Ras-related protein Rab-39B

Overview
NameRas-related protein Rab-39B
Smed IDSMED30012555
Length (bp)1006
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-39B (SMED30012555) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-39B (SMED30012555) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-39B (SMED30012555) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-39B (SMED30012555) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012555

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30012555h1SMcG0001007 dd_Smed_v4_3651_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012555h1SMcG0001007 dd_Smed_v4_3651_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012555h1SMcG0001007 Contig15474newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30012555h1SMcG0001007 Contig15474uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30012555h1SMcG0001007 Contig15474newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30012555h1SMcG0001007 Contig15474uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30012555h1SMcG0001007 GU591871smed_ncbi_20240424PMID:21356107
Fernández-Taboada et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-39B vs. Ensembl Human
Match: RAB39B (RAB39B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:16499])

HSP 1 Score: 200.29 bits (508), Expect = 7.528e-63
Identity = 100/200 (50.00%), Postives = 136/200 (68.00%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            +   + YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++ EW +E K+ ++     FV+VGHK D++++RQV+  EA   A        YIETSA    NVE  F+ L   +   +K     E+  Q GW+G+K G  P
Sbjct:    1 MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAY--GMKYIETSARDAINVEKAFTDLTRDIYELVKRG---EITIQEGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. Ensembl Human
Match: RAB39A (RAB39A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:16521])

HSP 1 Score: 198.364 bits (503), Expect = 6.046e-62
Identity = 105/198 (53.03%), Postives = 134/198 (67.68%), Query Frame = 1
Query:   91 YQFRIILIGDSMVGKSSLVRCFSEGKF----SEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            YQFR+I+IGDS VGKS L+  F++G+F    S  CDPTVGVDFFSR++EI    RIKLQLWDTAGQE+FRSIT+SYYRNSV   LVFDIT R SF+H+ +W +EAK+ ++     F++VGHK D+ S+RQV+  EA   + D      YIETSA    NVE  F+ L   +   IK+    E+  Q GW+G+K G  P
Sbjct:    7 YQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADC--GMKYIETSAKDATNVEESFTILTRDIYELIKKG---EICIQDGWEGVKSGFVP 199          
BLAST of Ras-related protein Rab-39B vs. Ensembl Human
Match: RAB14 (RAB14, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:16524])

HSP 1 Score: 161.77 bits (408), Expect = 2.974e-48
Identity = 78/179 (43.58%), Postives = 124/179 (69.27%), Query Frame = 1
Query:   76 SPF-FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKE 609
            +P+ ++Y F+ I+IGD  VGKS L+  F+E KF   C  T+GV+F +RIIE+  + +IKLQ+WDTAGQE+FR++T+SYYR +  A++V+DIT+RS+++HL  W  +A+     N    +++G+KAD+E++R V+  EA+ FA +     L++E SA TG+NVE  F   A ++   I++
Sbjct:    4 APYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQ-KIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNT-VIILIGNKADLEAQRDVTYEEAKQFAEEN--GLLFLEASAKTGENVEDAFLEAAKKIYQNIQD 178          
BLAST of Ras-related protein Rab-39B vs. Ensembl Human
Match: RAB14 (RAB14, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:16524])

HSP 1 Score: 161.77 bits (408), Expect = 7.925e-48
Identity = 82/211 (38.86%), Postives = 135/211 (63.98%), Query Frame = 1
Query:   76 SPF-FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGG-------WDGIKMGTDPGPEQ 684
            +P+ ++Y F+ I+IGD  VGKS L+  F+E KF   C  T+GV+F +RIIE+  + +IKLQ+WDTAGQE+FR++T+SYYR +  A++V+DIT+RS+++HL  W  +A+     N    +++G+KAD+E++R V+  EA+ FA +     L++E SA TG+NVE  F   A ++   I++        + G         G ++ ++P P++
Sbjct:    4 APYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQ-KIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNT-VIILIGNKADLEAQRDVTYEEAKQFAEEN--GLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR 210          
BLAST of Ras-related protein Rab-39B vs. Ensembl Human
Match: RAB2A (RAB2A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9763])

HSP 1 Score: 156.377 bits (394), Expect = 8.257e-46
Identity = 83/193 (43.01%), Postives = 129/193 (66.84%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG 663
            + Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R+I I  K +IKLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +F+HL  W ++A+     N    +++G+K+D+ES R+V   E   FA +     +++ETSA T  NVE  F + A ++  KI+E  F ++ ++   +GIK+G
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGK-QIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNM-VIMLIGNKSDLESRREVKKEEGEAFAREH--GLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVF-DINNEA--NGIKIG 188          
BLAST of Ras-related protein Rab-39B vs. Ensembl Celegans
Match: rab-39 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q18969])

HSP 1 Score: 206.838 bits (525), Expect = 1.240e-65
Identity = 102/198 (51.52%), Postives = 138/198 (69.70%), Query Frame = 1
Query:   79 PFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPT---FVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG 663
            P F+YQ+R+I+IGDS VGKSSL+R F+EGK +EI DPTVGVDF++R+IE+    R+KLQLWDTAGQEKFRSITKSYYRNSV  + ++D T R SF+H+  W +EA L +    P+   F +VG K+DM+S+RQV+  E  +FA        +IETS+ TG NV   F  +A ++ N++ +    EL    GW+G+K G
Sbjct:   12 PLFHYQYRLIVIGDSTVGKSSLLRYFTEGKMAEISDPTVGVDFYARMIELRPGYRVKLQLWDTAGQEKFRSITKSYYRNSVGVLAIYDTTNRESFEHVENWVKEAALNLGGPSPSKCVFQLVGTKSDMDSQRQVNYEEGEYFA--KYHKMKFIETSSRTGDNVNEAFHMIAQEIQNRVDDG---ELRPVDGWEGLKTG 204          
BLAST of Ras-related protein Rab-39B vs. Ensembl Celegans
Match: rab-14 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874])

HSP 1 Score: 159.073 bits (401), Expect = 2.613e-47
Identity = 81/179 (45.25%), Postives = 120/179 (67.04%), Query Frame = 1
Query:   76 SPF-FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKE 609
            +P+ ++Y F+ I+IGD  VGKS L+  F+E KF   C  T+GV+F +RIIE+  + +IKLQ+WDTAGQE+FR++T+SYYR +  A++V+DIT+RS+++HL  W  +AK     N   F+I G+KAD+E +R V   EA+ FA +      ++E SA TG NVE  F   A Q+   I++
Sbjct:    4 APYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQ-KIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLADAKSLTNPNTAIFLI-GNKADLEDQRDVPYEEAKAFAEEN--GLTFLECSAKTGSNVEDAFLETAKQIYQNIQD 178          
BLAST of Ras-related protein Rab-39B vs. Ensembl Celegans
Match: rab-14 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874])

