDTSMLDCIHQSNLLLYHPIYRIFYVSHDSQDLKIFSYIARDSRTSVFRCNVFKAYKKLQAMRIVRTVGQAFDVCHRLALQKQE 198          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. TrEMBL
Match: A0A4S2LJ59 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008227 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 2.235e-48
Identity = 103/212 (48.58%), Postives = 132/212 (62.26%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQS---------------------FNLLNGPSSDHP------VNNSATGL---------------LLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPTIDEE 593
            +IGSMD+ RPQNRLEIVS+MRRIR+EFK K +KK++V  K+S DGV+V   +RKK  I LR   S                      ++ +G SS H             GL               L+M+HPIYRIFYVSHDSQDL IFSYIARDS+++ F+CNVFKA +K++AM+IVRTVGQAFDVCHR+  + +++K   E N T DE+
Sbjct:   38 FIGSMDIPRPQNRLEIVSSMRRIRYEFKEKGIKKQKVLIKVSADGVFV--YARKKPKILLRWPGSKSPSVQYPIGRLYQDVLPQDGASIHDGNSSHHDGESTTDTTGGVLGLGLSDASILNCIHQSNLMMYHPIYRIFYVSHDSQDLNIFSYIARDSRTSVFRCNVFKAYKKLQAMRIVRTVGQAFDVCHRLAMQKQESKGTKEENITSDEQ 247          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. TrEMBL
Match: A0A4W3INZ5 (PID domain-containing protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.516e-47
Identity = 86/158 (54.43%), Postives = 114/158 (72.15%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN-QKSEDT 554
            Y+G +DV RP +R+EIVSAMRRIR+EFKAK +KK +V   +S+DGV V LR ++K     R   +++               + LL+MH P+YRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK  +K +AM+IVRTVGQAF+VCH+++ Q++E+T
Sbjct:   36 YVGCLDVQRPTSRMEIVSAMRRIRYEFKAKNIKKRKVNMTVSVDGVRVTLRKKQK-----RKEWTWD--------------ESKLLVMHDPVYRIFYVSHDSQDLKIFSYIARDGVSNTFRCNVFKTKKKSQAMRIVRTVGQAFEVCHKLSLQRAEET 174          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. TrEMBL
Match: A0A267DQP8 (PID domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028612g1 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 2.007e-47
Identity = 92/166 (55.42%), Postives = 118/166 (71.08%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPT 581
            +IGS+DV RPQ+R+EIV+AMRRIRFEFKAKA+KK +V   IS+DGV V  R  ++  + L                     +T  LLMHHPIYRIFYVSHDSQDLKIFSYIARDS+   FKC+VFKA +K +AM+IVRT+GQAF+VCH+++  S++ +S +  N T
Sbjct:   35 FIGSLDVPRPQSRVEIVAAMRRIRFEFKAKAIKKRKVTISISVDGVSVICRRARRRALWL--------------------DSTSQLLMHHPIYRIFYVSHDSQDLKIFSYIARDSQRNAFKCSVFKAYKKAQAMRIVRTIGQAFEVCHQLSLGSKEGRSAAASNAT 180          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Cavefish
Match: si:dkey-34e4.1 (carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein-like [Source:NCBI gene;Acc:103035680])

HSP 1 Score: 167.933 bits (424), Expect = 1.680e-44
Identity = 90/182 (49.45%), Postives = 126/182 (69.23%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN-QKSE-------DTKSNSEYNPTIDEENSTE 605
            Y+GS+DV RP +R+EIV+AMRRIR+EFKAK +KK++V   +S+DGV V LR ++K     R   +++               + +L+MH PIYRIFYVSHDSQDLKIFSYIARD  S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++ Q +E       D+ ++ E + ++DE  + E
Sbjct:   36 YVGSLDVPRPNSRMEIVAAMRRIRYEFKAKNIKKKKVSLVVSVDGVKVILRKKQK-----RKEWTWD--------------ESKMLVMHDPIYRIFYVSHDSQDLKIFSYIARDGSSNTFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHAEQNGDGQLDSAADGESDKSVDEATNEE 198          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Cavefish
Match: nos1apb (carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein-like [Source:NCBI gene;Acc:103026217])

HSP 1 Score: 145.976 bits (367), Expect = 6.824e-38
Identity = 84/157 (53.50%), Postives = 108/157 (68.79%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDT 554
            ++GS+DV RP++RLEI++AMRRIR+EFK K +KK +V   +++DGV V LR +KK              N  S D       + + L   PIYRIFYVSHDSQDLKIFSYIARD KS  F+CNVFK+ RK +AM+IVRT+GQAF+VCH+ +  S D 
Sbjct:   36 FVGSLDVVRPKSRLEILAAMRRIRYEFKVKNIKKTKVSLVVAVDGVKVVLRKKKKK-------------NAYSWDE------SQVTLTQDPIYRIFYVSHDSQDLKIFSYIARDKKSNVFRCNVFKSKRKSQAMRIVRTIGQAFEVCHKQSLDSVDA 173          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Cavefish
Match: nos1apa (nitric oxide synthase 1 (neuronal) adaptor protein a [Source:ZFIN;Acc:ZDB-GENE-081024-1])

