Leucine--tRNA ligase

Overview
NameLeucine--tRNA ligase
Smed IDSMED30012572
Length (bp)2670
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine--tRNA ligase (SMED30012572) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine--tRNA ligase (SMED30012572) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine--tRNA ligase (SMED30012572) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine--tRNA ligase (SMED30012572) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012572

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012572SMESG000071689.1 SmedASXL_015954SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30012572SMESG000071689.1 dd_Smed_v4_9705_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012572SMESG000071689.1 dd_Smed_v4_9705_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30012572SMESG000071689.1 dd_Smed_v4_9705_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012572SMESG000071689.1 dd_Smed_v4_9705_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012572SMESG000071689.1 dd_Smed_v4_9705_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012572SMESG000071689.1 dd_Smed_v4_9705_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30012572SMESG000071689.1 dd_Smed_v4_9705_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine--tRNA ligase vs. Ensembl Human
Match: LARS2 (leucyl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:17095])

HSP 1 Score: 497.278 bits (1279), Expect = 8.726e-162
Identity = 296/795 (37.23%), Postives = 441/795 (55.47%), Query Frame = 2
Query:  200 YDFNVKKQLETFW----QEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL-VDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIP------------IIRNQNL------KFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTL----RIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVN--DPKVFLVNDFLLQDSEFIAKYQ-SLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLA 2491
            Y    +K +E +W    +E+ SKI++ D  ++ K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++R   P+ WT  NI  M++Q+ +++ L   W RE++TC P+YYKWTQ+LF +L+E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  L+QWFI+TTA ++++ D L  +   +W  +   Q  WIGD  G ++DF L V  Q      EKL+ +T  P A      + V I+  +               L  H SL  K  L   L+P            ++  Q +      K   +  + S++G+P    +D  LA  LG+        AY+ ++++    +E  +          +     L    R   +GG   S    DWLISRQRYWGTPIPIVHCP CGP   P   LPV LP       +    +   PL+ A  W+   CP+C    A RE+DTMDTFVDS+WY+ RY D  N     + +V    MPVD+YIGG EHA+ HL+YARF SHF H   D K+    EPF + L  GL+  QT++  SG+++   +V      PV+   +E L   W+KMSKSK NG+ P+ VV++YG+D  RL IL    P+K+  W  + D + G+  W++R+W L    + +  +   P+  L+++    ++  + +Y+ S+++++   + + F+++  +S L  L++   + S      S  +   L   ++   PL+P ++SE+WA LA
Sbjct:   51 YTLQTRKDVEKWWHQRIKEQASKISEADK-SKPKFYVLSMFPYPSGKLHMGHVRVYTISDTIARFQKMRGMQVINPMGWDAFGLPAENAAVERNLHPQSWTQSNIKHMRKQL-DRLGLCFSWDREITTCLPDYYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVDEHGCSWRSGAKVEQKYLRQWFIKTTAYAKAMQDALADLP--EWYGIKGMQAHWIGDCVGCHLDFTLKVHGQATG---EKLTAYTATPEAIYG--TSHVAISPSH-------------RLLHGHSSL--KEALRMALVPGKDCLTPVMAVNMLTQQEVPVVILAKADLEGSLDSKIGIPSTSSEDTILAQTLGL--------AYSEVIETLPDGTERLSSSAEFTGMTRQDAFLALTQKARGKRVGGDVTSDKLKDWLISRQRYWGTPIPIVHCPVCGPTPVPLEDLPVTLP-----NIASFTGKGGPPLAMASEWVNCSCPRCKG-AAKRETDTMDTFVDSAWYYFRYTDPHNPHSPFNTAVADYWMPVDLYIGGKEHAVMHLFYARFFSHFCH---DQKMVKHREPFHKLLAQGLIKGQTFRLPSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWTLTTRFIEARASGKSPQPQLLSNKEKAEARKLWEYKNSVISQVTTHFTEDFSLNSAISQLMGLSNALSQASQSVILHSPEFEDALCALMVMAAPLAPHVTSEIWAGLA 804          
BLAST of Leucine--tRNA ligase vs. Ensembl Human
Match: LARS2 (leucyl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:17095])

HSP 1 Score: 497.278 bits (1279), Expect = 8.726e-162
Identity = 296/795 (37.23%), Postives = 441/795 (55.47%), Query Frame = 2
Query:  200 YDFNVKKQLETFW----QEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL-VDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIP------------IIRNQNL------KFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTL----RIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVN--DPKVFLVNDFLLQDSEFIAKYQ-SLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLA 2491
            Y    +K +E +W    +E+ SKI++ D  ++ K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++R   P+ WT  NI  M++Q+ +++ L   W RE++TC P+YYKWTQ+LF +L+E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  L+QWFI+TTA ++++ D L  +   +W  +   Q  WIGD  G ++DF L V  Q      EKL+ +T  P A      + V I+  +               L  H SL  K  L   L+P            ++  Q +      K   +  + S++G+P    +D  LA  LG+        AY+ ++++    +E  +          +     L    R   +GG   S    DWLISRQRYWGTPIPIVHCP CGP   P   LPV LP       +    +   PL+ A  W+   CP+C    A RE+DTMDTFVDS+WY+ RY D  N     + +V    MPVD+YIGG EHA+ HL+YARF SHF H   D K+    EPF + L  GL+  QT++  SG+++   +V      PV+   +E L   W+KMSKSK NG+ P+ VV++YG+D  RL IL    P+K+  W  + D + G+  W++R+W L    + +  +   P+  L+++    ++  + +Y+ S+++++   + + F+++  +S L  L++   + S      S  +   L   ++   PL+P ++SE+WA LA
Sbjct:   51 YTLQTRKDVEKWWHQRIKEQASKISEADK-SKPKFYVLSMFPYPSGKLHMGHVRVYTISDTIARFQKMRGMQVINPMGWDAFGLPAENAAVERNLHPQSWTQSNIKHMRKQL-DRLGLCFSWDREITTCLPDYYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVDEHGCSWRSGAKVEQKYLRQWFIKTTAYAKAMQDALADLP--EWYGIKGMQAHWIGDCVGCHLDFTLKVHGQATG---EKLTAYTATPEAIYG--TSHVAISPSH-------------RLLHGHSSL--KEALRMALVPGKDCLTPVMAVNMLTQQEVPVVILAKADLEGSLDSKIGIPSTSSEDTILAQTLGL--------AYSEVIETLPDGTERLSSSAEFTGMTRQDAFLALTQKARGKRVGGDVTSDKLKDWLISRQRYWGTPIPIVHCPVCGPTPVPLEDLPVTLP-----NIASFTGKGGPPLAMASEWVNCSCPRCKG-AAKRETDTMDTFVDSAWYYFRYTDPHNPHSPFNTAVADYWMPVDLYIGGKEHAVMHLFYARFFSHFCH---DQKMVKHREPFHKLLAQGLIKGQTFRLPSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWTLTTRFIEARASGKSPQPQLLSNKEKAEARKLWEYKNSVISQVTTHFTEDFSLNSAISQLMGLSNALSQASQSVILHSPEFEDALCALMVMAAPLAPHVTSEIWAGLA 804          
BLAST of Leucine--tRNA ligase vs. Ensembl Human
Match: LARS2 (leucyl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:17095])

HSP 1 Score: 497.278 bits (1279), Expect = 8.726e-162
Identity = 296/795 (37.23%), Postives = 441/795 (55.47%), Query Frame = 2
Query:  200 YDFNVKKQLETFW----QEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL-VDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIP------------IIRNQNL------KFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTL----RIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVN--DPKVFLVNDFLLQDSEFIAKYQ-SLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLA 2491
            Y    +K +E +W    +E+ SKI++ D  ++ K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++R   P+ WT  NI  M++Q+ +++ L   W RE++TC P+YYKWTQ+LF +L+E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  L+QWFI+TTA ++++ D L  +   +W  +   Q  WIGD  G ++DF L V  Q      EKL+ +T  P A      + V I+  +               L  H SL  K  L   L+P            ++  Q +      K   +  + S++G+P    +D  LA  LG+        AY+ ++++    +E  +          +     L    R   +GG   S    DWLISRQRYWGTPIPIVHCP CGP   P   LPV LP       +    +   PL+ A  W+   CP+C    A RE+DTMDTFVDS+WY+ RY D  N     + +V    MPVD+YIGG EHA+ HL+YARF SHF H   D K+    EPF + L  GL+  QT++  SG+++   +V      PV+   +E L   W+KMSKSK NG+ P+ VV++YG+D  RL IL    P+K+  W  + D + G+  W++R+W L    + +  +   P+  L+++    ++  + +Y+ S+++++   + + F+++  +S L  L++   + S      S  +   L   ++   PL+P ++SE+WA LA
Sbjct:   51 YTLQTRKDVEKWWHQRIKEQASKISEADK-SKPKFYVLSMFPYPSGKLHMGHVRVYTISDTIARFQKMRGMQVINPMGWDAFGLPAENAAVERNLHPQSWTQSNIKHMRKQL-DRLGLCFSWDREITTCLPDYYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVDEHGCSWRSGAKVEQKYLRQWFIKTTAYAKAMQDALADLP--EWYGIKGMQAHWIGDCVGCHLDFTLKVHGQATG---EKLTAYTATPEAIYG--TSHVAISPSH-------------RLLHGHSSL--KEALRMALVPGKDCLTPVMAVNMLTQQEVPVVILAKADLEGSLDSKIGIPSTSSEDTILAQTLGL--------AYSEVIETLPDGTERLSSSAEFTGMTRQDAFLALTQKARGKRVGGDVTSDKLKDWLISRQRYWGTPIPIVHCPVCGPTPVPLEDLPVTLP-----NIASFTGKGGPPLAMASEWVNCSCPRCKG-AAKRETDTMDTFVDSAWYYFRYTDPHNPHSPFNTAVADYWMPVDLYIGGKEHAVMHLFYARFFSHFCH---DQKMVKHREPFHKLLAQGLIKGQTFRLPSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWTLTTRFIEARASGKSPQPQLLSNKEKAEARKLWEYKNSVISQVTTHFTEDFSLNSAISQLMGLSNALSQASQSVILHSPEFEDALCALMVMAAPLAPHVTSEIWAGLA 804          
BLAST of Leucine--tRNA ligase vs. Ensembl Human
Match: LARS2 (leucyl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:17095])

HSP 1 Score: 432.18 bits (1110), Expect = 2.243e-137
Identity = 264/732 (36.07%), Postives = 397/732 (54.23%), Query Frame = 2
Query:  377 RVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL-VDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIP------------IIRNQNL------KFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTL----RIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVN--DPKVFLVNDFLLQDSEFIAKYQ-SLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLA 2491
            + +++   +VI PMGWDAFGLPAENAA++R   P+ WT  NI  M++Q+ +++ L   W RE++TC P+YYKWTQ+LF +L+E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  L+QWFI+TTA ++++ D L  +   +W  +   Q  WIGD  G ++DF L V  Q      EKL+ +T  P A      + V I+  +               L  H SL  K  L   L+P            ++  Q +      K   +  + S++G+P    +D  LA  LG+        AY+ ++++    +E  +          +     L    R   +GG   S    DWLISRQRYWGTPIPIVHCP CGP   P   LPV LP       +    +   PL+ A  W+   CP+C    A RE+DTMDTFVDS+WY+ RY D  N     + +V    MPVD+YIGG EHA+ HL+YARF SHF H   D K+    EPF + L  GL+  QT++  SG+++   +V      PV+   +E L   W+KMSKSK NG+ P+ VV++YG+D  RL IL    P+K+  W  + D + G+  W++R+W L    + +  +   P+  L+++    ++  + +Y+ S+++++   + + F+++  +S L  L++   + S      S  +   L   ++   PL+P ++SE+WA LA
Sbjct:   70 QASKISEADVINPMGWDAFGLPAENAAVERNLHPQSWTQSNIKHMRKQL-DRLGLCFSWDREITTCLPDYYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVDEHGCSWRSGAKVEQKYLRQWFIKTTAYAKAMQDALADLP--EWYGIKGMQAHWIGDCVGCHLDFTLKVHGQATG---EKLTAYTATPEAIYG--TSHVAISPSH-------------RLLHGHSSL--KEALRMALVPGKDCLTPVMAVNMLTQQEVPVVILAKADLEGSLDSKIGIPSTSSEDTILAQTLGL--------AYSEVIETLPDGTERLSSSAEFTGMTRQDAFLALTQKARGKRVGGDVTSDKLKDWLISRQRYWGTPIPIVHCPVCGPTPVPLEDLPVTLP-----NIASFTGKGGPPLAMASEWVNCSCPRCKG-AAKRETDTMDTFVDSAWYYFRYTDPHNPHSPFNTAVADYWMPVDLYIGGKEHAVMHLFYARFFSHFCH---DQKMVKHREPFHKLLAQGLIKGQTFRLPSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWTLTTRFIEARASGKSPQPQLLSNKEKAEARKLWEYKNSVISQVTTHFTEDFSLNSAISQLMGLSNALSQASQSVILHSPEFEDALCALMVMAAPLAPHVTSEIWAGLA 761          
BLAST of Leucine--tRNA ligase vs. Ensembl Human
Match: LARS2 (leucyl-tRNA synthetase 2, mitochondrial [Source:HGNC Symbol;Acc:HGNC:17095])

HSP 1 Score: 404.445 bits (1038), Expect = 4.790e-130
Identity = 231/567 (40.74%), Postives = 318/567 (56.08%), Query Frame = 2
Query:  200 YDFNVKKQLETFW----QEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL-VDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIP------------IIRNQNL------KFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTL----RIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIH 1819
            Y    +K +E +W    +E+ SKI++ D  ++ K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++R   P+ WT  NI  M++Q+ +++ L   W RE++TC P+YYKWTQ+LF +L+E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  L+QWFI+TTA ++++ D L  +   +W  +   Q  WIGD  G ++DF L V  Q      EKL+ +T  P A      + V I+  +               L  H SL  K  L   L+P            ++  Q +      K   +  + S++G+P    +D  LA  LG+        AY+ ++++    +E  +          +     L    R   +GG   S    DWLISRQRYWGTPIPIVHCP CGP   P   LPV LP       +    +   PL+ A  W+   CP+C    A RE+DTMDTFVDS+WY+ RY D  N     + +V    MPVD+YIGG EHA+ HL+YARF SHF H
Sbjct:   51 YTLQTRKDVEKWWHQRIKEQASKISEADK-SKPKFYVLSMFPYPSGKLHMGHVRVYTISDTIARFQKMRGMQVINPMGWDAFGLPAENAAVERNLHPQSWTQSNIKHMRKQL-DRLGLCFSWDREITTCLPDYYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVDEHGCSWRSGAKVEQKYLRQWFIKTTAYAKAMQDALADLP--EWYGIKGMQAHWIGDCVGCHLDFTLKVHGQATG---EKLTAYTATPEAIYG--TSHVAISPSH-------------RLLHGHSSL--KEALRMALVPGKDCLTPVMAVNMLTQQEVPVVILAKADLEGSLDSKIGIPSTSSEDTILAQTLGL--------AYSEVIETLPDGTERLSSSAEFTGMTRQDAFLALTQKARGKRVGGDVTSDKLKDWLISRQRYWGTPIPIVHCPVCGPTPVPLEDLPVTLP-----NIASFTGKGGPPLAMASEWVNCSCPRCKG-AAKRETDTMDTFVDSAWYYFRYTDPHNPHSPFNTAVADYWMPVDLYIGGKEHAVMHLFYARFFSHFCH 579          
BLAST of Leucine--tRNA ligase vs. Ensembl Celegans
Match: lars-2 (Leucyl Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:Q23511])

HSP 1 Score: 389.423 bits (999), Expect = 1.207e-121
Identity = 251/742 (33.83%), Postives = 384/742 (51.75%), Query Frame = 2
Query:  218 KQLETFWQEKMS---KITQNDSAN-RKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVA--FVEINNDN--IWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDF-KDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTY-QTKSGKFIPNHQVKYLDDK-PVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFL---VNDFLLQDSEFIAKYQSLVTKILFQYQKSFT-ISVVVSVLQKLTSLYMKFSNEKAKS 2398
            K LE  W + +    + ++N  +N   K YILSMFPYPSG+LH+GHMRVYT +D  AR  RL  +EVI P+GWD+FGLPAENAA  +G +P +WT+ NI  MK+Q+ +   L  DW +E+STC+P +++WTQW+FC+LFE G V + S  VNWDPIDKTVLA E IDN G+SWRSGA  EK  L QW I T   ++ L +GL  +   QW  V + Q  WIG         D+  F         L V  +     + D       EI+N    +         K   +  +     + + ++GR IP+I  ++     Q  V+S L   + +F KD  L  K    F+        ++ K+  +E   +                     G GGY  S+  TDW++SRQR WGTPIP++       V    N+LPV+                     +     K    + G      ++DT+DTF DS+WY+LRYLD+KN   L S   + ++MPVD+Y+GG+EHA  H+++ARF+++F+    DI +    EPF+  +P G+V  +T+ + ++GK++ +  V+   DK  +  D+   +   ++KMSKSK NG+    ++D  G+DMTRL +L    P     W E D+  GI+    R+  +  +IV++  N   + L   ++  + +   F  +   +  ++L  +  +   I    + L+K+  +Y+  S E  ++
Sbjct:   31 KMLEKHWSKSLVDSFESSKNKPSNLNGKKYILSMFPYPSGRLHIGHMRVYTISDATARYYRLNGYEVIHPIGWDSFGLPAENAARDKGVDPREWTINNIESMKQQLLKTKIL-FDWEKEISTCEPEFFRWTQWIFCKLFEYGLVKRTSSEVNWDPIDKTVLAAEQIDNDGKSWRSGAKAEKKKLSQWMIETPKYAKRLQEGLRKM-SEQWGEVADIQANWIGKC-------DVYRFM--------LPVMKDGSNDEIIDLRIKDIFEISNAEFLVLKQSHSLADKDATQFPYKLPFQVLNGVTGRQIPVIVVED---TYQPDVTSFLNSRIGNFQKDKILVEK----FAIAEPKHKRKLTKNDIQEMASFG--------------------GYGGYETSRTLTDWVVSRQRGWGTPIPMIQTKDGKRVAVQLNKLPVL------------------GSDRGQEVDKERFGESG----VFDTDTLDTFFDSAWYYLRYLDNKNKSELISKGAM-KNMPVDVYVGGIEHAAVHMFFARFVAYFLK---DINVIQTAEPFTDLIPQGIVRGKTFIEKETGKYLGSEDVQQSGDKLTLKNDSSVEVDAVYEKMSKSKNNGVDLAAILDSEGVDMTRLRLLEAAAPRAPINWGETDLK-GIKKLLDRIAAINSQIVDARDNGKPIELKKEIDGSIKETYNFFVRNVGMCLEVLHLHNTALMRIQGFTNALKKVDPIYLAHSPEGQRA 701          
BLAST of Leucine--tRNA ligase vs. Ensembl Celegans
Match: lars-2 (Leucyl Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:Q23511])