HSP 1 Score: 159.073 bits (401), Expect = 2.613e-47
Identity = 81/179 (45.25%), Postives = 120/179 (67.04%), Query Frame = 1
Query:   76 SPF-FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKE 609
            +P+ ++Y F+ I+IGD  VGKS L+  F+E KF   C  T+GV+F +RIIE+  + +IKLQ+WDTAGQE+FR++T+SYYR +  A++V+DIT+RS+++HL  W  +AK     N   F+I G+KAD+E +R V   EA+ FA +      ++E SA TG NVE  F   A Q+   I++
Sbjct:    4 APYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQ-KIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLADAKSLTNPNTAIFLI-GNKADLEDQRDVPYEEAKAFAEEN--GLTFLECSAKTGSNVEDAFLETAKQIYQNIQD 178          
BLAST of Ras-related protein Rab-39B vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3824947:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 156.377 bits (394), Expect = 3.839e-46
Identity = 82/198 (41.41%), Postives = 129/198 (65.15%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGP 678
            + Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R++ I  K +IKLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +F+HL  W ++A+     N    +++G+K+D+E+ R+V   E   FA +     +++ETSA T  NVE  F   A ++  KI+E  F ++ ++   +GIK+G    P
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGK-QIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNM-VIMLIGNKSDLEARREVKREEGEAFAREH--GLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVF-DINNEA--NGIKLGPQHSP 193          
BLAST of Ras-related protein Rab-39B vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3822883:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 156.377 bits (394), Expect = 4.931e-46
Identity = 82/198 (41.41%), Postives = 129/198 (65.15%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGP 678
            + Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R++ I D  +IKLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +F+HL  W ++A+     N    +++G+K+D+E+ R+V   E   FA +     +++ETSA T  NVE  F   A ++  KI+E  F ++ ++   +GIK+G    P
Sbjct:   12 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTI-DGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNM-VIMLIGNKSDLEARREVKREEGEAFAREH--GLVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVF-DINNEA--NGIKLGPQHSP 202          
BLAST of Ras-related protein Rab-39B vs. Ensembl Fly
Match: Rab39 (gene:FBgn0029959 transcript:FBtr0307272)

HSP 1 Score: 206.453 bits (524), Expect = 1.623e-65
Identity = 102/201 (50.75%), Postives = 141/201 (70.15%), Query Frame = 1
Query:   70 MLSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADM---ESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG 663
            M+ P F YQFR+ILIGDS VGKSSL++ F++GKF+E+ DPTVGVDFF+R+IE+ D  +IKLQLWDTAGQE+FRSITKSYYRNSV  +LV+DI+  +SF+H+  W  EA+  ++ + P F +VG K D+      R+V+  EA+ FA        ++ETSA +G NVE  F  +  +V  +I+  +++    + GWDGIK G
Sbjct:    1 MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFAKQH--GLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKA---EDGWDGIKSG 196          
BLAST of Ras-related protein Rab-39B vs. Ensembl Fly
Match: Rab39 (gene:FBgn0029959 transcript:FBtr0071072)

HSP 1 Score: 206.453 bits (524), Expect = 1.623e-65
Identity = 102/201 (50.75%), Postives = 141/201 (70.15%), Query Frame = 1
Query:   70 MLSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADM---ESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG 663
            M+ P F YQFR+ILIGDS VGKSSL++ F++GKF+E+ DPTVGVDFF+R+IE+ D  +IKLQLWDTAGQE+FRSITKSYYRNSV  +LV+DI+  +SF+H+  W  EA+  ++ + P F +VG K D+      R+V+  EA+ FA        ++ETSA +G NVE  F  +  +V  +I+  +++    + GWDGIK G
Sbjct:    1 MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFAKQH--GLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKA---EDGWDGIKSG 196          
BLAST of Ras-related protein Rab-39B vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0343678)

HSP 1 Score: 166.777 bits (421), Expect = 4.194e-50
Identity = 82/182 (45.05%), Postives = 126/182 (69.23%), Query Frame = 1
Query:   76 SPF-FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKF 618
            +P+ +NY F+ I+IGD  VGKS L+  F+E KF   C  T+GV+F +RIIE+ DK +IKLQ+WDTAGQE+FR++T+SYYR +  A++V+DIT+RS+++HL  W  + +     +   F+I G+K+D+ES R+V+  EA+ FA +     +++E SA+TGQNVE  F   A ++   I+E + 
Sbjct:    4 APYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDK-KIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLI-GNKSDLESTREVTYEEAKEFADEN--GLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRL 181          
BLAST of Ras-related protein Rab-39B vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0080626)

HSP 1 Score: 166.777 bits (421), Expect = 4.194e-50
Identity = 82/182 (45.05%), Postives = 126/182 (69.23%), Query Frame = 1
Query:   76 SPF-FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKF 618
            +P+ +NY F+ I+IGD  VGKS L+  F+E KF   C  T+GV+F +RIIE+ DK +IKLQ+WDTAGQE+FR++T+SYYR +  A++V+DIT+RS+++HL  W  + +     +   F+I G+K+D+ES R+V+  EA+ FA +     +++E SA+TGQNVE  F   A ++   I+E + 
Sbjct:    4 APYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDK-KIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLI-GNKSDLESTREVTYEEAKEFADEN--GLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRL 181          
BLAST of Ras-related protein Rab-39B vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0080627)

HSP 1 Score: 166.007 bits (419), Expect = 1.616e-49
Identity = 82/182 (45.05%), Postives = 126/182 (69.23%), Query Frame = 1
Query:   76 SPF-FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKF 618
            +P+ +NY F+ I+IGD  VGKS L+  F+E KF   C  T+GV+F +RIIE+ DK +IKLQ+WDTAGQE+FR++T+SYYR +  A++V+DIT+RS+++HL  W  + +     +   F+I G+K+D+ES R+V+  EA+ FA +     +++E SA+TGQNVE  F   A ++   I+E + 
Sbjct:   28 APYNYNYIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDK-KIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLI-GNKSDLESTREVTYEEAKEFADE--NGLMFLEASAMTGQNVEEAFLETARKIYQNIQEGRL 205          
BLAST of Ras-related protein Rab-39B vs. Ensembl Zebrafish
Match: rab39bb (RAB39B, member RAS oncogene family b [Source:ZFIN;Acc:ZDB-GENE-061215-104])