HSP 1 Score: 147.902 bits (372), Expect = 2.957e-37
Identity = 85/170 (50.00%), Postives = 118/170 (69.41%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN----QKSEDTKSNSEYNPT 581
            YIGS+DVARP +R+EIV+AMRRIR+EFK K +KK++V   +S+DGV V LR +KK         +++               + +++M  PIYRIFYVSHDSQDLKIFSYIARD +S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++    Q++ D + + +   T
Sbjct:   36 YIGSLDVARPNSRVEIVAAMRRIRYEFKVKNIKKKKVNIMVSVDGVKVVLRKKKKK-----KEWTWD--------------ESKMMVMQDPIYRIFYVSHDSQDLKIFSYIARDGQSNVFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGDSQKT 186          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Cavefish
Match: ldlrap1b (low density lipoprotein receptor adaptor protein 1b [Source:ZFIN;Acc:ZDB-GENE-070112-1012])

HSP 1 Score: 56.6102 bits (135), Expect = 2.448e-8
Identity = 40/158 (25.32%), Postives = 68/158 (43.04%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTK 557
            Y+G   V +P+      +A++RI    KA   K ++V  K+S  G+                               +++SA+  L+ +  IYRI Y + D    K+F+YIA+   +   +C+ F   +K  A  +  TV QAF V     Q +++ K
Sbjct:   51 YLGVTLVEQPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGII------------------------------LHDSASNQLIENISIYRISYCTADKMHDKVFAYIAQSQGNETLECHAFLCTKKKVAQAVTLTVAQAFRVAFEFWQAAKEEK 178          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Cavefish
Match: ldlrap1b (low density lipoprotein receptor adaptor protein 1b [Source:ZFIN;Acc:ZDB-GENE-070112-1012])

HSP 1 Score: 55.0694 bits (131), Expect = 7.428e-8
Identity = 39/156 (25.00%), Postives = 67/156 (42.95%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSED 551
            Y+G   V +P+      +A++RI    KA   K ++V  K+S  G+                               +++SA+  L+ +  IYRI Y + D    K+F+YIA+   +   +C+ F   +K  A  +  TV QAF V     Q +++
Sbjct:   51 YLGVTLVEQPKGEELSAAAVKRIVATAKASGKKLQKVTLKVSPRGII------------------------------LHDSASNQLIENISIYRISYCTADKMHDKVFAYIAQSQGNETLECHAFLCTKKKVAQAVTLTVAQAFRVAFEFWQAAKE 176          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Sea Lamprey
Match: gulp1a (GULP PTB domain containing engulfment adaptor 1a [Source:NCBI gene;Acc:368404])

HSP 1 Score: 53.5286 bits (127), Expect = 3.875e-8
Identity = 41/163 (25.15%), Postives = 79/163 (48.47%), Query Frame = 3
Query:   51 NMSILSEILKFYIGSMDVARPQNRLEIVSAMRRIRFEF---KAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHR 530
             MS +S  +K Y+GS +V++P+    +  A+R+++F     K++  K  +V  ++SI GV                     +L+ P S    +N          P++RI + + D  D +I ++I +D+++    C  F + +  E  +I  ++GQAFD+ +R
Sbjct:   21 TMSCVSYSVK-YLGSCEVSQPKGSEVVKDAVRKLKFACHLKKSEGQKLPKVELQVSIRGV--------------------EILD-PKSKESQHNC---------PLHRISFCADDKTDKRILAFICKDAETDQHFCFAFDSEKSAE--EITLSIGQAFDLAYR 150          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Sea Lamprey
Match: anks1b (ankyrin repeat and sterile alpha motif domain containing 1B [Source:NCBI gene;Acc:565408])

HSP 1 Score: 48.1358 bits (113), Expect = 5.520e-6
Identity = 24/72 (33.33%), Postives = 40/72 (55.56%), Query Frame = 3
Query:  342 LMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTK 557
            +  H I  I   + D +DL  F+YI +D K++   C+VF A     A +I+ T+GQAF+V +++  +    K
Sbjct: 1092 IAEHEIRNISCAAQDPEDLCTFAYITKDLKTSYHYCHVFSAFDVNLAYEIILTLGQAFEVAYQLALQGRKAK 1163          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Nematostella
Match: EDO49371 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG70])