HSP 1 Score: 145.206 bits (365), Expect = 7.534e-37
Identity = 83/263 (31.56%), Postives = 150/263 (57.03%), Query Frame = 2
Query: 1628 ESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTY-QTKSGKFIPNHQVKYLDDK-PVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFL---VNDFLLQDSEFIAKYQSLVTKILFQYQKSFT-ISVVVSVLQKLTSLYMKFSNEKAKS 2398
            ++DT+DTF DS+WY+LRYLD+KN   L S   + ++MPVD+Y+GG+EHA  H+++ARF+++F+    DI +    EPF+  +P G+V  +T+ + ++GK++ +  V+   DK  +  D+   +   ++KMSKSK NG+    ++D  G+DMTRL +L    P     W E D+  GI+    R+  +  +IV++  N   + L   ++  + +   F  +   +  ++L  +  +   I    + L+K+  +Y+  S E  ++
Sbjct:   40 DTDTLDTFFDSAWYYLRYLDNKNKSELISKGAM-KNMPVDVYVGGIEHAAVHMFFARFVAYFLK---DINVIQTAEPFTDLIPQGIVRGKTFIEKETGKYLGSEDVQQSGDKLTLKNDSSVEVDAVYEKMSKSKNNGVDLAAILDSEGVDMTRLRLLEAAAPRAPINWGETDLK-GIKKLLDRIAAINSQIVDARDNGKPIELKKEIDGSIKETYNFFVRNVGMCLEVLHLHNTALMRIQGFTNALKKVDPIYLAHSPEGQRA 297          
BLAST of Leucine--tRNA ligase vs. Ensembl Celegans
Match: iars-2 (Isoleucyl Amino-acyl tRNA Synthetase [Source:UniProtKB/TrEMBL;Acc:E2JL04])

HSP 1 Score: 61.6178 bits (148), Expect = 2.136e-9
Identity = 43/168 (25.60%), Postives = 72/168 (42.86%), Query Frame = 2
Query:  275 ANRKKMYILSMF---PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAE-NAALQRGYEPEKWTLKNISEMK----EQMKEQMT------LSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGA 736
            A RK   I  +    PY +G+ H GH       D + +    + + V+F  GWD  GLP E     Q+G    +  L+  +  +    E + +QM       ++ DW +   T  P+Y      +F +L E+  VY+  + V W P   T LA+  ++   +   + A
Sbjct:   81 AARKDSEIFELLDGPPYANGEAHTGHAINKILKDFVVKSRIALGYRVLFRPGWDCHGLPIELKIGKQQGNAGSRTPLETRAAARIVADEAIGKQMNAFRRWGVTADWEKPYVTKSPSYVAAQLDIFAKLVEQKLVYRSFKPVYWSPSSNTALAESELEYNDKHQSTSA 248          
BLAST of Leucine--tRNA ligase vs. Ensembl Celegans
Match: glp-4 (Valine--tRNA ligase [Source:UniProtKB/Swiss-Prot;Acc:Q9U1Q4])

HSP 1 Score: 61.6178 bits (148), Expect = 2.598e-9
Identity = 39/150 (26.00%), Postives = 65/150 (43.33%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQR---------------GYEPEKWTLKNISEMKEQMKEQ---MTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELID 706
            P  +G LH+GH    T  D + R NR+     +F  G D  G+  +    +R                +  E W  KN  E  + + +Q   +  S+DW R + T DP   +     F R+ E G +Y+ + +VNW    ++ ++D  +D
Sbjct:  127 PNVTGNLHVGHALATTVEDTITRFNRMHGKRTLFNPGCDHAGIATQVVVEKRLKRERGLTRHDLGRDRFNQEVWHWKN--EKGDVIYDQFRKLGASVDWDRAVFTMDPKMCRAVTEAFIRMHESGTIYRSNRLVNWSCALRSAISDIEVD 274          
BLAST of Leucine--tRNA ligase vs. Ensembl Celegans
Match: glp-4 (Valine--tRNA ligase [Source:UniProtKB/Swiss-Prot;Acc:Q9U1Q4])

HSP 1 Score: 61.6178 bits (148), Expect = 2.598e-9
Identity = 39/150 (26.00%), Postives = 65/150 (43.33%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQR---------------GYEPEKWTLKNISEMKEQMKEQ---MTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELID 706
            P  +G LH+GH    T  D + R NR+     +F  G D  G+  +    +R                +  E W  KN  E  + + +Q   +  S+DW R + T DP   +     F R+ E G +Y+ + +VNW    ++ ++D  +D
Sbjct:  127 PNVTGNLHVGHALATTVEDTITRFNRMHGKRTLFNPGCDHAGIATQVVVEKRLKRERGLTRHDLGRDRFNQEVWHWKN--EKGDVIYDQFRKLGASVDWDRAVFTMDPKMCRAVTEAFIRMHESGTIYRSNRLVNWSCALRSAISDIEVD 274          
BLAST of Leucine--tRNA ligase vs. Ensembl Fly
Match: LeuRS-m (gene:FBgn0027085 transcript:FBtr0073348)

HSP 1 Score: 542.347 bits (1396), Expect = 6.258e-180
Identity = 303/730 (41.51%), Postives = 423/730 (57.95%), Query Frame = 2
Query:  194 PHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTK-SGKFIPNHQVKYLDDK---PVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLV---NDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTS 2362
            P    +VK ++E  W+E++S    N   ++ K Y+LSMFPYPSG LHMGH+RVYT AD +AR  R+    V  PMGWD+FGLPAENAA QRG EP  WT +NI++MKEQ+K ++  S DW+ ELSTC P YYKWTQ LF  L   G  YQ   +VNWDP+DKTVLADE +D  G SWRSGA VEK  L+QWFIRT+A ++ LLDGL+      WR +I  Q+ WIG+  G    F+L+           L V+T HP   L D  AF+ + +++              KL    SL+  +P +G  +P++ +  + F  +  V   L  P    +D  L    G+  +F   G     +  A      W +       L ++ L+    + +GGYR S    DWLISRQRYWGTPIPIVHC  CG V  P+ QLPV LPP                  +AF     +CPKCG  +A RE+DTMDTFVDSSWY+LRYLD++NS+ +   ++  + MPVD+YIGG EHA+ HLYYARF++HF+H      L    EPFS+ L  G+V+ ++++ K SG+++P  +V+ ++ K    V  + +EP+   W+KMSKSK NG+ P  + ++YG D TRLIILA+  P  +R W  +    GI NW++R+W  +++   +  +     +V    +FL +D++        V    F Y+ +  +SV +S +Q LT+
Sbjct:   32 PELTSDVKHRIEAHWREQLSGGQFNPKDSQDKYYVLSMFPYPSGNLHMGHVRVYTIADSVARFQRMCGKNVFQPMGWDSFGLPAENAANQRGVEPASWTEQNIAQMKEQLK-RLGCSFDWNHELSTCSPKYYKWTQHLFLMLHRHGLAYQNEALVNWDPVDKTVLADEQVDANGCSWRSGAKVEKKLLRQWFIRTSAYAKQLLDGLEDPTLRDWRDIINLQRHWIGECDGYA--FNLL-----TSASGLLRVWTTHP-EHLKDPHAFLVLRSNH-----------HLSKLKGADSLSAANPFAGTTMPVVFSDEVTFPPKSDVY--LAAPSFRGEDKDLWDSYGL--AFTSNGKDEESLSPA-----NWEM-------LRKEVLQAATRLNVGGYRVSSKLKDWLISRQRYWGTPIPIVHCQKCGAVPVPEEQLPVSLPP-------------KDSPKEAF---LCDCPKCGEKDARRETDTMDTFVDSSWYYLRYLDAQNSERIFDTALTKKFMPVDLYIGGKEHAVLHLYYARFINHFLH---SCGLSPTSEPFSRLLVQGMVMGRSFRVKGSGRYVPETEVEIVNAKKNQAVLKETKEPVVMTWEKMSKSKLNGVEPSDMFNEYGTDTTRLIILADVAPTSHRNW-SSATFPGILNWQKRLWLTLQDFQQAREDQTASDVVPTSEEFLAEDAKLFDARNFYVKGATFNYRHAQQLSVAISKMQGLTN 705          
BLAST of Leucine--tRNA ligase vs. Ensembl Fly
Match: ValRS (gene:FBgn0027079 transcript:FBtr0087735)

HSP 1 Score: 58.151 bits (139), Expect = 3.659e-8
Identity = 43/176 (24.43%), Postives = 77/176 (43.75%), Query Frame = 2
Query:  269 DSANRKKMYILSMFPYP--SGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMK-----------------EQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNT---GRSWRS 730
            D+ N    +++ + P P  +G LH+GH       D + R +R+     ++  G D  G+  +    +  +  EK +  ++   K                 EQ+K  +  S DW+R   T DP   +     F RL E+G +Y+ S +VNW    ++ ++D  +D     GR++ S
Sbjct:  123 DAPNPNGKFVM-IIPPPNVTGSLHLGHALTNAIEDAITRYHRMKGRTTLWVPGCDHAGIATQVVVEKLLWRDEKLSRHDLGREKFIERIWDWRREKGGRIYEQLK-SLGSSYDWTRVAFTMDPKLCRAVTEAFVRLHEEGSIYRSSRLVNWSCTLRSAISDIEVDKVEIPGRTFLS 296          
BLAST of Leucine--tRNA ligase vs. Ensembl Fly
Match: ValRS (gene:FBgn0027079 transcript:FBtr0087734)

HSP 1 Score: 58.151 bits (139), Expect = 3.659e-8
Identity = 43/176 (24.43%), Postives = 77/176 (43.75%), Query Frame = 2
Query:  269 DSANRKKMYILSMFPYP--SGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMK-----------------EQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNT---GRSWRS 730
            D+ N    +++ + P P  +G LH+GH       D + R +R+     ++  G D  G+  +    +  +  EK +  ++   K                 EQ+K  +  S DW+R   T DP   +     F RL E+G +Y+ S +VNW    ++ ++D  +D     GR++ S
Sbjct:  123 DAPNPNGKFVM-IIPPPNVTGSLHLGHALTNAIEDAITRYHRMKGRTTLWVPGCDHAGIATQVVVEKLLWRDEKLSRHDLGREKFIERIWDWRREKGGRIYEQLK-SLGSSYDWTRVAFTMDPKLCRAVTEAFVRLHEEGSIYRSSRLVNWSCTLRSAISDIEVDKVEIPGRTFLS 296          
BLAST of Leucine--tRNA ligase vs. Ensembl Fly
Match: ValRS (gene:FBgn0027079 transcript:FBtr0333148)

HSP 1 Score: 58.151 bits (139), Expect = 3.759e-8
Identity = 43/176 (24.43%), Postives = 77/176 (43.75%), Query Frame = 2
Query:  269 DSANRKKMYILSMFPYP--SGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMK-----------------EQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNT---GRSWRS 730
            D+ N    +++ + P P  +G LH+GH       D + R +R+     ++  G D  G+  +    +  +  EK +  ++   K                 EQ+K  +  S DW+R   T DP   +     F RL E+G +Y+ S +VNW    ++ ++D  +D     GR++ S
Sbjct:  123 DAPNPNGKFVM-IIPPPNVTGSLHLGHALTNAIEDAITRYHRMKGRTTLWVPGCDHAGIATQVVVEKLLWRDEKLSRHDLGREKFIERIWDWRREKGGRIYEQLK-SLGSSYDWTRVAFTMDPKLCRAVTEAFVRLHEEGSIYRSSRLVNWSCTLRSAISDIEVDKVEIPGRTFLS 296          
BLAST of Leucine--tRNA ligase vs. Ensembl Fly
Match: IleRS-m (gene:FBgn0036569 transcript:FBtr0302328)

HSP 1 Score: 56.6102 bits (135), Expect = 1.108e-7
Identity = 41/138 (29.71%), Postives = 60/138 (43.48%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAE-----NAALQRGYEPEKWTLKNISEMKEQMKEQMT---LSIDWSRE--LSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLAD 694
            PY +GQLHMGH       D+  R        V +  GWD  GLP E      A  Q   E  + +     E  +  KE+ +   +  +W ++    T  P +      +F  L+EKG VY+  + V W P  +T LA+
Sbjct:   84 PYANGQLHMGHAVNKILKDITLRQRVAHGQRVNYIPGWDCHGLPIELKATSTAPGQSAQEIRQKSRAFAWEAIKSQKEEFSSWGILANWQKDNIYMTFQPEFIVNQLEMFYNLYEKGLVYRDLKPVYWSPSSRTALAE 221          
BLAST of Leucine--tRNA ligase vs. Ensembl Zebrafish
Match: lars2 (leucyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-070928-3])

HSP 1 Score: 498.819 bits (1283), Expect = 1.980e-163
Identity = 295/791 (37.29%), Postives = 444/791 (56.13%), Query Frame = 2
Query:  200 YDFNVKKQLETFWQEKMS---KITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL-VDFQDENRILEKLSVFTEHPVAALSDFVAFVEI-NNDNIWWNYXXXXXXXXXXLSFHR----SLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFV---RLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTK-SGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEI--VNSPVNDPKVFLVNDFLLQDSEFIAKYQS-LVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLASKLAPIESIF 2521
            Y    ++++E +W  ++    +    D ++RKK Y+LSMFPYPSG+LHMGH+RVY  +D ++   ++  H+V+ PMGWDAFGLPAENAA++R  +PE WT  NI  M+ Q+ + + L  +W RE++TC P+YYKWTQ+LF ++FE G  YQK  +VNWDP+D+TVLADE +D  G SWRSGA VE+  LKQWFI+TT  ++ LLD L  +   +W  V   Q  WIGD +G + +  L VD +D   +   LS ++  P        A+V I  +  +       KS     L   R     +   + L+GR +P++ +   +F     + + +G+P    ++A +A  LG+ +S V        + ++ S   E  G + +    N + +K     R M +GG+  S    DWLISRQRYWGTPIPIVHC SCGPV  P+++LPV LP     K      +  SPL  A +W+  +CP+C  P A RE+DTMDTFVDSSWY+ RY D +N       S     MPVD+YIGG EHA+ HLYYARF+SHF     D  +    EPF + L  GL+  QT+  + +G+++    + +    PV   +   L+  W+KMSKSK NG+ P+ V+ +YG+   RL +L    P+++  W  + D + G+  W+ R+W L+ ++  V      P   ++N     +++ I   ++  +T++   + + F  +  +S L  LT+   + S      S+ +   L    I   P+ P L+SELWA L+   +P+ S+ 
Sbjct:   38 YKAETRRRVEQWWHGRIQEQWRTDAEDQSSRKKFYVLSMFPYPSGRLHMGHVRVYAISDTISHFQKMRGHQVLNPMGWDAFGLPAENAAIERNLDPEDWTRSNIESMRTQL-DSLGLCFNWDREITTCLPDYYKWTQYLFIKMFEAGLAYQKEALVNWDPVDQTVLADEQVDENGCSWRSGAPVEQKMLKQWFIKTTNYAKPLLDALADLP--EWYGVKSMQANWIGDCSGCFFNHTLKVDGRDTGEV---LSAYSSSPETVFG--AAYVSILPSHRLLHGSSALKSALLRALRPGRDSLTEVTALNLLTGRELPVVISAKSQFSGH--LDTVIGIPDSSEEEAAVAQSLGLSWSSVLKTEADGTHTLINS--DEFTGQSREEAF-NSVTQKA----RQMNVGGHLTSAKLRDWLISRQRYWGTPIPIVHCGSCGPVAVPEDELPVTLP-----KIPALTGKGASPLKTAEDWLNCQCPRCKGP-AERETDTMDTFVDSSWYYFRYTDPQNPLRPFERSRADHWMPVDVYIGGKEHAVMHLYYARFLSHFCR---DQSMTAHREPFRKLLVQGLIKGQTFTLEHTGQYLKKEDIDFTGPDPVEKSSGRRLTVTWEKMSKSKHNGVDPQEVLQQYGISTLRLYLLYAAPPEQDILWDVKTDAIPGVLRWQSRLWGLVSKLRSVREGPETPNPSILNKRERSEAKKIWDNKNYTLTQVTGHFTEDFLFNAAISRLMGLTNTLSQASTRVVLHSVEFEDALASLCIMAAPMCPHLASELWAGLSQVRSPLGSVL 802          
BLAST of Leucine--tRNA ligase vs. Ensembl Zebrafish
Match: lars2 (leucyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-070928-3])

HSP 1 Score: 233.417 bits (594), Expect = 3.806e-70
Identity = 103/198 (52.02%), Postives = 143/198 (72.22%), Query Frame = 2
Query:  197 HYDFNVKKQLETFWQEKMS---KITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTT 781
             Y    ++++E +W  ++    +    D ++RKK Y+LSMFPYPSG+LHMGH+RVY  +D ++   ++  H+V+ PMGWDAFGLPAENAA++R  +PE WT  NI  M+ Q+ + + L  +W RE++TC P+YYKWTQ+LF ++FE G  YQK  +VNWDP+D+TVLADE +D  G SWRSGA VE+  LKQWFI+TT
Sbjct:   48 EYKAETRRRVEQWWHGRIQEQWRTDAEDQSSRKKFYVLSMFPYPSGRLHMGHVRVYAISDTISHFQKMRGHQVLNPMGWDAFGLPAENAAIERNLDPEDWTRSNIESMRTQL-DSLGLCFNWDREITTCLPDYYKWTQYLFIKMFEAGLAYQKEALVNWDPVDQTVLADEQVDENGCSWRSGAPVEQKMLKQWFIKTT 244          
BLAST of Leucine--tRNA ligase vs. Ensembl Zebrafish
Match: vars2 (valyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-060503-575])

HSP 1 Score: 59.3066 bits (142), Expect = 2.116e-8
Identity = 38/151 (25.17%), Postives = 69/151 (45.70%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEK------------------WTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDN 709
            P  +G LH+GH       D LAR  R+  ++V++  G D  G+ A  + ++R    E+                  W  +   E+  Q++ ++  S+DWSR   T DP +       F RL + G +Y+   ++NW    ++ ++D  +D+
Sbjct:  133 PNVTGTLHLGHALTVAIEDALARWRRMQGYKVLWVPGCDHAGI-ATQSVVERKLLREQGKSRQDFSREEFLKQVWMWKNEKGDEIYHQLR-KLGASLDWSRACFTMDPAFSSAVTEAFVRLCDSGLIYRAEGLINWSCTLESAISDIEVDS 281          
BLAST of Leucine--tRNA ligase vs. Ensembl Zebrafish
Match: vars2 (valyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-060503-575])