HSP 1 Score: 201.83 bits (512), Expect = 1.112e-63
Identity = 100/194 (51.55%), Postives = 135/194 (69.59%), Query Frame = 1
Query:   91 YQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++ EW +EA+  ++ +   F++VGHK D+E +RQVS +EA   A        Y+ETSA    NVE  F+ L   +   +K     E+  Q GW+G+K G  P
Sbjct:    7 YQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEEARSHVQPHSIVFLLVGHKCDLEPQRQVSQQEAEKLAAAY--GMRYVETSARDAINVERAFTELTRDIFELVKNG---EISIQEGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. Ensembl Zebrafish
Match: rab39ba (RAB39B, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-070620-7])

HSP 1 Score: 199.904 bits (507), Expect = 7.876e-63
Identity = 99/194 (51.03%), Postives = 135/194 (69.59%), Query Frame = 1
Query:   91 YQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++ EW +EA+  ++ +   F++VGHK D+E +RQVS +EA   A        Y+ETSA    NVE  F+ L   +   +K     ++  Q GW+G+K G  P
Sbjct:    7 YQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEEARSHVQPHSIVFILVGHKCDLEQQRQVSQQEAEKLAAAY--GMRYVETSARDAINVEKAFTELTRDIFELVKCG---DITIQEGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. Ensembl Zebrafish
Match: rab42a (RAB42, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-040426-1983])

HSP 1 Score: 196.438 bits (498), Expect = 1.413e-61
Identity = 95/197 (48.22%), Postives = 135/197 (68.53%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG 663
            +   + YQFRIIL+GDS VGKSSL++ F++G +S++ DPTVGVDF++R I+I   ++IKLQLWDTAGQE+FRSIT SYYRNSV  +LVFD+T R +FDH+ EW++E    +  +   ++++GHK+D+  +R+V+  EA   A D +G   Y+ETSA    NVE  F  L   +   +   K  E+  + GWDG+K G
Sbjct:    1 MDTLWQYQFRIILLGDSTVGKSSLLKRFTDGIYSDVADPTVGVDFYARSIDIEPGVKIKLQLWDTAGQERFRSITTSYYRNSVGGLLVFDLTNRKTFDHVREWHREVSEHILPHHMVYILIGHKSDLSRDRKVTRDEAEQLAAD-LG-IRYVETSAKCNSNVERAFELLTRDIYELM---KMGEISTRDGWDGVKSG 192          
BLAST of Ras-related protein Rab-39B vs. Ensembl Zebrafish
Match: rab42b (RAB42, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050417-172])

HSP 1 Score: 171.785 bits (434), Expect = 6.760e-52
Identity = 93/209 (44.50%), Postives = 132/209 (63.16%), Query Frame = 1
Query:   82 FFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPT--FVIVGHKADM--ESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIRL 696
             + YQFRII++GDS VGKSS+++ ++E  F E  + TVGVDF+   +E+   +R+KLQ WDTAGQE+FRS+T+SYYRNSV  +LVFD+  R SF+++ EWY  A++C + +  T  FV+VGHK+D     ER V   EA   A+       YIE SA TG NV+  F  L  ++   +K  + Q    + GWDG+K  + P  + L +L
Sbjct:    5 LWQYQFRIIMLGDSTVGKSSMLKRYTEDLFLECINQTVGVDFYVHFLEVEPGVRVKLQFWDTAGQERFRSVTRSYYRNSVGGLLVFDLGNRKSFENVREWY--AEVCERVHPYTVLFVLVGHKSDRVKGGERAVDRTEAEKLASQL--GAPYIEASAKTGHNVKEAFDLLTRRIYQGLKSGEIQL---REGWDGVK-SSAPTAQTLQKL 205          
BLAST of Ras-related protein Rab-39B vs. Ensembl Zebrafish
Match: rab14 (RAB14, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-030826-20])

HSP 1 Score: 160.999 bits (406), Expect = 1.102e-47
Identity = 77/182 (42.31%), Postives = 124/182 (68.13%), Query Frame = 1
Query:   76 SPF-FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKF 618
            +P+ ++Y F+ I+IGD  VGKS L+  F+E KF   C  T+GV+F +RIIE+  + ++KLQ+WDTAGQE+FR++T+SYYR +  A++V+DIT+RS+++HL  W  +A+     N    +++G+KAD+E++R V+  EA+ FA +     L++E SA TG+NVE  F   A ++   I++   
Sbjct:    4 APYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQ-KVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNT-VIILIGNKADLEAQRDVTYEEAKQFAEEN--GLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSL 181          
BLAST of Ras-related protein Rab-39B vs. Ensembl Xenopus
Match: nr6a1 (nuclear receptor subfamily 6 group A member 1 [Source:Xenbase;Acc:XB-GENE-487592])

HSP 1 Score: 201.06 bits (510), Expect = 4.286e-63
Identity = 100/194 (51.55%), Postives = 136/194 (70.10%), Query Frame = 1
Query:   91 YQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++ EW +EAK  ++     FV+VGHK D++++RQV+  EA   A+       YIETSA    NVE  F+ L   +   +++    E+  Q GW+G+K G  P
Sbjct:    7 YQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEEAKAHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLASSF--GMRYIETSARDAINVEKAFTELTRDIYELVRKG---EINIQEGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. Ensembl Xenopus
Match: RAB2A (RAB2A, member RAS oncogene family [Source:NCBI gene;Acc:100038062])

HSP 1 Score: 155.606 bits (392), Expect = 1.382e-45
Identity = 84/200 (42.00%), Postives = 131/200 (65.50%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG---TDPG 675
            + Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R+I I  K +IKLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +F+HL  W ++A+     N    +++ +K+D+ES R+V   E   FA +     +++ETSA T  NVE  F + A ++  KI+E  F ++ ++   +GIK+G   + PG
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGK-QIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNM-VIMLIANKSDLESRREVKKEEGEAFAREH--GLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVF-DINNEA--NGIKIGPQHSTPG 195          
BLAST of Ras-related protein Rab-39B vs. Ensembl Xenopus
Match: hus1 (HUS1 checkpoint clamp component [Source:Xenbase;Acc:XB-GENE-983295])

HSP 1 Score: 155.606 bits (392), Expect = 1.504e-45
Identity = 92/224 (41.07%), Postives = 138/224 (61.61%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIR--LGSYDK--------SYGCC 726
            + Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R+I I  K  IKLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +F HL  W ++A+     N    +++G+K+D+ES R VS  E   FA +     +++ETSA T  NVE  F   A ++  KI++  F ++ ++   +GIK+    GP+Q I   LGS  +        + GCC
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGK-PIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFSHLTSWLEDARQHSSSNM-VIILIGNKSDLESRRDVSREEGEAFAREH--GLIFMETSAKTAANVEEAFIDTAKEIYKKIQQGLF-DVNNEA--NGIKV----GPQQSINEPLGSGLRQNQNEGGGTSGCC 215          
BLAST of Ras-related protein Rab-39B vs. Ensembl Xenopus
Match: olfml2b (olfactomedin like 2B [Source:Xenbase;Acc:XB-GENE-960543])