HSP 1 Score: 57.3806 bits (137), Expect = 4.382e-10
Identity = 44/157 (28.03%), Postives = 72/157 (45.86%), Query Frame = 3
Query:   81 FYIGSMDVARPQNRLEIVSAMRRIRF-------EFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHR 530
            FY G  +VA  +    I  A+ +++F       E   KA K  +V  KI+IDGV                               + +S +  +L  +P++ I Y + D ++ ++F++IA+D  S    C VF+A R  E + +  TVGQAFD+ +R
Sbjct:    1 FY-GVTEVAEAKGTEVIKEAITKVQFANHIKKSEAGTKASKLRKVDLKINIDGV------------------------------SIEDSKSKEVLHSYPLHHISYCADDKRNKRVFAFIAKDKTSPKHTCYVFEAERLAEELTL--TVGQAFDLAYR 124          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Nematostella
Match: EDO43144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZG4])

HSP 1 Score: 58.9214 bits (141), Expect = 2.579e-9
Identity = 38/150 (25.33%), Postives = 69/150 (46.00%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGV-YVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHR 530
            Y+GS  V         + A R++R    AK  K   V   IS++G+ +++ RSR                               LL+ HH +  + Y++ D +D  +F+YIA+D+K     C+VF+  +K  + ++  ++GQAF++ + 
Sbjct:  261 YLGSHMVKEISGVTSTIDACRKMRLS-TAKLQKVPSVILSISVNGIKFIDARSR-------------------------------LLVSHHDMKNVSYITQDPEDKCVFAYIAKDAKIDKHYCHVFRVEKKELSDEVTMSIGQAFELAYE 378          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Medaka
Match: si:dkey-34e4.1 (carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein [Source:NCBI gene;Acc:101157471])

HSP 1 Score: 165.236 bits (417), Expect = 2.472e-43
Identity = 84/172 (48.84%), Postives = 122/172 (70.93%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPTIDEENS 599
            Y+GS+DV RP +R+EIV+AMRRIR+EFKAK +KK++V   +S+DGV V LR ++K     R   +++               + +++M  PIYRIFYVSHDSQDLKIFSYIARD  S +F+CNVFK+ +K +AM+IVRTVGQAF+VCH+I+ +  +  ++ + + + +E+ S
Sbjct:   36 YVGSLDVPRPNSRMEIVAAMRRIRYEFKAKNIKKKKVSILVSVDGVKVMLRKKQK-----RKEWTWD--------------ESKMMIMGDPIYRIFYVSHDSQDLKIFSYIARDGSSNSFRCNVFKSKKKTQAMRIVRTVGQAFEVCHKISLQHAEQDADGDSDKSTEEDGS 188          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Medaka
Match: nos1apb (carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein [Source:NCBI gene;Acc:101156607])

HSP 1 Score: 151.754 bits (382), Expect = 2.089e-39
Identity = 85/163 (52.15%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN-QKSEDTKSNSE 569
            YIGS++V RP +R+EIV+AMRRIR+EFK K +KK++V   +S D V V LR +K+               G S D   +N+   +L+   PIYRIFYVSHD+ DLKIFSYIARD +S  F+CNVFK+ RK +AM+IVRTVGQAFDVCH++  Q+  D + + E
Sbjct:   36 YIGSLEVGRPGSRMEIVAAMRRIRYEFKLKNIKKKKVNIIVSTDFVKVILRKKKR--------------KGWSWD---DNT---ILVAQDPIYRIFYVSHDAHDLKIFSYIARDGQSNVFRCNVFKSKRKSQAMRIVRTVGQAFDVCHQMTLQQKNDEQEDEE 178          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Medaka
Match: ENSORLT00000029293.1 (carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein [Source:NCBI gene;Acc:101163480])

HSP 1 Score: 153.68 bits (387), Expect = 4.101e-39
Identity = 82/151 (54.30%), Postives = 108/151 (71.52%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN 536
            YIGS+DV RP +R+EIV+AMRRIR+EFK K +KK++V   +S+DGV V LR +KK   +    +S                   +++M  PIYRIFYVSHDSQDLKIFSYIARD +S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++
Sbjct:   36 YIGSLDVTRPSSRVEIVAAMRRIRYEFKVKNIKKKKVNIVVSVDGVKVTLRKKKKK-KEWTWDESK------------------MIVMQDPIYRIFYVSHDSQDLKIFSYIARDGQSNVFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLS 167          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Medaka
Match: ENSORLT00000043507.1 (carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein [Source:NCBI gene;Acc:101163480])