HSP 1 Score: 59.3066 bits (142), Expect = 2.116e-8
Identity = 38/151 (25.17%), Postives = 69/151 (45.70%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEK------------------WTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDN 709
            P  +G LH+GH       D LAR  R+  ++V++  G D  G+ A  + ++R    E+                  W  +   E+  Q++ ++  S+DWSR   T DP +       F RL + G +Y+   ++NW    ++ ++D  +D+
Sbjct:  133 PNVTGTLHLGHALTVAIEDALARWRRMQGYKVLWVPGCDHAGI-ATQSVVERKLLREQGKSRQDFSREEFLKQVWMWKNEKGDEIYHQLR-KLGASLDWSRACFTMDPAFSSAVTEAFVRLCDSGLIYRAEGLINWSCTLESAISDIEVDS 281          
BLAST of Leucine--tRNA ligase vs. Ensembl Zebrafish
Match: iars2 (isoleucyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-030616-608])

HSP 1 Score: 57.3806 bits (137), Expect = 8.872e-8
Identity = 62/227 (27.31%), Postives = 92/227 (40.53%), Query Frame = 2
Query:  188 IMPHYDFNVKKQLETFWQEKMSKITQNDSANR----------KKMYIL-SMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAAL-----------QRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLAD-ELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESL 799
            ++P  DF +K    +  ++++ KI Q    ++          KK Y L    PY +G  H+GH       D+  R   L   +V +  GWD  GLP E  AL           Q   +  ++  K IS  +   +    ++ DW     T D  Y      +F  +  KG +YQ  + V W P  +T LA+ EL  N     RS  I    PL     + TA +E L
Sbjct:   36 LLPRTDFPIKVNGPSLLEQEI-KIQQKCGFDQLYKWQREKKAKKEYCLHDGPPYANGDPHVGHALNKILKDIRNRFEVLRGRQVHYVPGWDCHGLPIELKALGDLGTNELTPVQIRQKAREFAEKAISRQRAAFQRWGVMA-DWDNCYYTFDGKYEAAQLKVFQEMHNKGLIYQDYKPVFWSPSSRTALAEAELEYNPEHVSRSLYIT--FPLLTLPAKLTAKAEGL 258          
BLAST of Leucine--tRNA ligase vs. Ensembl Xenopus
Match: bmp8 (bone morphogenetic protein 8 (osteogenic protein 2) [Source:Xenbase;Acc:XB-GENE-485424])

HSP 1 Score: 479.945 bits (1234), Expect = 3.008e-155
Identity = 273/750 (36.40%), Postives = 434/750 (57.87%), Query Frame = 2
Query:  197 HYDFNVKKQLETFWQ----EKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAAL-SDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIK----HPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLE--NGLNEK-----CLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKS-GKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVND--PKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNE 2386
             Y    +K++E +W+    E+ +KI++ D + + K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++ G  P+ WT +NI  M+EQ+ +++ L  +W RE++TC  +YYKWTQ+LF +++E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  LKQWF++TT  ++ + D L  +   +W  V   Q  WIG+  G +  FD +   D     E +S ++  P A   + +VA   + N  +       K    +  +  +    +    +  + + +P++ +   +F+    + +++G+P    +DA LA KLG+         Y ++++++   ++G  +  N     GL+ +       +     G+GG+  S    DWLISRQRYWGTPIP++HCPSCG V  P   LPV+LP      ++    + +SPL+ A  W+  +CP+C    A+RE+DTMDTFVDS+WY+LRY D  NS+     +     MPVD+YIGG EHA+ HLYYARF +HF    +   +    EPF + L  GL+  QTY+  S G+++   +V     +P Y++  E L   W+KMSKSK NG+  + +V++YG+D TRL +L    P+++  W  + D + G++ W+ R+W +  + + +  +   P   L+N   + ++  I + ++L    +   +K   IS++ S L   +S  +  S+E
Sbjct:   48 EYGLETRKKVENWWKPKVKERFTKISKVDKS-KPKFYVLSMFPYPSGKLHMGHVRVYTISDAIARFQKMRGMQVINPMGWDAFGLPAENAAIEHGLRPDTWTERNIQHMREQL-DRIGLCFNWDREITTCSGDYYKWTQYLFLKMYEAGLAYQKEAMVNWDPVDQTVLANEQVDENGCSWRSGAKVEQKYLKQWFLKTTVYAKDMSDALADLP--EWYGVKSMQANWIGECNGCF--FDCMLKIDGVETGETISAYSFKPEAVFGASYVAI--LPNHRLLHGASSLKEALQKAYTKGKDCVTRVSALNLFTKQEVPVVISAKTEFEGY--LDTKIGIPSATPEDAELADKLGL--------LYVKVIETS---NDGTEMICNSGKFTGLSRQEAFLAITQQASSEGVGGHLTSDKLRDWLISRQRYWGTPIPVIHCPSCGTVPVPYEDLPVLLP-----SAASFTGKGLSPLASASEWINCKCPRCTGA-ASRETDTMDTFVDSAWYYLRYTDPLNSERPFDKAWADFWMPVDLYIGGKEHAVMHLYYARFFNHFC---SSQGMTKHREPFHKLLVQGLIKGQTYKLASTGRYLKKSEVDDTGFEPAYLETGEKLLVTWEKMSKSKHNGVDAQEIVEQYGIDTTRLYLLFAAPPEQDILWDVKTDAIPGVRRWQTRLWTITSKFIEARKSSSVPNPHLLNKKEVAEARRIWESRNLAVLEVVISRKCLNISLIHSYLNLTSSRVILHSSE 767          
BLAST of Leucine--tRNA ligase vs. Ensembl Xenopus
Match: bmp8 (bone morphogenetic protein 8 (osteogenic protein 2) [Source:Xenbase;Acc:XB-GENE-485424])

HSP 1 Score: 475.707 bits (1223), Expect = 1.373e-153
Identity = 268/751 (35.69%), Postives = 434/751 (57.79%), Query Frame = 2
Query:  197 HYDFNVKKQLETFWQ----EKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAAL-SDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIK----HPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLE--NGLNEK-----CLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKS-GKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVND--PKVFLVNDFLLQDSEFI--AKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSN 2383
             Y    +K++E +W+    E+ +KI++ D + + K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++ G  P+ WT +NI  M+EQ+ +++ L  +W RE++TC  +YYKWTQ+LF +++E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  LKQWF++TT  ++ + D L  +   +W  V   Q  WIG+  G +  FD +   D     E +S ++  P A   + +VA   + N  +       K    +  +  +    +    +  + + +P++ +   +F+    + +++G+P    +DA LA KLG+         Y ++++++   ++G  +  N     GL+ +       +     G+GG+  S    DWLISRQRYWGTPIP++HCPSCG V  P   LPV+LP      ++    + +SPL+ A  W+  +CP+C    A+RE+DTMDTFVDS+WY+LRY D  NS+     +     MPVD+YIGG EHA+ HLYYARF +HF    +   +    EPF + L  GL+  QTY+  S G+++   +V     +P Y++  E L   W+KMSKSK NG+  + +V++YG+D TRL +L    P+++  W  + D + G++ W+ R+W +  + + +  +   P   L+N   + ++  I  ++  +++  +   + + +  +  +S L  L++   + S+
Sbjct:   49 EYGLETRKKVENWWKPKVKERFTKISKVDKS-KPKFYVLSMFPYPSGKLHMGHVRVYTISDAIARFQKMRGMQVINPMGWDAFGLPAENAAIEHGLRPDTWTERNIQHMREQL-DRIGLCFNWDREITTCSGDYYKWTQYLFLKMYEAGLAYQKEAMVNWDPVDQTVLANEQVDENGCSWRSGAKVEQKYLKQWFLKTTVYAKDMSDALADLP--EWYGVKSMQANWIGECNGCF--FDCMLKIDGVETGETISAYSFKPEAVFGASYVAI--LPNHRLLHGASSLKEALQKAYTKGKDCVTRVSALNLFTKQEVPVVISAKTEFEGY--LDTKIGIPSATPEDAELADKLGL--------LYVKVIETS---NDGTEMICNSGKFTGLSRQEAFLAITQQASSEGVGGHLTSDKLRDWLISRQRYWGTPIPVIHCPSCGTVPVPYEDLPVLLP-----SAASFTGKGLSPLASASEWINCKCPRCTGA-ASRETDTMDTFVDSAWYYLRYTDPLNSERPFDKAWADFWMPVDLYIGGKEHAVMHLYYARFFNHFC---SSQGMTKHREPFHKLLVQGLIKGQTYKLASTGRYLKKSEVDDTGFEPAYLETGEKLLVTWEKMSKSKHNGVDAQEIVEQYGIDTTRLYLLFAAPPEQDILWDVKTDAIPGVRRWQTRLWTITSKFIEARKSSSVPNPHLLNKKEVAEARRIWESRNLAVLEVVTSHFTEDYLFNAAISQLMSLSNTLSQASS 769          
BLAST of Leucine--tRNA ligase vs. Ensembl Xenopus
Match: bmp8 (bone morphogenetic protein 8 (osteogenic protein 2) [Source:Xenbase;Acc:XB-GENE-485424])

HSP 1 Score: 472.241 bits (1214), Expect = 3.779e-152
Identity = 270/743 (36.34%), Postives = 431/743 (58.01%), Query Frame = 2
Query:  197 HYDFNVKKQLETFWQ----EKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAAL-SDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIK----HPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLE--NGLNEK-----CLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKS-GKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVND--PKVFLVNDFLLQDSEFIAKYQSL-VTKILFQYQKSFTISVVVSVLQKLTS 2362
             Y    +K++E +W+    E+ +KIT ++S ++ K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++ G  P+ WT +NI  M+EQ+ +++ L  +W RE++TC  +YYKWTQ+LF +++E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  LKQWF++TT  ++ + D L  +   +W  V   Q  WIG+  G +  FD +   D     E +S ++  P A   + +VA   + N  +       K    +  +  +    +    +  + + +P++ +   +F+    + +++G+P    +DA LA KLG+         Y ++++++   ++G  +  N     GL+ +       +     G+GG+  S    DWLISRQRYWGTPIP++HCPSCG V  P   LPV+LP      ++    + +SPL+ A  W+  +CP+C    A+RE+DTMDTFVDS+WY+LRY D  NS+     +     MPVD+YIGG EHA+ HLYYARF +HF    +   +    EPF + L  GL+  QTY+  S G+++   +V   DD   +    E L   W+KMSKSK NG+  + +V++YG+D TRL +L    P+++  W  + D + G++ W+ R+W +  + + +  +   P   L+N   + ++  I + ++L V ++   + + +  +  +S L  L++
Sbjct:   64 EYGLETRKKVENWWKPKVKERFTKITLDESKSKPKFYVLSMFPYPSGKLHMGHVRVYTISDAIARFQKMRGMQVINPMGWDAFGLPAENAAIEHGLRPDTWTERNIQHMREQL-DRIGLCFNWDREITTCSGDYYKWTQYLFLKMYEAGLAYQKEAMVNWDPVDQTVLANEQVDENGCSWRSGAKVEQKYLKQWFLKTTVYAKDMSDALADLP--EWYGVKSMQANWIGECNGCF--FDCMLKIDGVETGETISAYSFKPEAVFGASYVAI--LPNHRLLHGASSLKEALQKAYTKGKDCVTRVSALNLFTKQEVPVVISAKTEFEGY--LDTKIGIPSATPEDAELADKLGL--------LYVKVIETS---NDGTEMICNSGKFTGLSRQEAFLAITQQASSEGVGGHLTSDKLRDWLISRQRYWGTPIPVIHCPSCGTVPVPYEDLPVLLP-----SAASFTGKGLSPLASASEWINCKCPRCTGA-ASRETDTMDTFVDSAWYYLRYTDPLNSERPFDKAWADFWMPVDLYIGGKEHAVMHLYYARFFNHFC---SSQGMTKHREPFHKLLVQGLIKGQTYKLASTGRYLKKSEV---DDTGKHYG--EKLLVTWEKMSKSKHNGVDAQEIVEQYGIDTTRLYLLFAAPPEQDILWDVKTDAIPGVRRWQTRLWTITSKFIEARKSSSVPNPHLLNKKEVAEARRIWESRNLAVLEVTSHFTEDYLFNAAISQLMSLSN 772          
BLAST of Leucine--tRNA ligase vs. Ensembl Xenopus
Match: bmp8 (bone morphogenetic protein 8 (osteogenic protein 2) [Source:Xenbase;Acc:XB-GENE-485424])

HSP 1 Score: 462.225 bits (1188), Expect = 2.793e-149
Identity = 274/740 (37.03%), Postives = 407/740 (55.00%), Query Frame = 2
Query:  200 YDFNVKKQLETFWQEKM-----SKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIM---GIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKS-GKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVND--PKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSN 2383
            Y    +K++E +W           I Q  S  + K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++ G  P+ WT +NI  M+EQ+ +++ L  +W RE++TC  +YYKWTQ+LF +++E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  LKQWF++TT  ++ + D L  +   +W  V   Q  WIG+  G +  FD +   D     E +S ++  P A      ++V I                   L  HR L     L   L      Q    + +DCV+    L         L +K  +P           +V SA  E EG+ LD  +     E  L   +     G+GG+  S    DWLISRQRYWGTPIP++HCPSCG V  P   LPV+LP      ++    + +SPL+ A  W+  +CP+C    A+RE+DTMDTFVDS+WY+LRY D  NS+     +     MPVD+YIGG EHA+ HLYYARF +HF    +   +    EPF + L  GL+  QTY+  S G+++   +V     +P Y++  E L   W+KMSKSK NG+  + +V++YG+D TRL +L    P+++  W  + D + G++ W+ R+W +  + + +  +   P   L+N   + ++  I + ++L   +   + + +  +  +S L  L++   + S+
Sbjct:   22 YGLETRKKVENWWNVAFLLNNWRTIGQYKS--KPKFYVLSMFPYPSGKLHMGHVRVYTISDAIARFQKMRGMQVINPMGWDAFGLPAENAAIEHGLRPDTWTERNIQHMREQL-DRIGLCFNWDREITTCSGDYYKWTQYLFLKMYEAGLAYQKEAMVNWDPVDQTVLANEQVDENGCSWRSGAKVEQKYLKQWFLKTTVYAKDMSDALADLP--EWYGVKSMQANWIGECNGCF--FDCMLKIDGVETGETISAYSFKPEAVFG--ASYVAI-------------------LPNHRLLHGASSLKEAL------QKAYTKGKDCVTRVSAL--------NLFTKQEVP-----------VVISAKTEFEGY-LDTKIGLSRQEAFLAITQQASSEGVGGHLTSDKLRDWLISRQRYWGTPIPVIHCPSCGTVPVPYEDLPVLLP-----SAASFTGKGLSPLASASEWINCKCPRCTGA-ASRETDTMDTFVDSAWYYLRYTDPLNSERPFDKAWADFWMPVDLYIGGKEHAVMHLYYARFFNHFC---SSQGMTKHREPFHKLLVQGLIKGQTYKLASTGRYLKKSEVDDTGFEPAYLETGEKLLVTWEKMSKSKHNGVDAQEIVEQYGIDTTRLYLLFAAPPEQDILWDVKTDAIPGVRRWQTRLWTITSKFIEARKSSSVPNPHLLNKKEVAEARRIWESRNLA--VTSHFTEDYLFNAAISQLMSLSNTLSQASS 696          
BLAST of Leucine--tRNA ligase vs. Ensembl Xenopus
Match: bmp8 (bone morphogenetic protein 8 (osteogenic protein 2) [Source:Xenbase;Acc:XB-GENE-485424])

HSP 1 Score: 411.764 bits (1057), Expect = 1.181e-129
Identity = 239/690 (34.64%), Postives = 389/690 (56.38%), Query Frame = 2
Query:  368 VLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAAL-SDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIK----HPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLE--NGLNEK-----CLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKS-GKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVND--PKVFLVNDFLLQDSEFI--AKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSN 2383
            V  R  ++   +VI PMGWDAFGLPAENAA++ G  P+ WT +NI  M+EQ+ +++ L  +W RE++TC  +YYKWTQ+LF +++E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  LKQWF++TT  ++ + D L  +   +W  V   Q  WIG+  G +  FD +   D     E +S ++  P A   + +VA   + N  +       K    +  +  +    +    +  + + +P++ +   +F+    + +++G+P    +DA LA KLG+         Y ++++++   ++G  +  N     GL+ +       +     G+GG+  S    DWLISRQRYWGTPIP++HCPSCG V  P   LPV+LP      ++    + +SPL+ A  W+  +CP+C    A+RE+DTMDTFVDS+WY+LRY D  NS+     +     MPVD+YIGG EHA+ HLYYARF +HF    +   +    EPF + L  GL+  QTY+  S G+++   +V     +P Y++  E L   W+KMSKSK NG+  + +V++YG+D TRL +L    P+++  W  + D + G++ W+ R+W +  + + +  +   P   L+N   + ++  I  ++  +++  +   + + +  +  +S L  L++   + S+
Sbjct:   66 VKERFTKISKVDVINPMGWDAFGLPAENAAIEHGLRPDTWTERNIQHMREQL-DRIGLCFNWDREITTCSGDYYKWTQYLFLKMYEAGLAYQKEAMVNWDPVDQTVLANEQVDENGCSWRSGAKVEQKYLKQWFLKTTVYAKDMSDALADLP--EWYGVKSMQANWIGECNGCF--FDCMLKIDGVETGETISAYSFKPEAVFGASYVAI--LPNHRLLHGASSLKEALQKAYTKGKDCVTRVSALNLFTKQEVPVVISAKTEFEGY--LDTKIGIPSATPEDAELADKLGL--------LYVKVIETS---NDGTEMICNSGKFTGLSRQEAFLAITQQASSEGVGGHLTSDKLRDWLISRQRYWGTPIPVIHCPSCGTVPVPYEDLPVLLP-----SAASFTGKGLSPLASASEWINCKCPRCTGA-ASRETDTMDTFVDSAWYYLRYTDPLNSERPFDKAWADFWMPVDLYIGGKEHAVMHLYYARFFNHFC---SSQGMTKHREPFHKLLVQGLIKGQTYKLASTGRYLKKSEVDDTGFEPAYLETGEKLLVTWEKMSKSKHNGVDAQEIVEQYGIDTTRLYLLFAAPPEQDILWDVKTDAIPGVRRWQTRLWTITSKFIEARKSSSVPNPHLLNKKEVAEARRIWESRNLAVLEVVTSHFTEDYLFNAAISQLMSLSNTLSQASS 726          
BLAST of Leucine--tRNA ligase vs. Ensembl Mouse
Match: Lars2 (leucyl-tRNA synthetase, mitochondrial [Source:MGI Symbol;Acc:MGI:2142973])