HSP 1 Score: 150.984 bits (380), Expect = 8.070e-44
Identity = 69/174 (39.66%), Postives = 114/174 (65.52%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIK 606
            +++QFR++L+GDS VGK+SL+  +++G+F++    TVGVDF  R  E    ++++LQ WDTAGQE++R++T+SYYRN+   +L+FD+T R SFD++ EW+ E     +     F+++G K D++ +R V+  EA+  A +      Y+ETSA TG NV    S L  +++   +
Sbjct:    5 WDFQFRVLLLGDSGVGKTSLLHRYTDGQFTDTTTETVGVDFCCREEEPEPGVKVRLQFWDTAGQERYRAVTRSYYRNAAGVLLLFDLTTRQSFDNVTEWHMEVTERTQAKPMVFMLLGAKNDLKEKRMVTREEAQRLAENLSAP--YLETSARTGSNVSAALSLLCRELLRAAR 176          
BLAST of Ras-related protein Rab-39B vs. Ensembl Xenopus
Match: map4 (microtubule associated protein 4 [Source:Xenbase;Acc:XB-GENE-6259104])

HSP 1 Score: 150.599 bits (379), Expect = 1.633e-43
Identity = 78/204 (38.24%), Postives = 128/204 (62.75%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQ 684
            +S  +++ F+ ++IG +  GKS L+  F E KF +  + T+GV+F SRI+ +  K  +KLQ+WDTAGQE+FRS+T+SYYR +  A+LV+DI  R +++ L  W  +A+     N    ++ G+K D++++R+V+  EA  FA +   + +++ETSA+TG+NVE  F   A  +++KI+     EL  +  W GI+ G D  P  
Sbjct:    1 MSETYDFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRIVNVGGK-SVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDIASRETYNALTNWLTDARTLASPNI-IIILCGNKKDLDADREVTFLEASRFAQEN--ELMFLETSALTGENVEEAFLKCARTILSKIESG---ELDPERMWSGIQYG-DASPRH 196          
BLAST of Ras-related protein Rab-39B vs. Ensembl Mouse
Match: Rab39 (RAB39, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:2442855])

HSP 1 Score: 201.06 bits (510), Expect = 2.935e-63
Identity = 107/198 (54.04%), Postives = 135/198 (68.18%), Query Frame = 1
Query:   91 YQFRIILIGDSMVGKSSLVRCFSEGKF----SEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            YQFR+I+IGDS VGKS L+  F++G+F    S  CDPTVGVDFFSR++EI    RIKLQLWDTAGQE+FRSIT+SYYRNSV   LVFDIT R SF+H+ +W +EAK+ ++     F++VGHK D+ S+RQVS  EA   +TD      YIETSA    NVE  F+ L   +   IK+    E+  Q GW+G+K G  P
Sbjct:    7 YQFRLIVIGDSTVGKSCLLHRFTQGRFPGLHSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQIVFLLVGHKCDLASQRQVSREEAERLSTDC--GMKYIETSAKDATNVEESFTILTRDIYELIKKG---EICIQDGWEGVKSGFVP 199          
BLAST of Ras-related protein Rab-39B vs. Ensembl Mouse
Match: Rab39b (RAB39B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1915040])

HSP 1 Score: 200.29 bits (508), Expect = 4.740e-63
Identity = 100/200 (50.00%), Postives = 136/200 (68.00%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            +   + YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++ EW +E K+ ++     FV+VGHK D++++RQV+  EA   A        YIETSA    NVE  F+ L   +   +K     E+  Q GW+G+K G  P
Sbjct:    1 MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAY--GMKYIETSARDAINVEKAFTDLTRDIYELVKRG---EITIQEGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. Ensembl Mouse
Match: Rab14 (RAB14, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1915615])

HSP 1 Score: 161.77 bits (408), Expect = 5.441e-48
Identity = 82/211 (38.86%), Postives = 135/211 (63.98%), Query Frame = 1
Query:   76 SPF-FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGG-------WDGIKMGTDPGPEQ 684
            +P+ ++Y F+ I+IGD  VGKS L+  F+E KF   C  T+GV+F +RIIE+  + +IKLQ+WDTAGQE+FR++T+SYYR +  A++V+DIT+RS+++HL  W  +A+     N    +++G+KAD+E++R V+  EA+ FA +     L++E SA TG+NVE  F   A ++   I++        + G         G ++ ++P P++
Sbjct:    4 APYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQ-KIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNT-VIILIGNKADLEAQRDVTYEEAKQFAEEN--GLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR 210          
BLAST of Ras-related protein Rab-39B vs. Ensembl Mouse
Match: Rab42 (RAB42, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:2441753])

HSP 1 Score: 159.844 bits (403), Expect = 3.223e-47
Identity = 88/218 (40.37%), Postives = 136/218 (62.39%), Query Frame = 1
Query:   88 NYQFRIILIGDSMVGKSSLVRCF---SEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDT-IGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIK-MGTDPGPEQLIRLGSYDKSYGCC 726
            +YQFRI L+GD+ VGK+SL+RC+   + G      +PTVGV+F+SR +++P  +R+KLQLWDTAGQE FR IT+S+YRN V  +LVFD+T R SF+H+  W+QE       +   F++VGHK D+ + R VS++EA   A    +G   ++ETSA +  NV++ F ++ + +   +++   +  LD+  W G++ +   P P    R  S  +  G C
Sbjct:    7 SYQFRIALLGDAGVGKTSLLRCYVAGARGAAEPDPEPTVGVEFYSRALQLPAGLRVKLQLWDTAGQECFRCITRSFYRNMVGVLLVFDVTNRESFEHIQAWHQEVVSTQGPDKVVFLLVGHKCDLNT-RCVSSQEAEELAASLGMG---FMETSAKSNCNVDLAFDTVTSAIEQALQQGDIK--LDK-DWAGVRLLHRSPNP----RSSSRKQDSGTC 213          
BLAST of Ras-related protein Rab-39B vs. Ensembl Mouse
Match: Rab2a (RAB2A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1928750])