HSP 1 Score: 115.546 bits (288), Expect = 1.278e-26
Identity = 64/129 (49.61%), Postives = 88/129 (68.22%), Query Frame = 3
Query:  150 IRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN 536
            +++EFK K +KK++V   +S+DGV V LR +KK   +    +S                   +++M  PIYRIFYVSHDSQDLKIFSYIARD +S  F+CNVFK+ +K +AM+IVRTVGQAF+VCH+++
Sbjct:   17 LQYEFKVKNIKKKKVNIVVSVDGVKVTLRKKKKK-KEWTWDESK------------------MIVMQDPIYRIFYVSHDSQDLKIFSYIARDGQSNVFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLS 126          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Medaka
Match: ldlrap1a (low density lipoprotein receptor adapter protein 1-B [Source:NCBI gene;Acc:101174278])

HSP 1 Score: 54.6842 bits (130), Expect = 8.916e-8
Identity = 39/159 (24.53%), Postives = 66/159 (41.51%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKS 560
            ++G   V +P+      SA++RI    KA   K ++V  K+   G+ +                          D P N      LL    IYRI Y + D    K+F+YI +++ +   +C+ +   ++ EA  +  TV QAF V   + Q + + K 
Sbjct:   51 HLGMTLVDQPKGEELSASAVKRIVATAKASGKKPQKVSLKVCPQGIVLY-------------------------DRPTNQ-----LLEKVSIYRISYCTVDKLHGKVFAYITQNALNGTLECHAYLCSKRREAQAVALTVAQAFTVAFELWQGAREDKG 179          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Planmine SMEST
Match: SMESG000071224.1 (SMESG000071224.1)

HSP 1 Score: 973.77 bits (2516), Expect = 0.000e+0
Identity = 532/532 (100.00%), Postives = 532/532 (100.00%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPTIDEENSTETRNXXXXXXXXXXXXXXXXXXXXXPIRSADLVKIXXXXXXXXXXXXXXXXXXXIMQSSTKKDGRRTVPNSISEPSIKLHSNGLNEEKKITFDSFLSSYLFLNYIISNQLSEMNSNLSGELIKTVNSKLPTFDKLFSPQFFRPENLGTKISKTXXXXXXXXXXXXIKFRIKCQSQIEELACQNKVLSTFIKRTFEEIRQNQCESCMLRLSGLDITTSTCSSLENHRNSRPNCANEIDLNQLFQENLRFPAANSQESSINSNFFKNNHSDQKAIYFNELFSEHNEKEIPFDEMDFYRKLDHSITRNFYKMASWSPHVNGDYHIDLKKSKSSNDPSQCTSETSIANSQEEINKFNDKIMNF 1679
            YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPTIDEENSTETRNQNSSMTSSSQEKKISSSQSAQPIRSADLVKIDDEAQSDSQSESLSTLDDLIMQSSTKKDGRRTVPNSISEPSIKLHSNGLNEEKKITFDSFLSSYLFLNYIISNQLSEMNSNLSGELIKTVNSKLPTFDKLFSPQFFRPENLGTKISKTQLELLKNQLEEEIKFRIKCQSQIEELACQNKVLSTFIKRTFEEIRQNQCESCMLRLSGLDITTSTCSSLENHRNSRPNCANEIDLNQLFQENLRFPAANSQESSINSNFFKNNHSDQKAIYFNELFSEHNEKEIPFDEMDFYRKLDHSITRNFYKMASWSPHVNGDYHIDLKKSKSSNDPSQCTSETSIANSQEEINKFNDKIMNF
Sbjct:   41 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPTIDEENSTETRNQNSSMTSSSQEKKISSSQSAQPIRSADLVKIDDEAQSDSQSESLSTLDDLIMQSSTKKDGRRTVPNSISEPSIKLHSNGLNEEKKITFDSFLSSYLFLNYIISNQLSEMNSNLSGELIKTVNSKLPTFDKLFSPQFFRPENLGTKISKTQLELLKNQLEEEIKFRIKCQSQIEELACQNKVLSTFIKRTFEEIRQNQCESCMLRLSGLDITTSTCSSLENHRNSRPNCANEIDLNQLFQENLRFPAANSQESSINSNFFKNNHSDQKAIYFNELFSEHNEKEIPFDEMDFYRKLDHSITRNFYKMASWSPHVNGDYHIDLKKSKSSNDPSQCTSETSIANSQEEINKFNDKIMNF 572          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Planmine SMEST
Match: SMESG000071224.1 (SMESG000071224.1)