HSP 1 Score: 511.146 bits (1315), Expect = 2.260e-167
Identity = 286/752 (38.03%), Postives = 427/752 (56.78%), Query Frame = 2
Query:  200 YDFNVKKQLETFW----QEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL-VDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQS-----------QDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTL----RIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVND--PKVFLVNDFLLQDSEFIAKYQ-SLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSN 2383
            Y    +K +E +W    +E+ S++++ D   + K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++R   PE WT  NI  M++Q+ +++ L   W RE++TC P+YYKWTQ+LF +L+E G  YQK  +VNWDP+D+TVLA+E ++  G SWRSGA VEK  L+QWFI+TTA ++++ D L  +   +W  +   Q  WIGD  G ++DF L VD +D     EKL+ +T  P A          I++  I  ++      S  K +  ++L    P    L P++    L  Q            +  + S++G+P    +D  LA  LG+P        Y+ +++++   +E  +          +     L    R M +GG+  S    DWLISRQRYWGTPIPIVHCP+CGPV  P   LPV+LP       +       SPL+ A  W+   CP+C    A RE+DTMDTFVDS+WY+ RY D  N+      ++    MPVD+YIGG EHA+ HL+YARF+SHF H   D K+    EPF + L  GL+  QT++  SG+ +    + +    PV    +E L   W+KMSKSK NG+ P+ +V +YG+D  RL IL    P+K+  W  + D + G+  W++R+W+L    + +  +   P+  L+N      ++ + +Y+ +++ ++   + + F ++ VVS L  L+S   + S 
Sbjct:   50 YTLQTRKDVEKWWHQQIKEQASRVSEEDKL-KPKFYLLSMFPYPSGKLHMGHVRVYTLSDTIARFQKMRGMQVINPMGWDAFGLPAENAAIERNLHPESWTQSNIKHMRKQL-DRLGLCFSWDREITTCLPDYYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVNEYGCSWRSGAKVEKKYLRQWFIKTTAYAKAMQDALADLP--EWYGIKGMQAHWIGDCVGCHLDFTLKVDGEDTG---EKLTAYTATPEA-------IYGISHVAISPSHGLLHGCSSVKKALQKALV---PGRDCLTPVMAVSMLTLQEVPIVIMANPDLEGSLDSKIGIPSTSSEDTRLAQALGLP--------YSEVIEASPDGTERLSGSAEFTGMTRQDAFVALTRKARGMRVGGHVTSNKLKDWLISRQRYWGTPIPIVHCPACGPVPVPLQDLPVILP-----SIASLTGRGGSPLATALEWVNCSCPRCKG-SAKRETDTMDTFVDSAWYYFRYTDPHNTQSPFGSALADFWMPVDLYIGGKEHAVMHLFYARFLSHFCH---DQKMVKHREPFHKLLAQGLIKGQTFRLPSGQCLKKEDIDFTGPAPVCAKTKEKLEVTWEKMSKSKHNGVDPEEIVAQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWSLTTRFIEARTSGTVPQPQLLNSKEKTKAQNLWEYKNAVIAQVTTHFTEDFALNSVVSQLMGLSSALSQASQ 767          
BLAST of Leucine--tRNA ligase vs. Ensembl Mouse
Match: Lars2 (leucyl-tRNA synthetase, mitochondrial [Source:MGI Symbol;Acc:MGI:2142973])

HSP 1 Score: 272.322 bits (695), Expect = 2.111e-81
Identity = 148/364 (40.66%), Postives = 217/364 (59.62%), Query Frame = 2
Query:  200 YDFNVKKQLETFW----QEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL-VDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQS-----------QDCVSSRLGLPLVDFKDATLASKLGIPFSFV 1243
            Y    +K +E +W    +E+ S++++ D   + K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++R   PE WT  NI  M++Q+ +++ L   W RE++TC P+YYKWTQ+LF +L+E G  YQK  +VNWDP+D+TVLA+E ++  G SWRSGA VEK  L+QWFI+TTA ++++ D L  +   +W  +   Q  WIGD  G ++DF L VD +D     EKL+ +T  P        A   I++  I  ++      S  K +  ++L    P    L P++    L  Q            +  + S++G+P    +D  LA  LG+P+S V
Sbjct:   50 YTLQTRKDVEKWWHQQIKEQASRVSEEDKL-KPKFYLLSMFPYPSGKLHMGHVRVYTLSDTIARFQKMRGMQVINPMGWDAFGLPAENAAIERNLHPESWTQSNIKHMRKQL-DRLGLCFSWDREITTCLPDYYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVNEYGCSWRSGAKVEKKYLRQWFIKTTAYAKAMQDALADLP--EWYGIKGMQAHWIGDCVGCHLDFTLKVDGEDTG---EKLTAYTATP-------EAIYGISHVAISPSHGLLHGCSSVKKALQKALV---PGRDCLTPVMAVSMLTLQEVPIVIMANPDLEGSLDSKIGIPSTSSEDTRLAQALGLPYSEV 396          
BLAST of Leucine--tRNA ligase vs. Ensembl Mouse
Match: Lars2 (leucyl-tRNA synthetase, mitochondrial [Source:MGI Symbol;Acc:MGI:2142973])

HSP 1 Score: 105.531 bits (262), Expect = 2.406e-26
Identity = 46/83 (55.42%), Postives = 61/83 (73.49%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSR 559
            PYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++R   PE WT  NI  M++Q+ +++ L   W R
Sbjct:    2 PYPSGKLHMGHVRVYTLSDTIARFQKMRGMQVINPMGWDAFGLPAENAAIERNLHPESWTQSNIKHMRKQL-DRLGLCFSWDR 83          
BLAST of Leucine--tRNA ligase vs. Ensembl Mouse
Match: Iars2 (isoleucine-tRNA synthetase 2, mitochondrial [Source:MGI Symbol;Acc:MGI:1919586])

HSP 1 Score: 63.929 bits (154), Expect = 5.967e-10
Identity = 54/183 (29.51%), Postives = 80/183 (43.72%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQR-GYEPEKWTLKNISE-----MKEQMKEQMTLSI------DWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLAD-ELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTV 820
            PY +G  H+GH       D+  R + +   +V F  GWD  GLP E   L   G + +  +   I E      +  +++Q +  +      DW+    T DP Y      +F +++EKG VY+  + V W P  +T LA+ EL  N     RS  I  + PL    +R     ESL D    V
Sbjct:  116 PYANGDPHVGHALNKILKDIANRFHMMRGSKVHFVPGWDCHGLPIETKVLSELGVDAQSLSAMEIREKARSFAQAAIEKQKSAFVRWGVMADWNNCYYTFDPKYEAKQLRVFYQMYEKGLVYRSYKPVYWSPSSRTALAEAELEYNPEHVSRS--IYVRFPL----LRPPPKLESLTDASSPV 292          
BLAST of Leucine--tRNA ligase vs. Ensembl Mouse
Match: Iars2 (isoleucine-tRNA synthetase 2, mitochondrial [Source:MGI Symbol;Acc:MGI:1919586])

HSP 1 Score: 63.5438 bits (153), Expect = 9.021e-10
Identity = 54/183 (29.51%), Postives = 80/183 (43.72%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQR-GYEPEKWTLKNISE-----MKEQMKEQMTLSI------DWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLAD-ELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTV 820
            PY +G  H+GH       D+  R + +   +V F  GWD  GLP E   L   G + +  +   I E      +  +++Q +  +      DW+    T DP Y      +F +++EKG VY+  + V W P  +T LA+ EL  N     RS  I  + PL    +R     ESL D    V
Sbjct:  116 PYANGDPHVGHALNKILKDIANRFHMMRGSKVHFVPGWDCHGLPIETKVLSELGVDAQSLSAMEIREKARSFAQAAIEKQKSAFVRWGVMADWNNCYYTFDPKYEAKQLRVFYQMYEKGLVYRSYKPVYWSPSSRTALAEAELEYNPEHVSRS--IYVRFPL----LRPPPKLESLTDASSPV 292          
BLAST of Leucine--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q8VDC0|SYLM_MOUSE (Probable leucine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Lars2 PE=1 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 1.581e-166
Identity = 286/752 (38.03%), Postives = 427/752 (56.78%), Query Frame = 2
Query:  200 YDFNVKKQLETFW----QEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL-VDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQS-----------QDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTL----RIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVND--PKVFLVNDFLLQDSEFIAKYQ-SLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSN 2383
            Y    +K +E +W    +E+ S++++ D   + K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++R   PE WT  NI  M++Q+ +++ L   W RE++TC P+YYKWTQ+LF +L+E G  YQK  +VNWDP+D+TVLA+E ++  G SWRSGA VEK  L+QWFI+TTA ++++ D L  +   +W  +   Q  WIGD  G ++DF L VD +D     EKL+ +T  P A          I++  I  ++      S  K +  ++L    P    L P++    L  Q            +  + S++G+P    +D  LA  LG+P        Y+ +++++   +E  +          +     L    R M +GG+  S    DWLISRQRYWGTPIPIVHCP+CGPV  P   LPV+LP       +       SPL+ A  W+   CP+C    A RE+DTMDTFVDS+WY+ RY D  N+      ++    MPVD+YIGG EHA+ HL+YARF+SHF H   D K+    EPF + L  GL+  QT++  SG+ +    + +    PV    +E L   W+KMSKSK NG+ P+ +V +YG+D  RL IL    P+K+  W  + D + G+  W++R+W+L    + +  +   P+  L+N      ++ + +Y+ +++ ++   + + F ++ VVS L  L+S   + S 
Sbjct:   50 YTLQTRKDVEKWWHQQIKEQASRVSEEDKL-KPKFYLLSMFPYPSGKLHMGHVRVYTLSDTIARFQKMRGMQVINPMGWDAFGLPAENAAIERNLHPESWTQSNIKHMRKQL-DRLGLCFSWDREITTCLPDYYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVNEYGCSWRSGAKVEKKYLRQWFIKTTAYAKAMQDALADLP--EWYGIKGMQAHWIGDCVGCHLDFTLKVDGEDTG---EKLTAYTATPEA-------IYGISHVAISPSHGLLHGCSSVKKALQKALV---PGRDCLTPVMAVSMLTLQEVPIVIMANPDLEGSLDSKIGIPSTSSEDTRLAQALGLP--------YSEVIEASPDGTERLSGSAEFTGMTRQDAFVALTRKARGMRVGGHVTSNKLKDWLISRQRYWGTPIPIVHCPACGPVPVPLQDLPVILP-----SIASLTGRGGSPLATALEWVNCSCPRCKG-SAKRETDTMDTFVDSAWYYFRYTDPHNTQSPFGSALADFWMPVDLYIGGKEHAVMHLFYARFLSHFCH---DQKMVKHREPFHKLLAQGLIKGQTFRLPSGQCLKKEDIDFTGPAPVCAKTKEKLEVTWEKMSKSKHNGVDPEEIVAQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWSLTTRFIEARTSGTVPQPQLLNSKEKTKAQNLWEYKNAVIAQVTTHFTEDFALNSVVSQLMGLSSALSQASQ 767          
BLAST of Leucine--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q5RDP4|SYLM_PONAB (Probable leucine--tRNA ligase, mitochondrial OS=Pongo abelii OX=9601 GN=LARS2 PE=2 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 8.202e-162
Identity = 297/795 (37.36%), Postives = 441/795 (55.47%), Query Frame = 2
Query:  200 YDFNVKKQLETFW----QEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL-VDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIP------------IIRNQNL------KFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTL----RIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVN--DPKVFLVNDFLLQDSEFIAKYQ-SLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLA 2491
            Y    +K +E +W    +E+ SKI++ D  ++ K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++R   PE WT  NI  M++Q+ +++ L   W RE++TC P+YYKWTQ+LF +L+E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  L+QWFI+TTA ++++ D L  +   +W  +   Q  WIGD  G ++DF L V  Q      EKL+ +T  P A      + V I+  +               L  H SL  K  L   L+P            ++  Q +      K   +  + S++G+P    +D  LA  LG+        AY+ ++++    +E  +          +     L    R   +GG   S    DWLISRQRYWGTPIPIVHCP CGP   P   LPV LP       +    +  SPL+ A  W+   CP+C    A RE+DTMDTFVDS+WY+ RY D  N     + +V    MPVD+YIGG EHA+ HL+YARF SHF H   D K+    EPF + L  GL+  QT++  SG+++   +V      PV+   +E L   W+KMSKSK NG+ P+ VV++YG+D  RL IL    P+K+  W  + D + G+  W++R+W L    + +  +   P+  L+++    ++  + +Y+ S+++++   + + F+++  +S L  L+    + S      S  +   L   ++   P++P ++SE+WA LA
Sbjct:   51 YTLQTRKDVEKWWHQRIKEQASKISEADK-SKPKFYVLSMFPYPSGKLHMGHVRVYTISDTIARFQKMRGMQVINPMGWDAFGLPAENAAVERNLHPESWTQSNIKHMRKQL-DRLGLCFSWDREITTCLPDYYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVDEHGCSWRSGAKVEQKYLRQWFIKTTAYAKAMQDALADLP--EWYGIKGMQAHWIGDCVGCHLDFTLKVHGQATG---EKLTAYTATPEAIYG--TSHVAISPSH-------------RLLHGHSSL--KEALRMALVPGKDCLTPVMAVNMLTQQEVPVVILAKADLEGSLDSKIGIPSTSSEDTILAQTLGL--------AYSEVIETLPDGTERLSSSAEFTGMTRQDAFLALTQKARGKRVGGDVTSDKLKDWLISRQRYWGTPIPIVHCPVCGPTPVPLEDLPVTLP-----NIASFTGKGGSPLAMASEWVNCSCPRCKG-AAKRETDTMDTFVDSAWYYFRYTDPHNPHSPFNTAVADYWMPVDLYIGGKEHAVMHLFYARFFSHFCH---DQKMVKHREPFHKLLAQGLIKGQTFRLPSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWTLTTRFIEARASGKSPQPQLLSNKEKAEARKLWEYKNSVISQVTTHFTEDFSLNSAISQLMGLSGALSQASQSVILHSPEFEDALCALMVMAAPMAPHVTSEIWAGLA 804          
BLAST of Leucine--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q15031|SYLM_HUMAN (Probable leucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=LARS2 PE=1 SV=2)

HSP 1 Score: 497.278 bits (1279), Expect = 4.190e-161
Identity = 296/795 (37.23%), Postives = 441/795 (55.47%), Query Frame = 2
Query:  200 YDFNVKKQLETFW----QEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL-VDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIP------------IIRNQNL------KFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTL----RIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNSPVN--DPKVFLVNDFLLQDSEFIAKYQ-SLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLA 2491
            Y    +K +E +W    +E+ SKI++ D  ++ K Y+LSMFPYPSG+LHMGH+RVYT +D +AR  ++   +VI PMGWDAFGLPAENAA++R   P+ WT  NI  M++Q+ +++ L   W RE++TC P+YYKWTQ+LF +L+E G  YQK  +VNWDP+D+TVLA+E +D  G SWRSGA VE+  L+QWFI+TTA ++++ D L  +   +W  +   Q  WIGD  G ++DF L V  Q      EKL+ +T  P A      + V I+  +               L  H SL  K  L   L+P            ++  Q +      K   +  + S++G+P    +D  LA  LG+        AY+ ++++    +E  +          +     L    R   +GG   S    DWLISRQRYWGTPIPIVHCP CGP   P   LPV LP       +    +   PL+ A  W+   CP+C    A RE+DTMDTFVDS+WY+ RY D  N     + +V    MPVD+YIGG EHA+ HL+YARF SHF H   D K+    EPF + L  GL+  QT++  SG+++   +V      PV+   +E L   W+KMSKSK NG+ P+ VV++YG+D  RL IL    P+K+  W  + D + G+  W++R+W L    + +  +   P+  L+++    ++  + +Y+ S+++++   + + F+++  +S L  L++   + S      S  +   L   ++   PL+P ++SE+WA LA
Sbjct:   51 YTLQTRKDVEKWWHQRIKEQASKISEADK-SKPKFYVLSMFPYPSGKLHMGHVRVYTISDTIARFQKMRGMQVINPMGWDAFGLPAENAAVERNLHPQSWTQSNIKHMRKQL-DRLGLCFSWDREITTCLPDYYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVDEHGCSWRSGAKVEQKYLRQWFIKTTAYAKAMQDALADLP--EWYGIKGMQAHWIGDCVGCHLDFTLKVHGQATG---EKLTAYTATPEAIYG--TSHVAISPSH-------------RLLHGHSSL--KEALRMALVPGKDCLTPVMAVNMLTQQEVPVVILAKADLEGSLDSKIGIPSTSSEDTILAQTLGL--------AYSEVIETLPDGTERLSSSAEFTGMTRQDAFLALTQKARGKRVGGDVTSDKLKDWLISRQRYWGTPIPIVHCPVCGPTPVPLEDLPVTLP-----NIASFTGKGGPPLAMASEWVNCSCPRCKG-AAKRETDTMDTFVDSAWYYFRYTDPHNPHSPFNTAVADYWMPVDLYIGGKEHAVMHLFYARFFSHFCH---DQKMVKHREPFHKLLAQGLIKGQTFRLPSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWTLTTRFIEARASGKSPQPQLLSNKEKAEARKLWEYKNSVISQVTTHFTEDFSLNSAISQLMGLSNALSQASQSVILHSPEFEDALCALMVMAAPLAPHVTSEIWAGLA 804          
BLAST of Leucine--tRNA ligase vs. UniProt/SwissProt
Match: sp|B7KCI7|SYL_GLOC7 (Leucine--tRNA ligase OS=Gloeothece citriformis (strain PCC 7424) OX=65393 GN=leuS PE=3 SV=1)