HSP 1 Score: 156.762 bits (395), Expect = 4.112e-46
Identity = 83/193 (43.01%), Postives = 129/193 (66.84%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG 663
            + Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R+I I  K +IKLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +F+HL  W ++A+     N    +++G+K+D+ES R+V   E   FA +     +++ETSA T  NVE  F + A ++  KI+E  F ++ ++   +GIK+G
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGK-QIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNM-VIMLIGNKSDLESRREVKKEEGEAFAREH--GLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVF-DINNEA--NGIKIG 188          
BLAST of Ras-related protein Rab-39B vs. UniProt/SwissProt
Match: sp|Q8BHD0|RB39A_MOUSE (Ras-related protein Rab-39A OS=Mus musculus OX=10090 GN=Rab39a PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 2.053e-62
Identity = 107/198 (54.04%), Postives = 135/198 (68.18%), Query Frame = 1
Query:   91 YQFRIILIGDSMVGKSSLVRCFSEGKF----SEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            YQFR+I+IGDS VGKS L+  F++G+F    S  CDPTVGVDFFSR++EI    RIKLQLWDTAGQE+FRSIT+SYYRNSV   LVFDIT R SF+H+ +W +EAK+ ++     F++VGHK D+ S+RQVS  EA   +TD      YIETSA    NVE  F+ L   +   IK+    E+  Q GW+G+K G  P
Sbjct:    7 YQFRLIVIGDSTVGKSCLLHRFTQGRFPGLHSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMHVQPFQIVFLLVGHKCDLASQRQVSREEAERLSTDC--GMKYIETSAKDATNVEESFTILTRDIYELIKKG---EICIQDGWEGVKSGFVP 199          
BLAST of Ras-related protein Rab-39B vs. UniProt/SwissProt
Match: sp|Q8BHC1|RB39B_MOUSE (Ras-related protein Rab-39B OS=Mus musculus OX=10090 GN=Rab39b PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 3.315e-62
Identity = 100/200 (50.00%), Postives = 136/200 (68.00%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            +   + YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++ EW +E K+ ++     FV+VGHK D++++RQV+  EA   A        YIETSA    NVE  F+ L   +   +K     E+  Q GW+G+K G  P
Sbjct:    1 MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAY--GMKYIETSARDAINVEKAFTDLTRDIYELVKRG---EITIQEGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. UniProt/SwissProt
Match: sp|Q96DA2|RB39B_HUMAN (Ras-related protein Rab-39B OS=Homo sapiens OX=9606 GN=RAB39B PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 3.615e-62
Identity = 100/200 (50.00%), Postives = 136/200 (68.00%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            +   + YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++ EW +E K+ ++     FV+VGHK D++++RQV+  EA   A        YIETSA    NVE  F+ L   +   +K     E+  Q GW+G+K G  P
Sbjct:    1 MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAY--GMKYIETSARDAINVEKAFTDLTRDIYELVKRG---EITIQEGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. UniProt/SwissProt
Match: sp|Q17QU4|RB39B_BOVIN (Ras-related protein Rab-39B OS=Bos taurus OX=9913 GN=RAB39B PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.268e-61
Identity = 99/200 (49.50%), Postives = 136/200 (68.00%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            +   + YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++ EW +E K+ ++     FV+VGHK D++++RQV+  EA   A        YIETSA    NVE  F+ L   +   +K     ++  Q GW+G+K G  P
Sbjct:    1 MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAY--GMKYIETSARDAINVEKAFTDLTRDIYELVKRG---DITIQEGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. UniProt/SwissProt
Match: sp|Q14964|RB39A_HUMAN (Ras-related protein Rab-39A OS=Homo sapiens OX=9606 GN=RAB39A PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 2.904e-61
Identity = 105/198 (53.03%), Postives = 134/198 (67.68%), Query Frame = 1
Query:   91 YQFRIILIGDSMVGKSSLVRCFSEGKF----SEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            YQFR+I+IGDS VGKS L+  F++G+F    S  CDPTVGVDFFSR++EI    RIKLQLWDTAGQE+FRSIT+SYYRNSV   LVFDIT R SF+H+ +W +EAK+ ++     F++VGHK D+ S+RQV+  EA   + D      YIETSA    NVE  F+ L   +   IK+    E+  Q GW+G+K G  P
Sbjct:    7 YQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADC--GMKYIETSAKDATNVEESFTILTRDIYELIKKG---EICIQDGWEGVKSGFVP 199          
BLAST of Ras-related protein Rab-39B vs. TrEMBL
Match: A0A0X3PR49 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR122324 PE=4 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 3.427e-79
Identity = 127/226 (56.19%), Postives = 159/226 (70.35%), Query Frame = 1
Query:   70 MLSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGP---EQLIRLGSYD----KSYGCC 726
            M+SP+F++QFR+ILIGDS VGKSSL++ F+EGKF+++CDPTVGVDF SR I + D   IKLQLWDTAGQEKF+SIT+SYYRN+V A+LVFDIT R SF H+  W+++A + MKC  P+F++VG KAD+ S R+VS  EA   A   +GD  YIETSA+TG NVE VF  LA  V  K+K   + EL   G WDGIK G    P   +  +RL S D       GCC
Sbjct:    1 MVSPYFDFQFRVILIGDSTVGKSSLLQTFNEGKFTQVCDPTVGVDFSSRKIRLSDNKIIKLQLWDTAGQEKFKSITRSYYRNAVGALLVFDITNRESFSHISGWFEDAAMNMKCRSPSFILVGQKADLASAREVSVLEAECLA-QRLGDYQYIETSALTGANVEQVFLLLAESVYAKMKAGIYTELGSTGEWDGIKPGYGSSPTSSQPPLRLSSRDYDGPSDQGCC 225          
BLAST of Ras-related protein Rab-39B vs. TrEMBL
Match: A0A0V0J979 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR122324 PE=4 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 3.537e-76
Identity = 128/237 (54.01%), Postives = 159/237 (67.09%), Query Frame = 1
Query:   70 MLSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEK-----------FRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGP---EQLIRLGSYD----KSYGCC 726
            M+SP+F++QFR+ILIGDS VGKSSL++ F+EGKF+++CDPTVGVDF SR I + D   IKLQLWDTAGQEK           FRSIT+SYYRN+V A+LVFDIT R SF H+  W+++A + MKC  P+F++VG KAD+ S R+VS  EA   A   +GD  YIETSA+TG NVE VF  LA  V  K+K   + EL   G WDGIK G    P   +  +RL S D       GCC
Sbjct:    1 MVSPYFDFQFRVILIGDSTVGKSSLLQTFNEGKFTQVCDPTVGVDFSSRKIRLSDNKIIKLQLWDTAGQEKFKSRLFILMIDFRSITRSYYRNAVGALLVFDITNRESFSHISGWFEDAAMNMKCRSPSFILVGQKADLASAREVSVLEAECLA-QRLGDYQYIETSALTGANVEQVFLLLAESVYAKMKAGIYTELGSTGEWDGIKPGYGSSPTSSQPPLRLSSRDYDGPSDQGCC 236          
BLAST of Ras-related protein Rab-39B vs. TrEMBL
Match: Q86EN0 (RAB39, member RAS oncogene family OS=Schistosoma japonicum OX=6182 GN=RAB39 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 5.333e-76
Identity = 109/197 (55.33%), Postives = 147/197 (74.62%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG 663
            + P+F+YQFR+I+IGDSMVGKSSL++ F EG FS + DPT+GVDFFSR + I +++ +KLQLWDTAGQEKFRSIT SYYRN V  ++VFD+T R +FDH+ +WY+EA++ +KC+ P F++VGHKAD   ERQV+  EA+  A   +GD  YIETS++TGQN+E  F  LA  +   + +  + EL   G WDG+K G
Sbjct:    1 MLPYFDYQFRVIIIGDSMVGKSSLMKSFVEGNFSPVSDPTIGVDFFSRTVRIQEEVFVKLQLWDTAGQEKFRSITASYYRNCVGVIIVFDLTDRETFDHISDWYEEARVSIKCSAPVFIVVGHKADRRDERQVTKIEAQSLA-QRLGDYAYIETSSLTGQNIEKTFELLAEGIYTNVIKGSYNELCAGGVWDGVKQG 196          
BLAST of Ras-related protein Rab-39B vs. TrEMBL
Match: A0A430Q3C1 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0006616 PE=4 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.664e-75
Identity = 109/197 (55.33%), Postives = 147/197 (74.62%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG 663
            + P+F+YQFR+I+IGDSMVGKSSL++ F EG F+ + DPT+GVDFFSR + I +++ +KLQLWDTAGQEKFR+IT SYYRN V  V+VFD+T R +FDH+ +WY+EA+  +KC+ P F+IVGHKAD   ERQV+  EA   A   +GD +YIETS++TGQN+E  F  LA  + + + +  + EL   G WDG+K G
Sbjct:    1 MLPYFDYQFRVIIIGDSMVGKSSLMKSFVEGNFTPVSDPTIGVDFFSRTVRIQEEVFVKLQLWDTAGQEKFRTITSSYYRNCVGVVVVFDLTDRETFDHVADWYEEARGSIKCSAPVFIIVGHKADRRDERQVTKIEAESLA-QRLGDYIYIETSSLTGQNIEKTFELLAEGIYSNVIKGSYNELCAGGVWDGVKQG 196          
BLAST of Ras-related protein Rab-39B vs. TrEMBL
Match: V4AZJ3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_199507 PE=4 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 3.025e-75
Identity = 116/220 (52.73%), Postives = 161/220 (73.18%), Query Frame = 1
Query:   70 MLSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIRLGSYD-KSYGCC 726
            M+ P F YQFR+ILIGDS VGKSSL++ F++GKF E CDPTVGVDF++R+IE+   IR+KLQLWDTAGQE+FRSIT+SYYRNSV  ++++DITK+S+FD++ EW+ EAK+ ++ +   ++I+GHKAD E +RQV  R+ R FA   I    ++ETSA+TGQNVE  FSS+A  +   I + K +    + GWDG+K G    P++ + L   + +S GCC
Sbjct:    1 MVEPIFEYQFRLILIGDSTVGKSSLLKYFTDGKFEETCDPTVGVDFYARLIEVKPGIRVKLQLWDTAGQERFRSITRSYYRNSVGVMILYDITKKSTFDNVKEWFAEAKMHIEPHQAVYLIIGHKADREEQRQVPTRDGRRFA--EINGLKFLETSAMTGQNVEESFSSIAKDIYQSIADGKIKV---EEGWDGVKYGF-ARPKETVHLAEGEPESGGCC 214          
BLAST of Ras-related protein Rab-39B vs. Ensembl Cavefish
Match: rab39ba (ras-related protein Rab-39B [Source:NCBI gene;Acc:103034714])