HSP 1 Score: 973.385 bits (2515), Expect = 0.000e+0
Identity = 532/532 (100.00%), Postives = 532/532 (100.00%), Query Frame = 3
Query:   84 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPTIDEENSTETRNXXXXXXXXXXXXXXXXXXXXXPIRSADLVKIXXXXXXXXXXXXXXXXXXXIMQSSTKKDGRRTVPNSISEPSIKLHSNGLNEEKKITFDSFLSSYLFLNYIISNQLSEMNSNLSGELIKTVNSKLPTFDKLFSPQFFRPENLGTKISKTXXXXXXXXXXXXIKFRIKCQSQIEELACQNKVLSTFIKRTFEEIRQNQCESCMLRLSGLDITTSTCSSLENHRNSRPNCANEIDLNQLFQENLRFPAANSQESSINSNFFKNNHSDQKAIYFNELFSEHNEKEIPFDEMDFYRKLDHSITRNFYKMASWSPHVNGDYHIDLKKSKSSNDPSQCTSETSIANSQEEINKFNDKIMNF 1679
            YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPTIDEENSTETRNQNSSMTSSSQEKKISSSQSAQPIRSADLVKIDDEAQSDSQSESLSTLDDLIMQSSTKKDGRRTVPNSISEPSIKLHSNGLNEEKKITFDSFLSSYLFLNYIISNQLSEMNSNLSGELIKTVNSKLPTFDKLFSPQFFRPENLGTKISKTQLELLKNQLEEEIKFRIKCQSQIEELACQNKVLSTFIKRTFEEIRQNQCESCMLRLSGLDITTSTCSSLENHRNSRPNCANEIDLNQLFQENLRFPAANSQESSINSNFFKNNHSDQKAIYFNELFSEHNEKEIPFDEMDFYRKLDHSITRNFYKMASWSPHVNGDYHIDLKKSKSSNDPSQCTSETSIANSQEEINKFNDKIMNF
Sbjct:   40 YIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRINQKSEDTKSNSEYNPTIDEENSTETRNQNSSMTSSSQEKKISSSQSAQPIRSADLVKIDDEAQSDSQSESLSTLDDLIMQSSTKKDGRRTVPNSISEPSIKLHSNGLNEEKKITFDSFLSSYLFLNYIISNQLSEMNSNLSGELIKTVNSKLPTFDKLFSPQFFRPENLGTKISKTQLELLKNQLEEEIKFRIKCQSQIEELACQNKVLSTFIKRTFEEIRQNQCESCMLRLSGLDITTSTCSSLENHRNSRPNCANEIDLNQLFQENLRFPAANSQESSINSNFFKNNHSDQKAIYFNELFSEHNEKEIPFDEMDFYRKLDHSITRNFYKMASWSPHVNGDYHIDLKKSKSSNDPSQCTSETSIANSQEEINKFNDKIMNF 571          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Planmine SMEST
Match: SMESG000010313.1 (SMESG000010313.1)

HSP 1 Score: 129.028 bits (323), Expect = 1.900e-32
Identity = 73/189 (38.62%), Postives = 111/189 (58.73%), Query Frame = 3
Query:   75 LKFY---IGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN------QKSEDTKSNSEYNPTIDEENSTETRN 614
            + FY   +G ++V +P +R EIV+AMRRIR+E K  A +K+RV   ISIDG+ V L  +K   +KL+  ++                    ++  HPI+R+FYVSHD+QD+ IFSYI RD+ +  F C  FKA  + EA+++V  +G +F++CH+IN      QK +D   N E N T D ++  +T +
Sbjct:   33 INFYARIVGKIEVPQPNHRNEIVAAMRRIRYESKTSAQRKQRVKISISIDGIIVTLLGKK---LKLQWWKN-----------------EECVIYQHPIHRVFYVSHDAQDINIFSYIVRDNVTDIFMCIAFKAYSEKEAIEVVGAIGHSFEICHKINTDLVAKQKLDDI--NQEDNKTPDSKSFKDTED 199          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Planmine SMEST
Match: SMESG000010313.1 (SMESG000010313.1)

HSP 1 Score: 129.028 bits (323), Expect = 3.330e-31
Identity = 73/189 (38.62%), Postives = 111/189 (58.73%), Query Frame = 3
Query:   75 LKFY---IGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN------QKSEDTKSNSEYNPTIDEENSTETRN 614
            + FY   +G ++V +P +R EIV+AMRRIR+E K  A +K+RV   ISIDG+ V L  +K   +KL+  ++                    ++  HPI+R+FYVSHD+QD+ IFSYI RD+ +  F C  FKA  + EA+++V  +G +F++CH+IN      QK +D   N E N T D ++  +T +
Sbjct:  315 INFYARIVGKIEVPQPNHRNEIVAAMRRIRYESKTSAQRKQRVKISISIDGIIVTLLGKK---LKLQWWKN-----------------EECVIYQHPIHRVFYVSHDAQDINIFSYIVRDNVTDIFMCIAFKAYSEKEAIEVVGAIGHSFEICHKINTDLVAKQKLDDI--NQEDNKTPDSKSFKDTED 481          
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Planmine SMEST
Match: SMESG000010313.1 (SMESG000010313.1)