HSP 1 Score: 483.026 bits (1242), Expect = 3.326e-156
Identity = 281/697 (40.32%), Postives = 399/697 (57.25%), Query Frame = 2
Query:  212 VKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQW-RRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFT----------------EHPVA----------ALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNR----IVKSAWKESEGWNLDHNLENGLNEKCLKTLRI-----MGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQT-KSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKE 2191
            ++K+ +  W E     T  D+  + K Y LSMFPYPSG LHMGH+R Y   DV+AR+ R+  H V+ PMGWDAFGLPAENAA++RG  P KWT +NI++M++Q+ +Q+ LSIDWSRE++TC P+YY+WTQWLF + F+ G  YQK   VNWDP+D+TVLA+E +D+ G+SWRSGA VE+  L+QWF++ T  +E LL+ LD + G  W  +V   Q  WIG   G Y++F +V         EK++VFT                EHP+           A+  F+  V   ++        +       L+  +++   +P +G+ +PI+    + ++      + +G+P  D +D   A +  +P   V +    +     +  A+ E  G  ++    +G++    KT  I      G G  R      DWLISRQRYWG PIP++HCPSCG V  PD  LPV LP     +  E      SPL+K  +W+   CP CG P A RE+DTMDTF+DSSWYFLRY D+ +     S   V++ M VD Y+GG+EHAI HL Y+RF +  +    D  L +  EPF + L  G+V   TY+  K+GK+IP+ QV   D  P   +  EPLS F++KMSKSK+NG+ PK V+ KYG D  R+ IL    P+K+ +W + D V G   +  +VW ++ E
Sbjct:   10 IEKKWQQTWVEMGLDQTPEDN-TKPKYYALSMFPYPSGNLHMGHVRNYVITDVIARLKRMQGHRVLHPMGWDAFGLPAENAAIERGIHPAKWTYQNIAQMRQQL-QQLGLSIDWSREVTTCSPDYYQWTQWLFLQFFQAGLAYQKEAAVNWDPVDQTVLANEQVDSEGKSWRSGAKVERKMLRQWFLKITDYAEQLLNDLDKLPG--WPEKVKLMQANWIGKSIGAYLEFPIVGMD------EKIAVFTTRPDTVYGVTYVVLAPEHPLTPKVTTAKNKKAVEKFIKEVTSESEQ---ERTAEDKPKKGILTGGKAI---NPFNGQEVPILIANYVLYEY--GTGAVMGVPAHDIRDFKFAQENKLPIRVVIVPEDQQDQDVTLTQAYTEP-GIMVNSGSFDGMDSITGKTAIIDYAEKQGFGKARVQYRLRDWLISRQRYWGCPIPVIHCPSCGTVPVPDEDLPVKLP-----EDVEFSGRGASPLAKLDSWINVPCPSCGEP-AKRETDTMDTFIDSSWYFLRYTDANDQQTAFSLDKVNDWMSVDQYVGGVEHAILHLLYSRFFTKVVR---DRGLVDVDEPFQRLLTQGMVQGMTYKNPKTGKYIPSSQVNPED--PKDPETGEPLSVFYEKMSKSKYNGVDPKQVLAKYGADTARMFILFKAPPEKDLEWDDAD-VEGQFRFLNKVWRIVGE 675          
BLAST of Leucine--tRNA ligase vs. UniProt/SwissProt
Match: sp|B7JYA9|SYL_RIPO1 (Leucine--tRNA ligase OS=Rippkaea orientalis (strain PCC 8801) OX=41431 GN=leuS PE=3 SV=1)

HSP 1 Score: 479.174 bits (1232), Expect = 8.688e-155
Identity = 294/753 (39.04%), Postives = 418/753 (55.51%), Query Frame = 2
Query:  224 LETFWQE---KMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQW-RRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFT----------------EHPV----------AALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKES---EGWNLDHNLENGLNEKCLKTLRI-----MGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQT-KSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPK-VFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTS 2362
            +E  WQ+   K       +++N+ K Y LSMFPYPSG LHMGH+R Y   DV+AR+ RL  + V+ PMGWDAFGLPAENAA+ RG  P +WT KN+S+MK+Q+ + + LSIDW RE++TC P YYKWTQWLF +L++ G  YQK   VNWDPID+TVLA+E +D+ G SWRSGA VE+  L+QWF++ T  +E LL  LD + G  W  RV   Q+ WIG   G Y++F +   +      EK++VFT                EHP+          AA+  F+   E++N++     +       ++       AI +P +G+ IPI+    + ++      + +G+P  D +D   A +  +P   V +   +        E+    G  ++  + +G+     KT  I      G G  R      DWLISRQRYWG PIP+VHCPSCG V  PD  LPV LP     ++ E      SPL+K  +W+   CP CG P A RE+DTMDTF+DSSWY+LRY D+ N+    +    ++ M +D Y+GG+EHAI HL Y+RF   F     D  L N  EPF + L  G+V   TY+  ++GK++P+  V + DD     +  E LS F++KMSKSK+NG+ PK V+ KYG D  R+ IL    P+K+ +W + D V G   +  RVW L   + N   N PK V   ++   +D +      + + +I    +  +  +  VS L KL++
Sbjct:   10 IEQKWQQDWVKQGLDKTPENSNKPKFYALSMFPYPSGNLHMGHVRNYVITDVIARLKRLQGYRVLHPMGWDAFGLPAENAAIDRGIPPAEWTYKNMSQMKQQL-QTLGLSIDWEREVATCAPEYYKWTQWLFLQLYQAGLAYQKEAAVNWDPIDQTVLANEQVDSEGYSWRSGAKVERKLLRQWFLKITDYAEQLLTDLDKLPG--WPDRVKLMQENWIGKSVGAYLEFPIKGSE------EKIAVFTTRPDTVYGVTYVVLAPEHPLTLKVTTPEQKAAVDAFIE--EVSNES---EIERTAEDKPKRGILTGGTAI-NPFNGQEIPILIADYVLYEY--GTGAVMGVPAHDTRDFKFAKEKQLPIKVVIIPENSDNTNPPLTEAYTDPGIMVNSGIFDGIQSTEGKTAIIEYAEKEGYGKARIQYRLRDWLISRQRYWGCPIPVVHCPSCGTVAVPDADLPVKLP-----ENVEFTGRDASPLAKLEDWINVPCPSCGEP-AKRETDTMDTFIDSSWYYLRYTDANNNQEAFNLEKANDWMAIDQYVGGIEHAILHLLYSRF---FTKALRDRGLVNIDEPFKRLLTQGMVQGLTYKNPQTGKYVPSENVIFQDDHYRDKETGEILSFFYEKMSKSKYNGVDPKQVLGKYGADTARMFILFKAPPEKDLEWDDAD-VEGQFRFLNRVWRL---VANYLENKPKTVKKASELTKEDKDLRRAIHTAIKEISEDLEGDYQFNTAVSELMKLSN 732          
BLAST of Leucine--tRNA ligase vs. TrEMBL
Match: A0A2T7NI18 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_18980 PE=3 SV=1)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 337/771 (43.71%), Postives = 449/771 (58.24%), Query Frame = 2
Query:  215 KKQLETFW----QEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLN-----EKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTK-SGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSL-VTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLAS 2494
            +K++E  W    +E+    +  +  +++K Y+LSMFPYPSG+LHMGH+RVYT +DV+AR  RL    VI PMGWDAFGLPAENAA++RG  P++WT KNI  MKEQ+ EQ+  S DW+RE +TCDP YY+WTQ +F ++FE G VYQK   VNWDP+D TVLADE ID  GRSWRSGAIVEK  LKQW+I+TTA ++SL DGL  V    W+ +I  Q+ WIG   G  + F L     EN + E L ++T  P A     VA++ ++ D+        +           S+A  HP +G  IPI+ +++ +F   + V   LG+P +      LA  L +         Y  I+       E     H+L NGL      E  L      G+GG   SK   DWLISRQRYWGTPIPI+HC +C  V  P +QLPV LPP      S       SPLS+  +W+   CP+CG  EA RE DTMDTFVDSSWYFLRYLD  N+        V ++MPVD+YIGG EHA  HLY+ARF  HF+H   D+ L    EPF   L  G+VL ++++ K +GK++   QV +   KPV  D + PL E W+KMSKSK NG+ P+ V+ ++G+D TRL IL+   P  +RKW  ND  +GI  W+ R+W L+   +NS  +       +  L +  E + + ++L V++   Q+ K F ++  +S +Q  TS   K     A  S  Y R L D  I L P+ P L  ELW  LAS
Sbjct:   63 RKEIEKHWIPLIKEEDRLQSLQEDCSKEKYYVLSMFPYPSGKLHMGHVRVYTISDVMARFQRLQGRYVIHPMGWDAFGLPAENAAIERGERPDEWTYKNIKNMKEQL-EQLGCSFDWNREFATCDPAYYRWTQHIFLKMFEAGLVYQKEGEVNWDPVDMTVLADEQIDEHGRSWRSGAIVEKQYLKQWYIKTTAKAQSLYDGLHEVNAELWKDIISLQQDWIGKCDGTQLKFALEG--QENMVFEPLHIYTPTPEAVYG--VAYIAVSPDH--------RLNQQHLYKKILSVAAVHPFTGERIPIVVSKSTQFDYHNNV--MLGIPSISEASRCLADSLNL--------KYLEILGKRADGDECIVNSHDL-NGLTRSEAFEAVLHIALEKGVGGEHVSKRGRDWLISRQRYWGTPIPIIHCNTCQAVPVPFDQLPVELPP-----ISGLTGHGPSPLSQQHDWVNVTCPRCGG-EAKREIDTMDTFVDSSWYFLRYLDPHNTSAPYKRDTVDKYMPVDLYIGGKEHATMHLYFARFFCHFLH---DVGLLGRREPFDSLLTQGMVLGKSFRVKETGKYLKADQVDFTGTKPVEKDTKNPLVEEWEKMSKSKHNGVDPEDVLKEFGVDATRLCILSAVSPQSDRKWS-NDAFVGILRWQVRIWKLVGSYINSFTSASHTKCSDAELQEWEENLFEARNLVVSRATIQFSKKFLLNTAISHMQDFTSTLGKVPGHVAMESQQYQRCLADLCIMLAPICPSLMCELWTALAS 799          
BLAST of Leucine--tRNA ligase vs. TrEMBL
Match: A0A4Z2D8S1 (Putative leucine--tRNA ligase OS=Schistosoma japonicum OX=6182 GN=EWB00_003633 PE=4 SV=1)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 314/747 (42.03%), Postives = 436/747 (58.37%), Query Frame = 2
Query:  404 VIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDL---VDFQDEN---------------------RILEKLSVFTEHPVAALSDFVAFVEINNDNIWW---------NYXXXXXXXXXXLSFHRSL--AIKHPLSGRLIPIIRNQ----------------NLKFQSQDCVSSRLGLPLVD---FKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTY-QTKSGKFIPNHQV--KYLDDKPVY---IDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVN--------DPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSN---EKAKSSIFYHRMLLDF 2431
             I PMGWD+FGLPAENAA+ R   P  WT KNI  MK+Q+ E M+LS+DWSRELSTCDPNYYKWTQWLF +L++    Y +   VNWDPIDKTVLADELIDN G SWRSGA VE+ PL+QWF RTT  SESLLDGL  ++  QWR V++ Q+GW+G L G  ++F++   V+  D N                     +  E+L+VFT++P  A++D V+ + +  D++++         N    +     ++ F + L  +++HP +GR IP+IR                  +L  ++ DC+S  L +PL     F      S L              ++ +   E  G  +  ++      K ++ LR+   GGY CS  RTDWL+SRQRYWGTPIPI+HC SCG V  P++QLPV+LPP         +  K +      +W K+ CPKCG P A+RE+DT+DTFVDSSWY+LRYLD +N+  +C     +  +PVD+YIGG EHA+RHLYYARF++HF+H   DI +    EPF +FLP+GLVL QTY   ++G+FI   +V  K+L  K V    ++   P+  +WDKMSKSKFNGI P  VVDK+G+D  RL +LAN GP + RKW E D++ GI NW  ++  LI++++    +        + K  + +  L+    F   +QS++ ++   Y  +F IS  ++ LQ++T L  K S        SS  Y R L D 
Sbjct:    6 TICPMGWDSFGLPAENAAIDRNEHPLNWTRKNIMSMKQQINETMSLSVDWSRELSTCDPNYYKWTQWLFLKLYQSDLAYHRPAYVNWDPIDKTVLADELIDNQGCSWRSGAKVERRPLRQWFFRTTVYSESLLDGLKDIENNQWRDVVQLQRGWLGHLNGTQMEFNIYSSVEQHDCNPRHHHTIFQSSFKCEHIKNVIQENERLAVFTKYPNLAVADLVSHIRVGPDSVYFADIYRKGKLNNMRPQVWISGEIHFSQILDISVRHPFTGRSIPMIRENIRLSKLSRAYPNELVFSLNGRTSDCISELLDIPLPPGKLFSAEKDLSNLSKSDVISEDDLKRCVIFTPISELHGKTVSESM-----NKAMQILRVNKRGGYWCSDERTDWLVSRQRYWGTPIPIIHCDSCGAVPVPEDQLPVLLPPLENPLKRGDEPLKHNE-----SWRKTTCPKCGKP-ASRETDTLDTFVDSSWYYLRYLDPQNNSSMCDWKKAANSLPVDVYIGGAEHAVRHLYYARFIAHFLH---DISILPSREPFRRFLPVGLVLGQTYVDPETGRFISTQRVNKKHLSGKDVQYYEVETNTPVQMYWDKMSKSKFNGIDPSEVVDKHGMDTVRLTMLANVGPHRTRKWTEGDVLYGINNWLNKISRLIEQLIEYSTSLQNSNIPWELKCNMDDPLLVHTPNFFKYHQSIIKRVNGYYDDTFVISSAIARLQEMTELLRKSSTLVGGPGPSSFMYLRALADL 738          
BLAST of Leucine--tRNA ligase vs. TrEMBL
Match: A0A158R813 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4697 PE=3 SV=1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 316/803 (39.35%), Postives = 457/803 (56.91%), Query Frame = 2
Query:  245 KMSKITQNDS-ANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQ--DENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAI-----------------------------KHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYN----------RIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCG-------------------------PVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTK-SGKFIPNHQVKYLDDKPVYID-NQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLV---NDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFS--NEKAKSSIFYHRMLLDF 2431
            K +++ + D     K  YILSMFPYPSG+LHMGH+RVYT  DVL R  +L+ ++VI PMGWDAFGLPAENAA+ RG  P++WT KNI  M++Q++  M LS DW+RE+STC+PNYY+WTQWLF +LFE G  Y++   VNWDPIDKTVLA+EL+D  GRSWRSGA+VEK               SL DGL  ++G QWR VI  Q+GWIG   G  ++FDL DF   +E+   E+L+VFT+HP  A +  ++F+ +   +I+WN +    ++  +++  R LA+                             KH L+   IP+I +  L+ + +   +  LG P V  +   L+  L +P    ++              RI +S   E  G NL       +++      R+     YRCS+ R DW +SRQRYW TPIP+++C +CG                          V  P+  LPV LPP            + +       W  + CP CG+  A RE DT+DTFVDSSWY+LR+LD  NS  +CS     +H+PVDIY+GG+EHAIRHL+YARF++HF+H   ++ L    EPF +FLP+GLV+ +T+++  +G++ P  +++        +    E + E W+KMSKSK NG+ P  V  ++G+++TRL +LA+ GP   R+W E +I+ G++NW+ R+W LI  ++    N   ++      D+LL D +F+  Y  +V ++   Y +SF +S V++ LQKLTS+ +K S   EK  SS  Y + L D 
Sbjct:    3 KCAQLLRTDGFVESKVFYILSMFPYPSGRLHMGHLRVYTVTDVLVRYYQLLGNQVIHPMGWDAFGLPAENAAIDRGVLPDEWTCKNIQNMRKQLRNDMKLSFDWTREISTCNPNYYRWTQWLFIKLFEAGLAYRRLAEVNWDPIDKTVLANELVDAEGRSWRSGALVEK--------------RSLKDGLGEIRGQQWRDVIRMQEGWIGPNDGFVVEFDL-DFHSTEEDLQGERLAVFTKHPGLAAAGAISFIAVGPQSIFWNERFRFPQNLREVNGSRKLAVVSLCPSLGKLSVQPAASCYPWPERLNISVKHLLTDTYIPLIYDPELRSRVEYETAVELGTPDVCDRHRELSRFLDLPSPECKIDVNCPAETDIELRIRIKQSPLLEFNGLNLKEATALAVSKLTGSEYRL-----YRCSRYRKDWSVSRQRYWATPIPLIYCRNCGVICLKFETLSKLQRFTAFKALGPFQTVPVPEEDLPVELPPLKAPLKRGDVPLRENT-----EWRYTTCPSCGS-SAEREVDTLDTFVDSSWYYLRFLDPTNSKEICSRDNAHKHIPVDIYVGGVEHAIRHLFYARFIAHFLH--RELGLLPCREPFQRFLPVGLVMGRTFRSSTTGQYFPAQEIEKDSSGNARVKATGEVVVESWEKMSKSKLNGVDPSEVFARHGVELTRLTMLASVGPHAARQWNEGEILRGVKNWQSRLWKLIGRLIELSNNSSTLWPSADQADYLLADEDFLQTYAHIVEQVHHHYGESFVLSAVIANLQKLTSILLKHSQVGEKCMSSRTYLKALADL 777          
BLAST of Leucine--tRNA ligase vs. TrEMBL
Match: A0A2J7RII5 (Putative leucine--tRNA ligase, mitochondrial OS=Cryptotermes secundus OX=105785 GN=B7P43_G05917 PE=3 SV=1)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 318/750 (42.40%), Postives = 441/750 (58.80%), Query Frame = 2
Query:  209 NVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAI--KHPLSGRLIPIIRNQNLKF-QSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSC-GPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTK-SGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSL-------VTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRML 2422
            ++K  +E  W+ K+     +D   + K Y+LSMFPYPSGQLHMGH+RVYT +D +A   R+   +VI PMGWDAFGLPAENAA++RG EP  WT +NI  MKEQ+ + +  S +W REL+TCDPNYY WTQ+LF +L+E+G VY+K  +VNWDP+D+TVLADE +D    SWRSGA VEK  L QWFIRTT  S+SLLDGLD      WR +I  Q+ WIG+  G   +F+L D   +  +   L++FT +P    +   +F+ +   +I    K D   + E     + L +  K+P +G  +PI     +++ +  DC    LG+P +   D   A+   IP S  +  +            E  ++     N + +K       +GIGGY CS    DWLISRQRYWGTPIPIV+C  C GP   P ++LPV LP     +     +   SPL +A +W+ ++CPKCG  +ATRE+DTMDTFVDSSWYFLRYLD  N D   S S  +E MPVD+YIGG EHA+ HLYYARFM+HF+H    I L    EPF + L  G+V+ Q+Y+ K +G+++P   V +   KPV       +   W+KMSKSK NG+ P+TV+  YG+D TRL+ILA+  P  NR W  +D   GI  W+ R+W  ++  +N+  N   +  V+D +L   EF      +       +  + F Y  +F +SV +S +Q LT+   +  +E     + + R L
Sbjct:   36 SIKHDIERKWRNKLQASVHDDDNQKSKFYVLSMFPYPSGQLHMGHVRVYTISDTMAHFYRMNGKKVIHPMGWDAFGLPAENAAIERGIEPFAWTKQNIKHMKEQL-QNLGCSFEWDRELATCDPNYYHWTQFLFLKLYEEGLVYKKEALVNWDPVDQTVLADEQVDTNCCSWRSGAKVEKKLLNQWFIRTTCFSKSLLDGLDDPVLKNWRDIINLQRHWIGECNGTKFEFELEDTLSQ-VMKHTLTIFTCNPEYVCN--ASFIAVAPGSILDRLKFDCDSTVESNDVFKRLPVMAKNPFTGERLPIYVTDQVEYEEGMDC---HLGIPGISEMDRLFATAANIPISSPKENS------QQLNSVEDVDVARGRINHMAQK-------LGIGGYPCSSKLRDWLISRQRYWGTPIPIVYCKQCNGPQSVPYSELPVTLP-----EIERLSNWGKSPLLEATDWLNTKCPKCGG-DATRETDTMDTFVDSSWYFLRYLDPHNEDMPFSKSKAAEFMPVDLYIGGKEHAVLHLYYARFMNHFLH---SIGLVPYKEPFQRLLVQGMVMGQSYRIKGTGQYLPKENVDFSGPKPVEKGTGLDVVSSWEKMSKSKHNGVHPETVLKDYGIDTTRLLILADVAPTSNRHWT-SDTFPGILKWQHRLWLTMRSFLNTRSNLQNI--VSDTVLHTPEFKEHEARMFDSRNYYLKGVTFNYTTAFQLSVAISKMQGLTNSLRRVPSEVIGRGLQFERAL 753          
BLAST of Leucine--tRNA ligase vs. TrEMBL
Match: A0A2J7RII9 (Uncharacterized protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G05917 PE=3 SV=1)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 318/750 (42.40%), Postives = 441/750 (58.80%), Query Frame = 2
Query:  209 NVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAI--KHPLSGRLIPIIRNQNLKF-QSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSC-GPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTK-SGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSL-------VTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRML 2422
            ++K  +E  W+ K+     +D   + K Y+LSMFPYPSGQLHMGH+RVYT +D +A   R+   +VI PMGWDAFGLPAENAA++RG EP  WT +NI  MKEQ+ + +  S +W REL+TCDPNYY WTQ+LF +L+E+G VY+K  +VNWDP+D+TVLADE +D    SWRSGA VEK  L QWFIRTT  S+SLLDGLD      WR +I  Q+ WIG+  G   +F+L D   +  +   L++FT +P    +   +F+ +   +I    K D   + E     + L +  K+P +G  +PI     +++ +  DC    LG+P +   D   A+   IP S  +  +            E  ++     N + +K       +GIGGY CS    DWLISRQRYWGTPIPIV+C  C GP   P ++LPV LP     +     +   SPL +A +W+ ++CPKCG  +ATRE+DTMDTFVDSSWYFLRYLD  N D   S S  +E MPVD+YIGG EHA+ HLYYARFM+HF+H    I L    EPF + L  G+V+ Q+Y+ K +G+++P   V +   KPV       +   W+KMSKSK NG+ P+TV+  YG+D TRL+ILA+  P  NR W  +D   GI  W+ R+W  ++  +N+  N   +  V+D +L   EF      +       +  + F Y  +F +SV +S +Q LT+   +  +E     + + R L
Sbjct:   36 SIKHDIERKWRNKLQASVHDDDNQKSKFYVLSMFPYPSGQLHMGHVRVYTISDTMAHFYRMNGKKVIHPMGWDAFGLPAENAAIERGIEPFAWTKQNIKHMKEQL-QNLGCSFEWDRELATCDPNYYHWTQFLFLKLYEEGLVYKKEALVNWDPVDQTVLADEQVDTNCCSWRSGAKVEKKLLNQWFIRTTCFSKSLLDGLDDPVLKNWRDIINLQRHWIGECNGTKFEFELEDTLSQ-VMKHTLTIFTCNPEYVCN--ASFIAVAPGSILDRLKFDCDSTVESNDVFKRLPVMAKNPFTGERLPIYVTDQVEYEEGMDC---HLGIPGISEMDRLFATAANIPISSPKENS------QQLNSVEDVDVARGRINHMAQK-------LGIGGYPCSSKLRDWLISRQRYWGTPIPIVYCKQCNGPQSVPYSELPVTLP-----EIERLSNWGKSPLLEATDWLNTKCPKCGG-DATRETDTMDTFVDSSWYFLRYLDPHNEDMPFSKSKAAEFMPVDLYIGGKEHAVLHLYYARFMNHFLH---SIGLVPYKEPFQRLLVQGMVMGQSYRIKGTGQYLPKENVDFSGPKPVEKGTGLDVVSSWEKMSKSKHNGVHPETVLKDYGIDTTRLLILADVAPTSNRHWT-SDTFPGILKWQHRLWLTMRSFLNTRSNLQNI--VSDTVLHTPEFKEHEARMFDSRNYYLKGVTFNYTTAFQLSVAISKMQGLTNSLRRVPSEVIGRGLQFERAL 753          
BLAST of Leucine--tRNA ligase vs. Ensembl Cavefish
Match: lars2 (leucyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-070928-3])