HSP 1 Score: 200.675 bits (509), Expect = 2.998e-63
Identity = 98/194 (50.52%), Postives = 136/194 (70.10%), Query Frame = 1
Query:   91 YQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++ EW +EA+  ++ +   F++VGHK D++++RQVS +EA   A        Y+ETSA    NVE  F+ L   +   +K     ++  Q GW+G+K G  P
Sbjct:    7 YQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEEARSHVQPHSIVFLLVGHKCDLDAQRQVSQQEAEKLAAAY--GMRYVETSARDAINVERAFTELTRDIFELVKRG---DITIQEGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. Ensembl Cavefish
Match: ENSAMXT00000003791.2 (ras-related protein Rab-39B-like [Source:NCBI gene;Acc:103045353])

HSP 1 Score: 198.749 bits (504), Expect = 1.569e-62
Identity = 97/194 (50.00%), Postives = 135/194 (69.59%), Query Frame = 1
Query:   91 YQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++ EW +EA+  ++ +   F++VGHK D+E++RQV+ +EA   A        Y+ETSA    NVE  F+ L   +   +K     E+  Q  W+G++ G  P
Sbjct:    7 YQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEEARSHVQPHSIVFLLVGHKCDLEAQRQVTRQEAEKLAAAY--GMRYVETSARDAINVERAFTELTRDIFELVKHG---EITIQEDWEGVRSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. Ensembl Cavefish
Match: rab42a (ras-related protein Rab-39B-like [Source:NCBI gene;Acc:103028730])

HSP 1 Score: 197.593 bits (501), Expect = 5.498e-62
Identity = 96/194 (49.48%), Postives = 134/194 (69.07%), Query Frame = 1
Query:   82 FFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG 663
             + YQFRIIL+GDS VGKSSL++ F++G +S++ DPTVGVDF++R ++I   ++IKLQLWDTAGQE+FRSIT SYYRNSV  +LVFD+T R +FDH+ EW++E    +  +   +++VGHK+D+  ER+VS  EA   A + +G   Y+ETSA    NVE  F  L   +   +   K  E+  + GWDG+K G
Sbjct:    4 LWQYQFRIILLGDSTVGKSSLLKRFTDGVYSDVADPTVGVDFYARSLDIEPGVKIKLQLWDTAGQERFRSITTSYYRNSVGGLLVFDLTNRKTFDHVREWHREVSEHILPHHMVYILVGHKSDLNRERKVSRDEAEQLAAE-LG-VRYVETSAKCNSNVERAFELLTRDIYELM---KMGEIATRDGWDGVKSG 192          
BLAST of Ras-related protein Rab-39B vs. Ensembl Cavefish
Match: rab42b (ras-related protein Rab-39B [Source:NCBI gene;Acc:103039600])