HSP 1 Score: 100.138 bits (248), Expect = 7.158e-23
Identity = 58/159 (36.48%), Postives = 89/159 (55.97%), Query Frame = 3
Query:  156 FEFKAKAVKKERVYFKISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHHPIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTVGQAFDVCHRIN------QKSEDTKSNSEYNPTIDEENSTETRN 614
            +E K  A +K+RV   ISIDG+ V L  +K   +KL+  ++                    ++  HPI+R+FYVSHD+QD+ IFSYI RD+ +  F C  FKA  + EA+++V  +G +F++CH+IN      QK +D   N E N T D ++  +T +
Sbjct:   24 YESKTSAQRKQRVKISISIDGIIVTLLGKK---LKLQWWKN-----------------EECVIYQHPIHRVFYVSHDAQDINIFSYIVRDNVTDIFMCIAFKAYSEKEAIEVVGAIGHSFEICHKINTDLVAKQKLDDI--NQEDNKTPDSKSFKDTED 160          
The following BLAST results are available for this feature:
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOS1AP2.407e-4049.40nitric oxide synthase 1 adaptor protein [Source:HG... [more]
NOS1AP8.481e-4050.60nitric oxide synthase 1 adaptor protein [Source:HG... [more]
NOS1AP2.334e-3950.60nitric oxide synthase 1 adaptor protein [Source:HG... [more]
LDLRAP13.098e-724.68low density lipoprotein receptor adaptor protein 1... [more]
ANKS1B7.699e-736.92ankyrin repeat and sterile alpha motif domain cont... [more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dyc-13.025e-4650.62Dystrophin-like protein 1 [Source:UniProtKB/Swiss... [more]
dyc-13.025e-4650.62Dystrophin-like protein 1 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG426732.003e-3748.15gene:FBgn0261555 transcript:FBtr0302711[more]
CG426737.523e-3748.15gene:FBgn0261555 transcript:FBtr0302709[more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nos1apa2.157e-4050.00nitric oxide synthase 1 (neuronal) adaptor protein... [more]
nos1apa6.666e-4050.00nitric oxide synthase 1 (neuronal) adaptor protein... [more]
si:dkey-34e4.18.338e-3748.82si:dkey-34e4.1 [Source:ZFIN;Acc:ZDB-GENE-070705-45... [more]
si:dkey-34e4.11.283e-3648.63si:dkey-34e4.1 [Source:ZFIN;Acc:ZDB-GENE-070705-45... [more]
nos1apb1.634e-3655.03nitric oxide synthase 1 (neuronal) adaptor protein... [more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000019712.18.172e-4649.71carboxyl-terminal PDZ ligand of neuronal nitric ox... [more]
ski3.901e-4148.59SKI proto-oncogene [Source:Xenbase;Acc:XB-GENE-494... [more]
ski9.961e-4149.14SKI proto-oncogene [Source:Xenbase;Acc:XB-GENE-494... [more]
ski2.292e-2845.39SKI proto-oncogene [Source:Xenbase;Acc:XB-GENE-494... [more]
znf238.21.547e-725.31zinc finger protein 238, gene 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nos1ap1.716e-3950.60nitric oxide synthase 1 (neuronal) adaptor protein... [more]
Nos1ap3.167e-3248.98nitric oxide synthase 1 (neuronal) adaptor protein... [more]
Ldlrap13.366e-825.97low density lipoprotein receptor adaptor protein 1... [more]
Anks1b3.669e-735.21ankyrin repeat and sterile alpha motif domain cont... [more]
Anks1b3.669e-735.21ankyrin repeat and sterile alpha motif domain cont... [more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8STF6|DYC1_CAEEL3.848e-4550.62Dystrophin-like protein 1 OS=Caenorhabditis elegan... [more]
sp|O75052|CAPON_HUMAN4.073e-3950.60Carboxyl-terminal PDZ ligand of neuronal nitric ox... [more]
sp|Q9D3A8|CAPON_MOUSE1.201e-3850.60Carboxyl-terminal PDZ ligand of neuronal nitric ox... [more]
sp|O54960|CAPON_RAT1.324e-3850.60Carboxyl-terminal PDZ ligand of neuronal nitric ox... [more]
sp|Q8SXX4|CAPON_DROME7.541e-3648.15Capon-like protein OS=Drosophila melanogaster OX=7... [more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DPF31.075e-4855.42PID domain-containing protein OS=Macrostomum ligna... [more]
A0A4Z2CYB01.223e-4849.49Dystrophin-like protein isoform 2 (Fragment) OS=Sc... [more]