HSP 1 Score: 416.772 bits (1070), Expect = 8.760e-132
Identity = 274/773 (35.45%), Postives = 411/773 (53.17%), Query Frame = 2
Query:  392 MNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRS----------LAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFV---RLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQ-TKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEI--VNSPVNDPKVFLVNDFLLQDSEFIAKYQS-LVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVN 2656
            +  +V+ PMGWDAFGLPAENAA++RG +PE WT + I             +     E++TC P+YYKWTQ+LF +L+E G  YQK  +VNWDPID+TVLADE +D  G SWRSGA VE+  L+QWFI+TT  ++ LLD L  +   +W  V   Q  WIG+ +G +  FD V   +     E L+ +T  P A      AF+     +I  +++     S  + + HR+          +   +  +G+ +P++ +   +FQ    + + +G+P    +D  +A +LG+ +  V        + I+ SA  E  G   +    N + +K     R   +GG+  S    DWLISRQRYWGTPIPIVHC SCGPV  P  +LPV LP     K S    +  SPL  A  W+   CP+C  P A RE+DTMDTFVDS+WY+ RY D  N       S+    MPVD+YIGG EHA+ HLYYARF+SHF     D  + +  EPF + L  GL+  QT++ ++SG+++    + +   +PV  D+ + L   W+KMSKSK NG+ P+ VV +YG+D  RL IL    P+++  W  + D + G+  W+ R+W L+ ++         P   L+N     +++ I +Y++  + ++   + + F ++  +S L  LT+   + S      S+ + + L    +   P++P L+SELWA L+    P+ S      D  +    PW      P  D        T++I N++   V 
Sbjct:   75 IKEQVLNPMGWDAFGLPAENAAIERGLDPEDWTKRYICHCYPFSLLFNLFNNKLPFEITTCLPDYYKWTQYLFVKLYEAGLAYQKEAMVNWDPIDQTVLADEQVDENGCSWRSGAPVEQKLLRQWFIKTTNYAKPLLDALADLP--EWYGVKSMQANWIGECSGCF--FDHVLKLEGKETGEVLAAYTSTPEAVYG--AAFI-----SILPSHRLLHGSSPVRAALHRAFQPGKNSLTEVTALNVFTGQELPVVISAKNEFQGH--LDTVIGIPDSSEEDVCVARELGVSWDTVLKSEEDGTHTIINSA--EFTGQAPEEAF-NSITQKA----RQQKVGGHLTSSKLRDWLISRQRYWGTPIPIVHCESCGPVAVPVEELPVELP-----KVSLLSGKGASPLRSAHEWVNCSCPRCKGP-AQRETDTMDTFVDSAWYYFRYTDPHNKLRPFQRSLADHWMPVDVYIGGKEHAVMHLYYARFLSHFCK---DQGMVSHREPFKKLLVQGLIKGQTFRVSESGQYLKKEDIDFTGPEPVQKDSGKQLQVTWEKMSKSKHNGLDPQEVVQQYGIDTVRLYILYAAPPEQDILWDVKTDALPGVLRWQSRLWGLVTKLREARQAGETPNPSLLNKKERLEAKKIWEYKNHTIMQVTTNFTEDFLLNAAISRLMGLTNTLSQASPRVVLHSVEFEQALASLCLMAAPMAPHLTSELWAGLSQVKNPLSSSLTADGDVRQQ---PW------PTVDPEFLQTPDTVEINNKACGSVT 809          
BLAST of Leucine--tRNA ligase vs. Ensembl Cavefish
Match: vars2 (valyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:103044052])

HSP 1 Score: 64.3142 bits (155), Expect = 5.080e-10
Identity = 47/185 (25.41%), Postives = 82/185 (44.32%), Query Frame = 2
Query:  233 FWQEKMSKITQNDSANRKKMYILSMFPYP--SGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPE-----------------KWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRS 730
            F  EK S++ Q  + +R   Y     P P  +G LH+GH       D LAR  R+  ++V++  G D  G+  ++   +R    E                 +W  +   E+  Q+K ++  S+DW R   T DP +       F R+ + G +Y+   +VNW    ++ ++D  +D+   S R+
Sbjct:  123 FSPEKHSELPQ--AVDR---YFSLCIPPPNVTGTLHLGHALTVAIEDALARWRRMQGYKVLWVPGCDHAGIATQSVVERRLLREEGKRRQDFSRDEFLQEVWRWKKEKGEEIYHQLK-KLGASLDWRRACFTMDPGFSSAVTEAFVRMCDSGLIYRSESLVNWSCALESAISDIEVDSKQLSGRT 301          
BLAST of Leucine--tRNA ligase vs. Ensembl Cavefish
Match: vars2 (valyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:103044052])

HSP 1 Score: 64.3142 bits (155), Expect = 5.515e-10
Identity = 47/185 (25.41%), Postives = 82/185 (44.32%), Query Frame = 2
Query:  233 FWQEKMSKITQNDSANRKKMYILSMFPYP--SGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPE-----------------KWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRS 730
            F  EK S++ Q  + +R   Y     P P  +G LH+GH       D LAR  R+  ++V++  G D  G+  ++   +R    E                 +W  +   E+  Q+K ++  S+DW R   T DP +       F R+ + G +Y+   +VNW    ++ ++D  +D+   S R+
Sbjct:  123 FSPEKHSELPQ--AVDR---YFSLCIPPPNVTGTLHLGHALTVAIEDALARWRRMQGYKVLWVPGCDHAGIATQSVVERRLLREEGKRRQDFSRDEFLQEVWRWKKEKGEEIYHQLK-KLGASLDWRRACFTMDPGFSSAVTEAFVRMCDSGLIYRSESLVNWSCALESAISDIEVDSKQLSGRT 301          
BLAST of Leucine--tRNA ligase vs. Ensembl Cavefish
Match: vars1 (valyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-010601-1])

HSP 1 Score: 53.9138 bits (128), Expect = 8.690e-7
Identity = 38/149 (25.50%), Postives = 62/149 (41.61%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAA-----LQRGY------------EPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELID 706
            P  +G LH+GH       D L R +R+     ++  G D  G+  +         +RG             E  KW  +    +  Q+K ++  S+DW R   T DP      Q  F R+ E+G +Y+   +VNW     + ++D  +D
Sbjct:  289 PNVTGSLHLGHALTNAIQDCLTRWHRMRGETTLWNPGCDHAGIATQVVVEKKLMRERGMSRHDLGRENFIQEVWKWKNEKGDRIYHQLK-KLGSSLDWDRACFTMDPKLSYAVQEAFIRMHEEGVIYRSKRLVNWSCTLNSAISDIEVD 436          
BLAST of Leucine--tRNA ligase vs. Ensembl Cavefish
Match: iars2 (isoleucyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:103029967])

HSP 1 Score: 52.7582 bits (125), Expect = 1.977e-6
Identity = 39/154 (25.32%), Postives = 62/154 (40.26%), Query Frame = 2
Query:  263 QNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMT----------LSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLAD 694
            Q +   +K+  +    PY +G  H+GH       D+  R   L   +V +  GWD  GLP E  AL      +   L+   + +E  +E +           +  DW     T +  Y      +F  +  KG +YQ  + V W P  +T LA+
Sbjct:   99 QRERKAKKEFCLHDGPPYANGDAHVGHALNKILKDIHNRFEMLRGRKVHYVPGWDCHGLPIELKALGELQAKDMTPLQIRQKAREFAEEAIARQRAAFQRWGVMADWENCYYTFNGQYEAAQLRVFEDMHSKGLIYQDYKPVFWSPSTRTALAE 252          
BLAST of Leucine--tRNA ligase vs. Ensembl Sea Lamprey
Match: iars2 (isoleucyl-tRNA synthetase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-030616-608])

HSP 1 Score: 60.077 bits (144), Expect = 1.920e-9
Identity = 54/182 (29.67%), Postives = 81/182 (44.51%), Query Frame = 2
Query:  263 QNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTL------KNISEMKEQMKEQMTLSI-------DWSRELSTCDPNYYKWTQW-LFCRLFEKGFVYQKSEIVNWDPIDKTVLAD-ELIDNTGRSWRSGAIVEKVPLKQ 763
            Q +  ++K+  +    PY +G  H+GH+      D+  R   +  ++V F  GWD  GLP E  AL      +K TL      K   E  E+  E+   S        +W  +  +     Y+  Q  +F  + EKGF+YQ  + V W P  +T LA+ EL  N   +  S A+  K PL Q
Sbjct:   87 QKERKSKKEFCLHDGPPYANGDPHVGHVLNKVLKDITNRYYVMRGYKVHFVPGWDCHGLPIELKALTESEVNDK-TLSPLDIRKKAREFAEKAIEKQRASFIRWGIMANWKDDCYSTFSKEYEAEQLKVFYNMHEKGFIYQDYKPVFWSPSTRTALAEAELEYNPAHT--SKAVHVKFPLAQ 265          
BLAST of Leucine--tRNA ligase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000584.1 (pep scaffold:Pmarinus_7.0:GL486116:2002:8298:-1 gene:ENSPMAG00000000527.1 transcript:ENSPMAT00000000584.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.714e-7
Identity = 39/157 (24.84%), Postives = 63/157 (40.13%), Query Frame = 2
Query:  272 SANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENA--ALQRGYEPEKWTLKNISEMKEQMKE--------------QMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLAD 694
            S +R +       P+ +G  H GH+   T  DV+ R        V    GWD  GLP E     +     PE      I E   Q +               ++   ID+  +  T  P++ +   W+F +LF+KGFVY   +++ +     T L++
Sbjct:   35 SKSRPQYTFYDGPPFATGLPHYGHILAGTIKDVVTRFAHQSGFHVDRRFGWDCHGLPVEYEIDKMLNIKGPEDVAKMGIVEYNNQCRNIVMRYAKEWETTVIRLGRWIDFKNDYKTLYPSFMETVWWVFRQLFDKGFVYSGVKVMPYSTACTTPLSN 191          
BLAST of Leucine--tRNA ligase vs. Ensembl Yeast
Match: NAM2 (Mitochondrial leucyl-tRNA synthetase; also has direct role in splicing of several mitochondrial group I introns; indirectly required for mitochondrial genome maintenance; human homolog LARS2 can complement yeast null mutant, and is implicated in Perrault syndrome [Source:SGD;Acc:S000004374])

HSP 1 Score: 429.483 bits (1103), Expect = 4.338e-137
Identity = 281/768 (36.59%), Postives = 405/768 (52.73%), Query Frame = 2
Query:  236 WQEKMSK-ITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQW-RRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDN-IWWNYXXXXXXXXXXLSFHRSLA-----------IK--HPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKD-------------ATLASKLGIPFSFVRLGAYNRIVKSA-WKESEGWNLDHNLENGLNEKCLKTLRIMGI---GGYRCSKLR---TDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGP-EPFSQFLPIGLVLAQTY-QTKSGKFIPNHQVKYLDDKP------VYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVN--------------SPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSL 2365
            W++K ++ + + D+ N    YIL  FPYPSG LH+GH+RVY  +D L R  +   + VI PMGWDAFGLPAENAA++R   P  WT  NI++MK+QM + M  + DW RE++TCDP YYK+TQW+F +LFE G  Y+K   +NWDP+D TVLA+E +D  GRSWRSGAIVEK  LKQWF+  T  +  L   L+ +K   W   V + QK WIG+  G  + F + D + EN I     VFT  P    +  V +V +  D+ I   Y E+     E +     L            IK  +PL+   +PI     +        S+ +G P  D +D              T  +      S V      RI+ +  +  ++G       E+      +    IMG+    G   S +R    DWLISRQRYWGTPIPI+HC +CGPV  P++ LPV LP      +  +    I        ++   CP CG+P A RE+DTMDTF+DSSWY+ R+LD KN+       + S++MPVDIYIGG+EHAI HL Y+RF++ F+        P G  EPF + +  G+V  +TY    SGKF+   ++ +++D P      +  + + P+  + +KMSKSK+NG  P   + ++G D TR  IL  +       W E+ IV GI+ W ++V +L K I++              + +ND +V   NDF           Q  +  I   ++ + +++ V+S   KLT++
Sbjct:   30 WKQKTTRGLPKQDTLNSGSKYILCQFPYPSGALHIGHLRVYVISDSLNRFYKQKGYNVIHPMGWDAFGLPAENAAIERSINPAIWTRDNIAKMKQQM-QSMLANFDWDREITTCDPEYYKFTQWIFLKLFENGLAYRKEAEINWDPVDMTVLANEQVDAQGRSWRSGAIVEKKQLKQWFLGITKFAPKLKKHLNQLK--DWPSNVKQMQKNWIGESVGAELVFKVADPKFENLI-----VFTTRPETLFA--VQYVALALDHPIVQKYCEEMPDLKEFIQKSDQLPNDTKEGFQLPNIKAVNPLTKEEVPIFAAPYVVSSYGSAPSAVMGCPGHDNRDFEFWQTNCPGEHIKTCIAPFFDDASKVTEQERQRIIDTVPFTSTDGVLTKECGEHSGVLTVVARKSIMGMLNSEGLSKSVVRYKIRDWLISRQRYWGTPIPIIHCDNCGPVPVPESDLPVKLPELEGLDTKGNPLSTID------EFVNVACPSCGSP-AKRETDTMDTFIDSSWYYFRFLDPKNTSKPFDREIASKNMPVDIYIGGVEHAILHLLYSRFIAKFLGSINAWSDPAGIFEPFKKLVTQGMVQGKTYVDPDSGKFLKPDELTFVNDSPDGNTVIIKSNGKVPVVSY-EKMSKSKYNGADPNECILRHGPDATRAHILFQSPIADALNWDESKIV-GIERWLQKVLHLTKNILSLEKDLAISKDYKTPTDLNDAEVKFHNDF-----------QRFLKSITESFEVNLSLNTVISDYMKLTNI 767          
BLAST of Leucine--tRNA ligase vs. Ensembl Yeast
Match: VAS1 (Mitochondrial and cytoplasmic valyl-tRNA synthetase; human homolog VARS2 implicated in mitochondrial diseases, can partially complement yeast null mutant [Source:SGD;Acc:S000003326])