HSP 1 Score: 174.866 bits (442), Expect = 5.310e-53
Identity = 87/194 (44.85%), Postives = 126/194 (64.95%), Query Frame = 1
Query:   82 FFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMES--ERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIK 657
             + YQFRII++GDS VGKSS+++ ++E +F E  + TVGVDF+   +E+   +RIKLQ WDTAGQE+FRS+T+SYYRNSV A+LVFD+  R+SF+ + EW+ E +  ++ +   FV+VGHK+D E+  ER V   EA   A        Y+E SA TG +++  F  L  +V   +   + Q    + GWDG+K
Sbjct:    5 LWQYQFRIIMLGDSTVGKSSMLKRYTEDQFLECINQTVGVDFYVHFLEVEPGVRIKLQFWDTAGQERFRSVTRSYYRNSVGALLVFDLGNRASFERVREWHAEVREHVRPHAVLFVLVGHKSDREADGERVVGREEAEKLAAQL--GAPYVEASAKTGHDIQAPFELLTRRVYQGLLAGEVQL---REGWDGVK 193          
BLAST of Ras-related protein Rab-39B vs. Ensembl Cavefish
Match: rab42b (ras-related protein Rab-39B [Source:NCBI gene;Acc:103039600])

HSP 1 Score: 174.866 bits (442), Expect = 5.310e-53
Identity = 87/194 (44.85%), Postives = 126/194 (64.95%), Query Frame = 1
Query:   82 FFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMES--ERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIK 657
             + YQFRII++GDS VGKSS+++ ++E +F E  + TVGVDF+   +E+   +RIKLQ WDTAGQE+FRS+T+SYYRNSV A+LVFD+  R+SF+ + EW+ E +  ++ +   FV+VGHK+D E+  ER V   EA   A        Y+E SA TG +++  F  L  +V   +   + Q    + GWDG+K
Sbjct:    5 LWQYQFRIIMLGDSTVGKSSMLKRYTEDQFLECINQTVGVDFYVHFLEVEPGVRIKLQFWDTAGQERFRSVTRSYYRNSVGALLVFDLGNRASFERVREWHAEVREHVRPHAVLFVLVGHKSDREADGERVVGREEAEKLAAQL--GAPYVEASAKTGHDIQAPFELLTRRVYQGLLAGEVQL---REGWDGVK 193          
BLAST of Ras-related protein Rab-39B vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 161.77 bits (408), Expect = 9.646e-49
Identity = 90/219 (41.10%), Postives = 137/219 (62.56%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIK-----MGTDPGPEQLIRLGSYDKSYGCC 726
            + Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R+I I  K ++KLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +F+HL  W ++A+     N    +++G+K+D+ES R+V   E   FA +     +++ETSA T  NVE  F + A ++  KI+E  F ++ ++   +GIK     +G  P   Q    GS   S GCC
Sbjct:    8 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMIAIGGK-QVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTAWLEDARQHSNSNM-VIMLIGNKSDLESRREVKCEEGEAFAREH--GLVFMETSAKTAANVEEAFINTAREIYEKIQEGVF-DVNNEA--NGIKIGPQQLGATPSAGQGRPAGSTGGSDGCC 219          
BLAST of Ras-related protein Rab-39B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002219.1 (pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene:ENSPMAG00000002006.1 transcript:ENSPMAT00000002219.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.229 bits (404), Expect = 3.683e-48
Identity = 82/201 (40.80%), Postives = 127/201 (63.18%), Query Frame = 1
Query:   76 SPF-FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPG 675
            +P+ ++Y F+ I+IGD  VGKS L+  F+E KF   C  T+GV+F +RIIE+  + ++KLQ+WDTAGQE+FR++T+SYYR +  A++V+DIT+RS+++HL  W  +A+     N   F+I G+KAD+E++R V+  EA+ FA +     L++E SA TG NVE  F   A ++   I++        + G         PG
Sbjct:    4 APYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQ-KVKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLI-GNKADLEAQRDVTYEEAKQFAEEN--GLLFLEASAKTGDNVEEAFLETAKKIYQNIQDGSLDLNAAESGVQHKPATPQPG 200          
BLAST of Ras-related protein Rab-39B vs. Ensembl Sea Lamprey
Match: rab2a (RAB2A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-011212-2])

HSP 1 Score: 156.762 bits (395), Expect = 8.201e-47
Identity = 86/217 (39.63%), Postives = 135/217 (62.21%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIRLGSYDKSY---GCC 726
            + Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R+I I  K ++KLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +F+HL  W ++A+     N    +++G+K+D+ES R+V   E   FA +     +++ETSA T  NVE  F + A ++  KI+E  F ++ ++   +GIK+G            S ++     GCC
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGK-QVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNM-VIMLIGNKSDLESRREVKREEGEAFAREH--GLVFMETSAKTASNVEEAFINTAKEIYEKIQEGVF-DINNEA--NGIKIGPQHAASSPGMASSQNRQQQDGGCC 212          
BLAST of Ras-related protein Rab-39B vs. Ensembl Sea Lamprey
Match: RAB2B (RAB2B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20246])

HSP 1 Score: 152.14 bits (383), Expect = 1.762e-45
Identity = 77/178 (43.26%), Postives = 117/178 (65.73%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKF 618
            + Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R+I I  K ++KLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +F+HL  W ++A+     N    +++G+K+D+ES R V   E   FA +     +++ETSA T  NVE  F + A ++  +I E  F
Sbjct:    8 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMINIDGK-QVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSSNM-IIMLIGNKSDLESRRDVKREEGEAFAREH--GLVFMETSAKTAANVEEAFINTAKEIYQRIHEGVF 181          
BLAST of Ras-related protein Rab-39B vs. Ensembl Sea Lamprey
Match: rab4b (RAB4B, member RAS oncogene family [Source:NCBI gene;Acc:445498])