A0A4S2LJ592.235e-4848.58Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4W3INZ51.516e-4754.43PID domain-containing protein OS=Callorhinchus mil... [more]
A0A267DQP82.007e-4755.42PID domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-34e4.11.680e-4449.45carboxyl-terminal PDZ ligand of neuronal nitric ox... [more]
nos1apb6.824e-3853.50carboxyl-terminal PDZ ligand of neuronal nitric ox... [more]
nos1apa2.957e-3750.00nitric oxide synthase 1 (neuronal) adaptor protein... [more]
ldlrap1b2.448e-825.32low density lipoprotein receptor adaptor protein 1... [more]
ldlrap1b7.428e-825.00low density lipoprotein receptor adaptor protein 1... [more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gulp1a3.875e-825.15GULP PTB domain containing engulfment adaptor 1a [... [more]
anks1b5.520e-633.33ankyrin repeat and sterile alpha motif domain cont... [more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO493714.382e-1028.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431442.579e-925.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-34e4.12.472e-4348.84carboxyl-terminal PDZ ligand of neuronal nitric ox... [more]
nos1apb2.089e-3952.15carboxyl-terminal PDZ ligand of neuronal nitric ox... [more]
ENSORLT00000029293.14.101e-3954.30carboxyl-terminal PDZ ligand of neuronal nitric ox... [more]
ENSORLT00000043507.11.278e-2649.61carboxyl-terminal PDZ ligand of neuronal nitric ox... [more]
ldlrap1a8.916e-824.53low density lipoprotein receptor adapter protein 1... [more]
back to top
BLAST of Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071224.10.000e+0100.00SMESG000071224.1[more]
SMESG000071224.10.000e+0100.00SMESG000071224.1[more]
SMESG000010313.11.900e-3238.62SMESG000010313.1[more]
SMESG000010313.13.330e-3138.62SMESG000010313.1[more]
SMESG000010313.17.158e-2336.48SMESG000010313.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012574 ID=SMED30012574|Name=Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1767bp
CAAAAACTGCGACAACTGATAATTATGGAAAACCTTAACAAAAATTAAAA
AATATGTCTATTTTGTCTGAAATCTTAAAATTTTATATCGGATCCATGGA
CGTCGCTAGACCTCAGAATCGCCTGGAAATTGTATCAGCAATGAGACGAA
TCAGGTTTGAATTCAAAGCTAAAGCCGTGAAAAAGGAACGAGTCTACTTT
AAAATTTCCATCGATGGGGTCTATGTTAATTTAAGAAGTCGCAAAAAGAC
TCCAATAAAACTCAGATTATCACAAAGCTTCAATCTCCTTAATGGCCCCT
CTTCTGATCATCCAGTCAACAATTCTGCCACAGGATTGCTCTTAATGCAT
CATCCCATATACAGAATCTTTTACGTATCACACGACTCACAGGATCTTAA
AATATTCAGCTACATTGCTAGAGACAGCAAGTCCACTAATTTTAAGTGCA
ATGTTTTCAAAGCTTTACGAAAGATGGAAGCAATGAAAATCGTTCGCACA
GTTGGACAAGCATTTGATGTTTGTCATCGAATCAATCAAAAGTCTGAAGA
CACAAAAAGCAACTCAGAATATAACCCAACAATTGATGAAGAAAATTCCA
CAGAAACCAGAAATCAAAACTCAAGTATGACGAGTTCGTCCCAAGAAAAG
AAAATTTCTTCTTCTCAATCTGCTCAACCTATTAGATCTGCCGATCTAGT
TAAAATTGACGATGAAGCTCAAAGTGATTCACAATCTGAATCTTTATCAA
CTCTAGATGACCTAATCATGCAAAGTTCTACAAAAAAGGACGGAAGAAGA
ACTGTGCCGAATTCAATCAGTGAACCAAGCATAAAATTGCATTCTAATGG
TCTGAATGAAGAGAAAAAAATAACTTTTGACAGCTTCCTTTCATCATATC
TCTTCCTGAATTATATTATATCAAATCAGTTATCGGAAATGAATTCCAAC
CTTTCAGGAGAATTGATAAAAACTGTGAATTCCAAATTGCCAACTTTTGA
TAAACTTTTCAGTCCCCAGTTTTTCCGACCTGAAAACCTCGGCACGAAAA
TATCCAAAACTCAATTGGAATTGTTGAAAAATCAATTAGAAGAAGAAATC
AAATTCAGAATAAAATGCCAGAGTCAAATAGAAGAGCTGGCGTGTCAGAA
CAAAGTACTATCAACATTCATCAAGCGAACATTCGAAGAGATTCGTCAAA
ATCAGTGTGAATCATGCATGCTTCGCTTATCTGGGCTCGATATCACAACG
AGCACTTGTTCGTCACTCGAGAACCATCGCAACTCAAGACCAAATTGCGC
AAATGAAATCGATCTTAATCAATTGTTTCAGGAAAATCTTAGATTTCCTG
CAGCAAACAGTCAAGAGTCTTCCATAAATTCAAATTTTTTCAAAAATAAT
CATTCTGATCAGAAAGCCATATATTTCAATGAATTATTTTCCGAGCACAA
TGAAAAGGAAATCCCTTTCGATGAAATGGACTTCTACCGGAAATTGGATC
ATTCAATTACCAGAAACTTTTATAAAATGGCTTCTTGGTCACCCCACGTC
AACGGTGATTATCACATTGATCTTAAAAAGTCAAAATCTTCCAATGACCC
AAGTCAATGTACAAGCGAAACCAGTATTGCCAATTCTCAAGAAGAAATTA
ATAAATTCAATGATAAAATTATGAATTTCTAAATAAATAAATTTCTGATT
TTTTTTCCTTTTAAATATTAACCTAGTTCCTATCAAAATCTACTTGATTA
ATTTTGATATATACTCA
back to top