HSP 1 Score: 64.3142 bits (155), Expect = 6.012e-11
Identity = 43/150 (28.67%), Postives = 70/150 (46.67%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLP----------AENAALQRGYEPE-------KWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDN 709
            P  +G LH+GH       D L R NR+    V+F  G+D  G+           A++   +  Y  E       +W  +  S +K Q+ +++  S DWSRE  T  P   K  +  F RL ++G +Y+ S +VNW     T +++  ++N
Sbjct:  190 PNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEKQIWAKDRKTRHDYGREAFVGKVWEWKEEYHSRIKNQI-QKLGASYDWSREAFTLSPELTKSVEEAFVRLHDEGVIYRASRLVNWSVKLNTAISNLEVEN 338          
BLAST of Leucine--tRNA ligase vs. Ensembl Yeast
Match: ISM1 (Mitochondrial isoleucyl-tRNA synthetase; null mutant is deficient in respiratory growth; human homolog IARS2 implicated in mitochondrial diseases, can partially complement yeast null mutant [Source:SGD;Acc:S000005961])

HSP 1 Score: 60.8474 bits (146), Expect = 8.655e-10
Identity = 51/200 (25.50%), Postives = 90/200 (45.00%), Query Frame = 2
Query:  215 KKQLETFWQEKMSKITQNDSA---NRKKMYIL-SMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQ-------RGYEPEKWTLKNISEMKEQMKEQ------MTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQ 763
            K+QL  F++E  SK+   D      ++K++IL    PY +G+LH+GH       D++ R        + +  GWD  GLP E  AL+           P K     +   ++ +K Q        +  DW     T D +Y      +F  ++E+G + ++++ V W    +T LA+  ++    + +S A   K PL++
Sbjct:   59 KEQLRDFFEE-FSKLNTTDEKLEFIKEKLFILHDGPPYANGELHLGHALNKILKDIINRYQLSQGKYIFYKPGWDCHGLPIEIKALKDLSAQQIESISPLKIRSMALKHAQKAIKRQRETFQHFAILTDWETPYLTMDKDYEINQLNIFKEMYERGLIKRQNKPVYWGTETRTALAEGELE-YNENHKSIAAYVKFPLEK 256          
BLAST of Leucine--tRNA ligase vs. Ensembl Yeast
Match: ILS1 (Cytoplasmic isoleucine-tRNA synthetase; target of the G1-specific inhibitor reveromycin A [Source:SGD;Acc:S000000172])

HSP 1 Score: 50.0618 bits (118), Expect = 1.718e-6
Identity = 35/136 (25.74%), Postives = 60/136 (44.12%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENA-----ALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELS-------------TCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNW 664
            P+ +G  H GH+   T  D++ R   +  H V    GWD  G+P E+       +    +  K+ L+N +   E     MT + DW + +              T  P++ + T W F +L EKG VY+  +++ +
Sbjct:   47 PFATGTPHYGHILASTIKDIVPRYATMTGHHVERRFGWDTHGVPIEHIIDKKLGITGKDDVFKYGLENYN--NECRSIVMTYASDWRKTIGRLGRWIDFDNDYKTMYPSFMESTWWAFKQLHEKGQVYRGFKVMPY 180          
BLAST of Leucine--tRNA ligase vs. Ensembl Nematostella
Match: EDO29248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T464])

HSP 1 Score: 181.03 bits (458), Expect = 6.950e-50
Identity = 125/382 (32.72%), Postives = 187/382 (48.95%), Query Frame = 2
Query: 1334 EKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPS---------VVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNH----QVKYLDDK--PVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSL-------VTKILFQYQKSFTISVVVSVLQKLTSL--YMKFSNEKAKSSIF 2407
            +K  + L   G+G  + +    DW +SRQRYWGTPIPI+HC  CG    P   LPV+LP           S      S+AF+     CP CG   A RE+DTMDTFVDSSWYF+RY D++NS+ + +             +    +D YIGG+EHAI HL YARF +  +    D+ L    EPF++ L  G+VL   Y  ++ K    +     V+++ D   PV  D      E    MSKSK NGI P+ +++KYG D  RL  +    P+   +W +   V G   + RRV+N   ++    +      +     L D EF    +SL       + ++ + YQ+    +VV   ++ + +L  +  F +  A+ ++ 
Sbjct:   11 DKVAELLAAKGLGEKKTTWRLRDWGVSRQRYWGTPIPIIHCEDCGAQPVPAKDLPVVLP----QDLVPDGSGNPLIKSEAFH-AGVVCPCCGK-SARRETDTMDTFVDSSWYFMRYCDARNSEQMVAEGAEYWMRDQNAATGGSGMDQYIGGIEHAILHLLYARFWTKVMR---DLGLVKVDEPFTKLLTQGMVLNHIYSRRTAKGAKEYFWPKDVEHVADGLLPVGTDID---YEGVGTMSKSKNNGIDPQELIEKYGADTARLYTMFTAPPELTLEWNDA-AVEGSYRFLRRVYNFGAKLSQMDMAGAVQSVAGAKSLDDVEFGKAAKSLRLEIHTVLKQVEYDYQRMQYNTVVSGAMKMINALEDFKSFDDAGAQVALI 379          
BLAST of Leucine--tRNA ligase vs. Ensembl Nematostella
Match: EDO26794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB22])

HSP 1 Score: 63.5438 bits (153), Expect = 2.924e-10
Identity = 42/147 (28.57%), Postives = 69/147 (46.94%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAE----NAALQRGYEPE------------KWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELI 703
            P  +G LHMGH    T  D+L R  ++  +   +  G D   +  E    N   +RG +              +W  K    + +Q+K ++  ++DW+R   T D  YY     +F  L+ KG +Y+  +++NWDP  KT L+DE +
Sbjct:   43 PNVTGVLHMGHALNDTVQDILVRRAKMQGYNTCWVPGTDHASIATEAKVVNMLKERGIDKNALSREEFLEYAWEWKEKYGGIILQQLK-KLGCALDWNRTHFTMDDEYYAAVIRVFVDLYNKGQIYRGVKMINWDPKAKTALSDEEV 188          
BLAST of Leucine--tRNA ligase vs. Ensembl Nematostella
Match: EDO25681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVS8])

HSP 1 Score: 55.8398 bits (133), Expect = 2.745e-8
Identity = 40/147 (27.21%), Postives = 67/147 (45.58%), Query Frame = 2
Query:  278 NRKKMYILSMFPYPSGQLHMGHMR-VYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKG-FVYQKSEIVNWDPIDKTVLADELIDNT 712
            N K+  I +  PY +G +H+GH+  VY  +D+ AR  RL   +V F  G D  G+     A + G  P++   K    +++     +   I +     T    ++   Q  F +L+E G F+ Q +E + +D      LAD  +  T
Sbjct:    4 NPKRYTITAALPYTNGPIHIGHLAGVYVPSDIYARYLRLQGKDVAFMCGSDEHGVAISMKAKKEGITPQEVIDKYDGIIRQSF---LDFGISFDNYSRTSSKIHHDTAQEFFRKLYENGKFIEQTTEQL-YDAKADQFLADRFVTGT 146          
BLAST of Leucine--tRNA ligase vs. Ensembl Medaka
Match: lars2 (leucyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:101175189])

HSP 1 Score: 491.115 bits (1263), Expect = 2.729e-159
Identity = 296/820 (36.10%), Postives = 448/820 (54.63%), Query Frame = 2
Query:  122 LNSSRYVALKHVK-FFSCSMCFDIMPHYDFNVKKQLETFWQEKMSKITQNDS----ANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEI--------NNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQ-TKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQ-ENDIVLGIQNWERRVWNLIKEIVNS----PVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLASKLAPIESIFI 2524
            L   R +   H +  FS +  +D    Y    + ++E +W  ++    Q D+    + +KK Y+LSMFPYPSG+LHMGH+RVYT +D +    R+  HEV+ PMGWDAFGLPAENAA++R  +PE WT  NI  M+ Q+ + + L  +W RE++TC P+YYKWTQ+LF +LFE G  YQK  +VNWDP+D+TVLADE +D +GRSWRSGA+VE+  L QWFI+TT  ++ LLD L+ +   +W  V   Q  WIG+ TG Y D+ L     E    E LS ++  P        A+V I         + ++ +   +      + L+   +L +    +GR +P++ ++   F     + + +G+P    +D ++A  L + ++ V L  +    ++     +   L    E   +    K  R   +GG+  S    DWLISRQRYWGTPIP+VHC SCG V  P+ +LPV LP     K      +  SPL  A +W+  +CPKC  P A RE+DTMDTFVDS+WY+ RY D  N D      +    +PVD+YIGG EHA+ HLYYARF+SHF     D  L    EPF + L  GL+  QT++    G+++   ++ +   +PV +    P+   W+KMSKSK NG+ P+ VV +YG+D  RL IL    P+++  W  + D + G+  W+ R+W L+ ++  +     V +P +    + L +  +        + ++   + + F  +  +S L  LT+          + S+ +   L   ++   P++P L+SELWA L     P+ S+ +
Sbjct:   60 LGPVRRLRTPHTRTLFSETGVWDT--DYRSETRCRVERWWHPRVMAQWQKDALEENSQKKKFYVLSMFPYPSGRLHMGHVRVYTISDAIGHFQRMRGHEVLNPMGWDAFGLPAENAAIERNLDPEDWTKSNIQSMRGQL-DDLGLCFNWDREVTTCLPDYYKWTQYLFIKLFESGLAYQKEAVVNWDPVDRTVLADEQVDESGRSWRSGALVEQKLLTQWFIKTTNYAKPLLDALEELP--EWYGVKAMQANWIGECTGCYFDYRLKVNGKETG--ETLSAYSSSPEVVFG--AAYVAILPSHRLLHGSSSVRFALLKSFQSGTDCLTEVTALNL---FTGREVPLLISRKNMFDGY--LDTVIGVPECSEEDLSVAKALNLSWTTV-LETHENGAQTLINSDKFSGLTR--EQAFDSITQKA-REQKVGGHLTSSKLRDWLISRQRYWGTPIPVVHCESCGAVTVPEEELPVALP-----KVPSLTGKGASPLEAAHDWVNCKCPKCKGP-ARRETDTMDTFVDSAWYYFRYTDPHNPDRPFRRHLADHWLPVDVYIGGKEHAVMHLYYARFLSHFCR---DQGLVAHREPFRKLLVQGLIKGQTFKLADGGQYLRKEEIDFTGKEPVALSGG-PVEVTWEKMSKSKHNGLDPQEVVQQYGVDTVRLYILYAAPPEQDILWNVKTDALPGVLRWQSRLWQLVTKLRGARELGDVPNPSLLKTKE-LAEAKKIWENKNYAIQEVTAHFTEDFLFNAAISRLMGLTNTLTSAQVGVLQHSVEFEEALAALVLMTAPMAPHLASELWAGLCQIKNPLSSVLL 850          
BLAST of Leucine--tRNA ligase vs. Ensembl Medaka
Match: vars2 (valyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:101172991])

HSP 1 Score: 58.5362 bits (140), Expect = 3.044e-8
Identity = 40/150 (26.67%), Postives = 66/150 (44.00%), Query Frame = 2
Query:  311 PYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGY------------------EPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELID 706
            P  +G LH+GH       D L R  R+    V++  G D  G+ A  A ++R                    E  KW  +   E+ +Q++ ++  S+DWSR   T DP +       F RL + G +Y+   +VNW    ++ ++D  +D
Sbjct:  148 PNVTGSLHLGHALTVAVEDALVRWRRMQGCRVLWVPGCDHAGI-ATQAVVERRLVGTKGKRRQDFTRDEFLQEVWKWKNEKGDEIYQQLR-RLGASLDWSRARFTMDPGFCSTVTEAFVRLCDSGLIYRSEGLVNWSCALQSAISDIEVD 295          
BLAST of Leucine--tRNA ligase vs. Ensembl Medaka
Match: iars2 (isoleucyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:101171455])

HSP 1 Score: 57.7658 bits (138), Expect = 5.265e-8
Identity = 43/155 (27.74%), Postives = 65/155 (41.94%), Query Frame = 2
Query:  263 QNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAAL----QRGYEP-------EKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLAD 694
            Q +   +KK  +    PY +G  H+GH       D+  R   L   +V +  GWD  GLP E  AL      G  P        ++    I++ K   +    ++ DW +   T D  Y      +F  ++ KG VYQ  + V W P  +T LA+
Sbjct:   94 QRERKAKKKFSLHDGPPYANGAPHVGHALNKILKDIRNRFEVLRGRQVHYVPGWDCHGLPIELKALGGLCASGLTPLQIRQRAREFAEGAIAQQKAAFQRWGVMA-DWEQCYYTFDGPYEAAQLKVFQEMYSKGLVYQDYKPVFWSPSSRTALAE 247          
BLAST of Leucine--tRNA ligase vs. Ensembl Medaka
Match: iars2 (isoleucyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:101171455])

HSP 1 Score: 57.7658 bits (138), Expect = 5.442e-8
Identity = 43/155 (27.74%), Postives = 65/155 (41.94%), Query Frame = 2
Query:  263 QNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAAL----QRGYEP-------EKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLAD 694
            Q +   +KK  +    PY +G  H+GH       D+  R   L   +V +  GWD  GLP E  AL      G  P        ++    I++ K   +    ++ DW +   T D  Y      +F  ++ KG VYQ  + V W P  +T LA+
Sbjct:   94 QRERKAKKKFSLHDGPPYANGAPHVGHALNKILKDIRNRFEVLRGRQVHYVPGWDCHGLPIELKALGGLCASGLTPLQIRQRAREFAEGAIAQQKAAFQRWGVMA-DWEQCYYTFDGPYEAAQLKVFQEMYSKGLVYQDYKPVFWSPSSRTALAE 247          
BLAST of Leucine--tRNA ligase vs. Ensembl Medaka
Match: iars2 (isoleucyl-tRNA synthetase 2, mitochondrial [Source:NCBI gene;Acc:101171455])

HSP 1 Score: 57.7658 bits (138), Expect = 5.856e-8
Identity = 43/155 (27.74%), Postives = 65/155 (41.94%), Query Frame = 2
Query:  263 QNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAAL----QRGYEP-------EKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLAD 694
            Q +   +KK  +    PY +G  H+GH       D+  R   L   +V +  GWD  GLP E  AL      G  P        ++    I++ K   +    ++ DW +   T D  Y      +F  ++ KG VYQ  + V W P  +T LA+
Sbjct:   94 QRERKAKKKFSLHDGPPYANGAPHVGHALNKILKDIRNRFEVLRGRQVHYVPGWDCHGLPIELKALGGLCASGLTPLQIRQRAREFAEGAIAQQKAAFQRWGVMA-DWEQCYYTFDGPYEAAQLKVFQEMYSKGLVYQDYKPVFWSPSSRTALAE 247          
BLAST of Leucine--tRNA ligase vs. Planmine SMEST
Match: SMESG000071689.1 (SMESG000071689.1)

HSP 1 Score: 1665.59 bits (4312), Expect = 0.000e+0
Identity = 849/850 (99.88%), Postives = 849/850 (99.88%), Query Frame = 2
Query:  110 MIKLLNSSRYVALKHVKFFSCSMCFDIMPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE 2659
            MIKLLNSSRYVALKHVKFFSCSMCFDIMPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSG IVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYKEDKSKSDEKLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYSECKSSESDSEKISPLSKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFLIYLYPLSPLLSSELWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE
Sbjct:    1 MIKLLNSSRYVALKHVKFFSCSMCFDIMPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGVIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYKEDKSKSDEKLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYSECKSSESDSEKISPLSKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFLIYLYPLSPLLSSELWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE 850          
BLAST of Leucine--tRNA ligase vs. Planmine SMEST
Match: SMESG000071689.1 (SMESG000071689.1)

HSP 1 Score: 1660.97 bits (4300), Expect = 0.000e+0
Identity = 847/851 (99.53%), Postives = 847/851 (99.53%), Query Frame = 2
Query:  110 MIKLLNSSRYVALKHVKFFSCSMCFDIMPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXX-XXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE 2659
            MIKLLNSSRYVALKHVKFFSCSMCFDIMPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSG IVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYKEDKSK   EKLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYSECKSSESDSEKISPLSKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFLIYLYPLSPLLSSELWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE
Sbjct:    1 MIKLLNSSRYVALKHVKFFSCSMCFDIMPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGVIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYKEDKSKQSDEKLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYSECKSSESDSEKISPLSKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFLIYLYPLSPLLSSELWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE 851          
BLAST of Leucine--tRNA ligase vs. Planmine SMEST
Match: SMESG000071689.1 (SMESG000071689.1)

HSP 1 Score: 1615.9 bits (4183), Expect = 0.000e+0
Identity = 825/829 (99.52%), Postives = 825/829 (99.52%), Query Frame = 2
Query:  176 MCFDIMPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXX-XXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE 2659
            MCFDIMPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSG IVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYKEDKSK   EKLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYSECKSSESDSEKISPLSKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFLIYLYPLSPLLSSELWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE
Sbjct:    1 MCFDIMPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGVIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYKEDKSKQSDEKLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYSECKSSESDSEKISPLSKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFLIYLYPLSPLLSSELWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE 829          
BLAST of Leucine--tRNA ligase vs. Planmine SMEST
Match: SMESG000071689.1 (SMESG000071689.1)

HSP 1 Score: 1608.96 bits (4165), Expect = 0.000e+0
Identity = 822/823 (99.88%), Postives = 822/823 (99.88%), Query Frame = 2
Query:  191 MPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXXXXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE 2659
            MPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSG IVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYKEDKSKSDEKLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYSECKSSESDSEKISPLSKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFLIYLYPLSPLLSSELWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE
Sbjct:    1 MPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGVIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYKEDKSKSDEKLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYSECKSSESDSEKISPLSKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFLIYLYPLSPLLSSELWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE 823          
BLAST of Leucine--tRNA ligase vs. Planmine SMEST
Match: SMESG000071689.1 (SMESG000071689.1)