protein sequence of SMED30012574-orf-1

>SMED30012574-orf-1 ID=SMED30012574-orf-1|Name=SMED30012574-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=543bp
MSILSEILKFYIGSMDVARPQNRLEIVSAMRRIRFEFKAKAVKKERVYFK
ISIDGVYVNLRSRKKTPIKLRLSQSFNLLNGPSSDHPVNNSATGLLLMHH
PIYRIFYVSHDSQDLKIFSYIARDSKSTNFKCNVFKALRKMEAMKIVRTV
GQAFDVCHRINQKSEDTKSNSEYNPTIDEENSTETRNQNSSMTSSSQEKK
ISSSQSAQPIRSADLVKIDDEAQSDSQSESLSTLDDLIMQSSTKKDGRRT
VPNSISEPSIKLHSNGLNEEKKITFDSFLSSYLFLNYIISNQLSEMNSNL
SGELIKTVNSKLPTFDKLFSPQFFRPENLGTKISKTQLELLKNQLEEEIK
FRIKCQSQIEELACQNKVLSTFIKRTFEEIRQNQCESCMLRLSGLDITTS
TCSSLENHRNSRPNCANEIDLNQLFQENLRFPAANSQESSINSNFFKNNH
SDQKAIYFNELFSEHNEKEIPFDEMDFYRKLDHSITRNFYKMASWSPHVN
GDYHIDLKKSKSSNDPSQCTSETSIANSQEEINKFNDKIMNF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR006020PTB/PI_dom
IPR011993PH-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0050998nitric-oxide synthase binding
Vocabulary: biological process
TermDefinition
GO:0003062regulation of heart rate by chemical signal
GO:0010628positive regulation of gene expression
GO:0010750positive regulation of nitric oxide mediated signal transduction
GO:0042981regulation of apoptotic process
GO:0045428regulation of nitric oxide biosynthetic process
GO:0045429positive regulation of nitric oxide biosynthetic process
GO:0050999regulation of nitric-oxide synthase activity
GO:0051000positive regulation of nitric-oxide synthase activity
GO:0060307regulation of ventricular cardiac muscle cell membrane repolarization
GO:0098901regulation of cardiac muscle cell action potential
GO:1901381positive regulation of potassium ion transmembrane transport
GO:1901841regulation of high voltage-gated calcium channel activity
GO:1902261positive regulation of delayed rectifier potassium channel activity
GO:1902514regulation of calcium ion transmembrane transport via high voltage-gated calcium channel
GO:1903762positive regulation of voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization
GO:2000170positive regulation of peptidyl-cysteine S-nitrosylation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005739mitochondrion
GO:0005829cytosol
GO:0030018Z disc
GO:0033017sarcoplasmic reticulum membrane
GO:0048471perinuclear region of cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006020PTB/PI domainSMARTSM00462PTB_9coord: 5..167
e-value: 3.6E-23
score: 93.0
IPR006020PTB/PI domainPFAMPF00640PIDcoord: 11..159
e-value: 1.0E-16
score: 61.3
IPR006020PTB/PI domainPROSITEPS01179PIDcoord: 88..165
score: 11.455
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 8..167
e-value: 3.4E-40
score: 138.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 164..257
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 225..257
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 167..211
NoneNo IPR availablePANTHERPTHR11232DISABLED/NUMB-RELATED ADAPTORcoord: 11..387
NoneNo IPR availablePANTHERPTHR11232:SF17NITRIC OXIDE SYNTHASE 1 (NEURONAL) ADAPTOR PROTEIN A-RELATEDcoord: 11..387
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 10..164