HSP 1 Score: 1604.73 bits (4154), Expect = 0.000e+0
Identity = 820/824 (99.51%), Postives = 820/824 (99.51%), Query Frame = 2
Query:  191 MPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYXXXXXXXX-XXLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYXXXXXXXXXXXXXXXXXKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFXXXXXXXXXXXXXXXWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE 2659
            MPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSG IVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYKEDKSK   EKLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYSECKSSESDSEKISPLSKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFLIYLYPLSPLLSSELWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE
Sbjct:    1 MPHYDFNVKKQLETFWQEKMSKITQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVIFPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSRELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDNTGRSWRSGVIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQKGWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINNDNIWWNYKEDKSKQSDEKLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDCVSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLDHNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCPSCGPVLTPDNQLPVMLPPYSECKSSESDSEKISPLSKAFNWMKSECPKCGNPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIGGMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQTKSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDKYGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPVNDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLTSLYMKFSNEKAKSSIFYHRMLLDFLIYLYPLSPLLSSELWAQLASKLAPIESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE 824          
The following BLAST results are available for this feature:
BLAST of Leucine--tRNA ligase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LARS28.726e-16237.23leucyl-tRNA synthetase 2, mitochondrial [Source:HG... [more]
LARS28.726e-16237.23leucyl-tRNA synthetase 2, mitochondrial [Source:HG... [more]
LARS28.726e-16237.23leucyl-tRNA synthetase 2, mitochondrial [Source:HG... [more]
LARS22.243e-13736.07leucyl-tRNA synthetase 2, mitochondrial [Source:HG... [more]
LARS24.790e-13040.74leucyl-tRNA synthetase 2, mitochondrial [Source:HG... [more]
back to top
BLAST of Leucine--tRNA ligase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lars-21.207e-12133.83Leucyl Amino-acyl tRNA Synthetase [Source:UniProt... [more]
lars-27.534e-3731.56Leucyl Amino-acyl tRNA Synthetase [Source:UniProt... [more]
iars-22.136e-925.60Isoleucyl Amino-acyl tRNA Synthetase [Source:UniP... [more]
glp-42.598e-926.00Valine--tRNA ligase [Source:UniProtKB/Swiss-Prot;... [more]
glp-42.598e-926.00Valine--tRNA ligase [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Leucine--tRNA ligase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LeuRS-m6.258e-18041.51gene:FBgn0027085 transcript:FBtr0073348[more]
ValRS3.659e-824.43gene:FBgn0027079 transcript:FBtr0087735[more]
ValRS3.659e-824.43gene:FBgn0027079 transcript:FBtr0087734[more]
ValRS3.759e-824.43gene:FBgn0027079 transcript:FBtr0333148[more]
IleRS-m1.108e-729.71gene:FBgn0036569 transcript:FBtr0302328[more]
back to top
BLAST of Leucine--tRNA ligase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lars21.980e-16337.29leucyl-tRNA synthetase 2, mitochondrial [Source:ZF... [more]
lars23.806e-7052.02leucyl-tRNA synthetase 2, mitochondrial [Source:ZF... [more]
vars22.116e-825.17valyl-tRNA synthetase 2, mitochondrial [Source:ZFI... [more]
vars22.116e-825.17valyl-tRNA synthetase 2, mitochondrial [Source:ZFI... [more]
iars28.872e-827.31isoleucyl-tRNA synthetase 2, mitochondrial [Source... [more]
back to top
BLAST of Leucine--tRNA ligase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bmp83.008e-15536.40bone morphogenetic protein 8 (osteogenic protein 2... [more]
bmp81.373e-15335.69bone morphogenetic protein 8 (osteogenic protein 2... [more]
bmp83.779e-15236.34bone morphogenetic protein 8 (osteogenic protein 2... [more]
bmp82.793e-14937.03bone morphogenetic protein 8 (osteogenic protein 2... [more]
bmp81.181e-12934.64bone morphogenetic protein 8 (osteogenic protein 2... [more]
back to top
BLAST of Leucine--tRNA ligase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lars22.260e-16738.03leucyl-tRNA synthetase, mitochondrial [Source:MGI ... [more]
Lars22.111e-8140.66leucyl-tRNA synthetase, mitochondrial [Source:MGI ... [more]
Lars22.406e-2655.42leucyl-tRNA synthetase, mitochondrial [Source:MGI ... [more]
Iars25.967e-1029.51isoleucine-tRNA synthetase 2, mitochondrial [Sourc... [more]
Iars29.021e-1029.51isoleucine-tRNA synthetase 2, mitochondrial [Sourc... [more]
back to top
BLAST of Leucine--tRNA ligase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VDC0|SYLM_MOUSE1.581e-16638.03Probable leucine--tRNA ligase, mitochondrial OS=Mu... [more]
sp|Q5RDP4|SYLM_PONAB8.202e-16237.36Probable leucine--tRNA ligase, mitochondrial OS=Po... [more]
sp|Q15031|SYLM_HUMAN4.190e-16137.23Probable leucine--tRNA ligase, mitochondrial OS=Ho... [more]
sp|B7KCI7|SYL_GLOC73.326e-15640.32Leucine--tRNA ligase OS=Gloeothece citriformis (st... [more]
sp|B7JYA9|SYL_RIPO18.688e-15539.04Leucine--tRNA ligase OS=Rippkaea orientalis (strai... [more]
back to top
BLAST of Leucine--tRNA ligase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NI180.000e+043.71Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A4Z2D8S10.000e+042.03Putative leucine--tRNA ligase OS=Schistosoma japon... [more]
A0A158R8130.000e+039.35Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A2J7RII50.000e+042.40Putative leucine--tRNA ligase, mitochondrial OS=Cr... [more]
A0A2J7RII90.000e+042.40Uncharacterized protein OS=Cryptotermes secundus O... [more]
back to top
BLAST of Leucine--tRNA ligase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lars28.760e-13235.45leucyl-tRNA synthetase 2, mitochondrial [Source:ZF... [more]
vars25.080e-1025.41valyl-tRNA synthetase 2, mitochondrial [Source:NCB... [more]
vars25.515e-1025.41valyl-tRNA synthetase 2, mitochondrial [Source:NCB... [more]
vars18.690e-725.50valyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
iars21.977e-625.32isoleucyl-tRNA synthetase 2, mitochondrial [Source... [more]
back to top
BLAST of Leucine--tRNA ligase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
iars21.920e-929.67isoleucyl-tRNA synthetase 2, mitochondrial [Source... [more]
ENSPMAT00000000584.12.714e-724.84pep scaffold:Pmarinus_7.0:GL486116:2002:8298:-1 ge... [more]
back to top
BLAST of Leucine--tRNA ligase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
NAM24.338e-13736.59Mitochondrial leucyl-tRNA synthetase; also has dir... [more]
VAS16.012e-1128.67Mitochondrial and cytoplasmic valyl-tRNA synthetas... [more]
ISM18.655e-1025.50Mitochondrial isoleucyl-tRNA synthetase; null muta... [more]
ILS11.718e-625.74Cytoplasmic isoleucine-tRNA synthetase; target of ... [more]
back to top
BLAST of Leucine--tRNA ligase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO292486.950e-5032.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO267942.924e-1028.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO256812.745e-827.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Leucine--tRNA ligase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lars22.729e-15936.10leucyl-tRNA synthetase 2, mitochondrial [Source:NC... [more]
vars23.044e-826.67valyl-tRNA synthetase 2, mitochondrial [Source:NCB... [more]
iars25.265e-827.74isoleucyl-tRNA synthetase 2, mitochondrial [Source... [more]
iars25.442e-827.74isoleucyl-tRNA synthetase 2, mitochondrial [Source... [more]
iars25.856e-827.74isoleucyl-tRNA synthetase 2, mitochondrial [Source... [more]
back to top
BLAST of Leucine--tRNA ligase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071689.10.000e+099.88SMESG000071689.1[more]
SMESG000071689.10.000e+099.53SMESG000071689.1[more]
SMESG000071689.10.000e+099.52SMESG000071689.1[more]
SMESG000071689.10.000e+099.88SMESG000071689.1[more]
SMESG000071689.10.000e+099.51SMESG000071689.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012572 ID=SMED30012572|Name=Leucine--tRNA ligase|organism=Schmidtea mediterranea sexual|type=transcript|length=2670bp
TTCAAATTTTTCATATTTGAAGCCTTATTTATTTTTTACACATTTTAAAA
TTATTGATATTGGGTTCTCTTAATAAATTTGAATATTTAAATATATTCAA
ACTATTAACATGATTAAATTATTAAATAGCTCTAGGTATGTGGCATTAAA
ACATGTTAAATTTTTCAGCTGTTCAATGTGCTTTGATATAATGCCTCATT
ATGATTTTAACGTCAAAAAACAGCTTGAAACTTTTTGGCAAGAGAAAATG
TCCAAAATAACACAAAATGATTCCGCAAACCGAAAGAAAATGTATATTTT
ATCAATGTTTCCATATCCTAGTGGTCAATTGCATATGGGTCACATGAGGG
TGTACACAACAGCCGACGTTCTAGCTAGAGTTAACCGACTTATGAACCAT
GAAGTAATATTTCCAATGGGATGGGACGCTTTTGGATTACCAGCGGAAAA
TGCAGCTCTTCAACGTGGATATGAACCAGAAAAGTGGACTTTAAAAAACA
TTTCTGAAATGAAAGAACAAATGAAAGAACAAATGACTCTCAGTATTGAC
TGGAGCCGAGAATTGTCTACTTGTGATCCAAATTATTACAAATGGACACA
ATGGCTTTTTTGTCGGCTTTTTGAGAAAGGATTCGTTTATCAAAAATCTG
AAATAGTAAATTGGGATCCGATTGATAAAACGGTTTTGGCAGATGAATTG
ATTGATAACACTGGAAGGTCTTGGAGATCTGGTGCGATTGTTGAAAAAGT
ACCGCTTAAACAATGGTTTATTCGAACGACAGCTTTATCAGAAAGTTTGC
TCGATGGATTAGATACTGTGAAAGGAGGACAGTGGCGGCGTGTTATTGAA
GCCCAAAAAGGATGGATTGGAGATTTGACGGGTGTTTACATAGATTTTGA
TTTAGTGGATTTCCAAGATGAAAATAGAATTTTGGAAAAATTATCAGTTT
TTACAGAACACCCTGTAGCAGCTTTATCTGACTTTGTAGCGTTTGTTGAA
ATTAATAACGACAACATTTGGTGGAATTATAAAGAAGACAAATCCAAGTC
CGACGAGAAATTGTCGTTTCATAGAAGTCTAGCTATAAAGCATCCTTTGT
CCGGAAGACTAATACCAATCATTAGGAATCAAAATTTAAAATTCCAAAGC
CAAGATTGCGTTTCATCTCGTCTAGGTTTACCTTTAGTCGACTTCAAAGA
TGCAACATTAGCATCTAAACTAGGAATTCCGTTTTCTTTTGTTCGATTAG
GAGCTTATAATCGTATTGTGAAGAGCGCTTGGAAGGAGTCGGAAGGCTGG
AATTTGGATCATAATTTAGAGAATGGTCTTAATGAGAAATGTTTAAAAAC
TTTGCGCATTATGGGAATAGGTGGGTATCGTTGCAGTAAATTACGGACAG
ATTGGCTAATTTCTCGACAAAGATATTGGGGTACACCTATTCCTATAGTG
CATTGTCCTTCTTGTGGTCCGGTTTTGACTCCAGATAATCAACTTCCAGT
TATGTTGCCTCCATATTCTGAATGCAAATCTAGTGAATCAGATTCAGAAA
AAATATCTCCTTTATCTAAAGCATTTAATTGGATGAAATCTGAGTGCCCA
AAATGTGGAAATCCAGAAGCAACACGGGAATCAGATACAATGGACACATT
TGTCGATTCTTCTTGGTATTTTCTGAGATATCTTGATTCCAAAAATTCTG
ATTATCTATGTTCGCCGTCAGTTGTATCTGAACATATGCCTGTTGATATT
TATATTGGTGGCATGGAACACGCGATTCGACATCTTTATTATGCACGTTT
CATGTCACATTTCATTCATTATTACACTGATATAAAATTGCCAAACGGCC
CGGAGCCTTTTTCGCAATTTTTACCCATTGGATTGGTATTAGCACAAACC
TATCAAACGAAATCCGGTAAATTTATACCCAACCATCAAGTAAAATACCT
AGATGACAAGCCAGTTTATATAGATAATCAAGAACCACTTTCAGAATTTT
GGGATAAAATGAGTAAATCTAAATTCAATGGTATCAGTCCAAAGACTGTG
GTTGACAAATATGGGCTGGATATGACTAGATTGATAATTCTAGCAAATAC
TGGTCCTGATAAAAACAGAAAATGGCAAGAAAATGATATTGTTTTGGGTA
TTCAAAACTGGGAAAGACGTGTTTGGAATTTGATTAAAGAAATTGTGAAT
TCTCCTGTCAATGATCCGAAGGTATTTTTAGTGAATGATTTCCTTCTGCA
AGATTCGGAATTTATTGCGAAATACCAATCACTTGTTACAAAGATTTTAT
TCCAATATCAAAAATCTTTTACCATTAGTGTGGTAGTATCTGTTCTTCAA
AAGTTGACATCTTTATATATGAAATTTTCGAATGAAAAAGCGAAATCCAG
CATCTTTTACCATAGAATGCTCCTAGATTTCTTGATTTATCTATATCCCC
TTAGTCCTTTGTTATCCTCCGAATTATGGGCTCAATTGGCATCTAAATTA
GCACCGATTGAATCTATTTTCATTGAAACTGATGATTCTTATAAATCGAT
ATTTGGTCCATGGGGCTATAACCTAAACTTGCCCGTATGGGATCAGCGGT
TGAATGTAAATGAAATTACATTGGATATACAAAATGAGTCTGTAAATATT
GTCAATGAATAAATTTTATT
back to top

protein sequence of SMED30012572-orf-1

>SMED30012572-orf-1 ID=SMED30012572-orf-1|Name=SMED30012572-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=851bp
MIKLLNSSRYVALKHVKFFSCSMCFDIMPHYDFNVKKQLETFWQEKMSKI
TQNDSANRKKMYILSMFPYPSGQLHMGHMRVYTTADVLARVNRLMNHEVI
FPMGWDAFGLPAENAALQRGYEPEKWTLKNISEMKEQMKEQMTLSIDWSR
ELSTCDPNYYKWTQWLFCRLFEKGFVYQKSEIVNWDPIDKTVLADELIDN
TGRSWRSGAIVEKVPLKQWFIRTTALSESLLDGLDTVKGGQWRRVIEAQK
GWIGDLTGVYIDFDLVDFQDENRILEKLSVFTEHPVAALSDFVAFVEINN
DNIWWNYKEDKSKSDEKLSFHRSLAIKHPLSGRLIPIIRNQNLKFQSQDC
VSSRLGLPLVDFKDATLASKLGIPFSFVRLGAYNRIVKSAWKESEGWNLD
HNLENGLNEKCLKTLRIMGIGGYRCSKLRTDWLISRQRYWGTPIPIVHCP
SCGPVLTPDNQLPVMLPPYSECKSSESDSEKISPLSKAFNWMKSECPKCG
NPEATRESDTMDTFVDSSWYFLRYLDSKNSDYLCSPSVVSEHMPVDIYIG
GMEHAIRHLYYARFMSHFIHYYTDIKLPNGPEPFSQFLPIGLVLAQTYQT
KSGKFIPNHQVKYLDDKPVYIDNQEPLSEFWDKMSKSKFNGISPKTVVDK
YGLDMTRLIILANTGPDKNRKWQENDIVLGIQNWERRVWNLIKEIVNSPV
NDPKVFLVNDFLLQDSEFIAKYQSLVTKILFQYQKSFTISVVVSVLQKLT
SLYMKFSNEKAKSSIFYHRMLLDFLIYLYPLSPLLSSELWAQLASKLAPI
ESIFIETDDSYKSIFGPWGYNLNLPVWDQRLNVNEITLDIQNESVNIVNE
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002302Leu-tRNA-ligase
IPR009080tRNAsynth_Ia_anticodon-bd
IPR015413Methionyl/Leucyl_tRNA_Synth
IPR014729Rossmann-like_a/b/a_fold
IPR002300aa-tRNA-synth_Ia
IPR009008Val/Leu/Ile-tRNA-synth_edit
IPR001412aa-tRNA-synth_I_CS
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004823leucine-tRNA ligase activity
GO:0005524ATP binding
GO:0004812aminoacyl-tRNA ligase activity
GO:0002161aminoacyl-tRNA editing activity
GO:0016874ligase activity
Vocabulary: biological process
TermDefinition
GO:0006429leucyl-tRNA aminoacylation
GO:0006418tRNA aminoacylation for protein translation
GO:0006412translation
GO:0006450regulation of translational fidelity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002302Leucine-tRNA ligasePRINTSPR00985TRNASYNTHLEUcoord: 545..567
score: 63.62
coord: 581..591
score: 38.76
coord: 244..263
score: 41.32
coord: 154..171
score: 60.82
coord: 180..196
score: 57.28
coord: 213..226
score: 40.6
coord: 506..524
score: 64.82
IPR002302Leucine-tRNA ligaseTIGRFAMTIGR00396TIGR00396coord: 35..807
e-value: 3.8E-190
score: 631.9
IPR002302Leucine-tRNA ligasePANTHERPTHR43740FAMILY NOT NAMEDcoord: 36..808
NoneNo IPR availableGENE3DG3DSA:3.10.330.110coord: 591..642
e-value: 4.1E-209
score: 698.5
NoneNo IPR availableGENE3DG3DSA:1.10.730.10coord: 35..796
e-value: 4.1E-209
score: 698.5
NoneNo IPR availablePANTHERPTHR43740:SF2LEUCINE--TRNA LIGASE, MITOCHONDRIAL-RELATEDcoord: 36..808
NoneNo IPR availableCDDcd00812LeuRS_corecoord: 60..672
e-value: 7.41956E-88
score: 279.518
NoneNo IPR availableSUPERFAMILYSSF52374Nucleotidylyl transferasecoord: 39..677
IPR002300Aminoacyl-tRNA synthetase, class IaPFAMPF00133tRNA-synt_1coord: 42..195
e-value: 7.3E-21
score: 74.1
coord: 429..597
e-value: 2.2E-7
score: 29.5
IPR009008Valyl/Leucyl/Isoleucyl-tRNA synthetase, editing domainGENE3DG3DSA:3.90.740.10coord: 256..426
e-value: 4.1E-209
score: 698.5
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 59..590
e-value: 4.1E-209
score: 698.5
IPR001412Aminoacyl-tRNA synthetase, class I, conserved sitePROSITEPS00178AA_TRNA_LIGASE_Icoord: 68..79
IPR009080Aminoacyl-tRNA synthetase, class Ia, anticodon-bindingSUPERFAMILYSSF47323Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetasescoord: 684..803