HSP 1 Score: 137.887 bits (346), Expect = 1.321e-39
Identity = 75/194 (38.66%), Postives = 121/194 (62.37%), Query Frame = 1
Query:   88 NYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDIT--KRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG 663
            ++ F+ ++IG +  GKS L+  F E KF +  + T+GV+F S+++    K  +KLQ+WDTAGQE+FRS+T+SYYR +  A+LV+DIT   R +++ L  W  +A+     N    ++ G+K D+E +R+V+  EA  FA +   + +++ETSA+TG+NVE  F   A  ++NKI+     EL  +    GI+ G
Sbjct:   10 DFLFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSKVVNTGGKT-VKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSGSRETYNALTNWLADARTLASPNI-AIILCGNKKDLEPDREVTFLEASRFAQEN--ELMFLETSALTGENVEEAFLKCARTILNKIESG---ELDPERMGSGIQYG 196          
BLAST of Ras-related protein Rab-39B vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 136.346 bits (342), Expect = 4.722e-39
Identity = 75/199 (37.69%), Postives = 121/199 (60.80%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP-GP 678
            ++  F+I+LIGDS VGKS+L+  F++ +F+     T+GV+F +R +EI D  RIK Q+WDTAGQE++R+IT +YYR +V A++V+DI+K SS+++   W  E +     N    +I G+K+D+   R V   E++ FA +     L+ ETSA+  +NV+  F  L N +  K+ +++  +L D          + P GP
Sbjct:   10 YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEI-DGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLI-GNKSDLAHLRAVPTEESKTFAQEN--QLLFTETSALNSENVDKAFEELINTIYQKVSKHQM-DLGDSSANGNANGASAPNGP 203          
BLAST of Ras-related protein Rab-39B vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 135.191 bits (339), Expect = 1.180e-38
Identity = 74/199 (37.19%), Postives = 122/199 (61.31%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPE 681
            ++Y F+I+LIGDS VGKS+L+  F+  +F+     T+GV+F +R IE+ +K +IK Q+WDTAGQE++R+IT +YYR +V A++V+DI+K SS+++   W  E +     N    +I G+K+D+   R V   EA++FA +     L+ ETSA+   NV+  F  L   +   + +++    +D  G     MG++  P+
Sbjct:   10 YDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENK-KIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLI-GNKSDLAHLRAVPTDEAKNFAMEN--QMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQ----VDLSGSGTNNMGSNGAPK 200          
BLAST of Ras-related protein Rab-39B vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 128.257 bits (321), Expect = 4.319e-36
Identity = 65/166 (39.16%), Postives = 104/166 (62.65%), Query Frame = 1
Query:   94 QFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQV 591
            +++I+ +G+  VGK+SL+  F    F +    T+G+DF S+ + + DK  I+LQLWDTAGQE+FRS+  SY R+S  A++V+DITKR SF+++ +W ++ K           IVG+K+D+  ERQ+S  E    A   +G  +++ETS   G NV+ +F  +A  +
Sbjct:   10 KYKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKT-IRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAK-LLGAKIFMETSTKAGYNVKALFKKIAKSL 173          
BLAST of Ras-related protein Rab-39B vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 122.479 bits (306), Expect = 4.623e-34
Identity = 77/218 (35.32%), Postives = 122/218 (55.96%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIRLGSYDKSYGCC 726
            ++  ++Y F+++LIG+S VGKS L+  FS+  ++     T+GVDF  + +E+  K  +KLQ+WDTAGQE+FR+IT SYYR S   ++V+D+T + SF+ +  W QE            ++VG+K D++ +R V    A+ FA        ++ETSA+   NVE  F ++A Q    IKE+  Q+ L++      +   D G   L      +   GCC
Sbjct:    1 MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKT-VKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLK-LLVGNKCDLKDKRVVEYDVAKEFA--DANKMPFLETSALDSTNVEDAFLTMARQ----IKESMSQQNLNE----TTQKKEDKGNVNLKGQSLTNTGGGCC 206          
BLAST of Ras-related protein Rab-39B vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 120.939 bits (302), Expect = 2.322e-33
Identity = 68/174 (39.08%), Postives = 107/174 (61.49%), Query Frame = 1
Query:   97 FRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKF 618
             +I+LIGDS VGKS L+  F E KF+     T+G+DF  + ++I  K ++KLQLWDTAGQE+FR+IT +YYR ++  +LV+D+T   +F ++ +W++        +    ++VG+K+DME+ R V+A +    A +      +IE+SA    NV  +F +LA  +  KI  NK 
Sbjct:   21 MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGK-KVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHAN-DEAQLLLVGNKSDMET-RVVTADQGEALAKEL--GIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKL 189          
BLAST of Ras-related protein Rab-39B vs. Ensembl Nematostella
Match: EDO32176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVV1])

HSP 1 Score: 199.134 bits (505), Expect = 6.956e-63
Identity = 102/195 (52.31%), Postives = 138/195 (70.77%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIK 657
            + P + YQFRIILIGDS VGKSSL+R F+EG+F E  DPTVGVDF  R++E+   +RIKLQ+WDTAGQE+FRSIT SYYRN+V  ++++DIT R SF ++++WY+EAK C++     F++VGHK D ES+R VS  E   FA     + ++IETSA    N+E  F S+A +V  +++     EL  + GWDGIK
Sbjct:    1 MKPKYFYQFRIILIGDSTVGKSSLLRQFTEGQFFENSDPTVGVDFHVRVLELKGDVRIKLQIWDTAGQERFRSITYSYYRNTVGCLIIYDITNRDSFVNVMDWYKEAKQCVEEAEVVFMLVGHKIDKESKRVVSTEEGECFA--EAHNMMFIETSAKVLCNIEEAFISVAEEVYKRMERG---ELGLRDGWDGIK 190          
BLAST of Ras-related protein Rab-39B vs. Ensembl Nematostella
Match: EDO36687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU3])

HSP 1 Score: 156.762 bits (395), Expect = 1.284e-46
Identity = 83/198 (41.92%), Postives = 129/198 (65.15%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGP 678
            + Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R+I I  K +IKLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +F+HL  W ++A+     N    +++G+K+D+E+ R V   E   FA +     +++ETSA T  NVE  F + A ++  KI+E  F ++ ++   +GIK+G    P
Sbjct:    3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGK-QIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSSNM-VIMLIGNKSDLEARRDVKKEEGEAFAREH--GLIFMETSAKTAANVEEAFINTAKEIYQKIQEGVF-DINNEA--NGIKLGPQHSP 193          
BLAST of Ras-related protein Rab-39B vs. Ensembl Nematostella
Match: EDO43319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ04])

HSP 1 Score: 156.377 bits (394), Expect = 1.963e-46
Identity = 78/178 (43.82%), Postives = 122/178 (68.54%), Query Frame = 1
Query:   79 PF-FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKE 609
            P+ ++Y F+ I+IGD  VGKS L+  F+E KF   C  T+GV+F +RIIE+  + +IKLQ+WDTAGQE+FR++T+SYYR +  A++V+DIT+RS+++HL  W  +A+     N   F+I G+K+D++++R V+  EA+ FA +     L+ E SA TG+NVE  F   A ++   I++
Sbjct:    6 PYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQ-KIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLI-GNKSDLDAQRDVTYEEAKQFAEEN--GLLFCEASAKTGENVEDAFLETAKKIYQNIQD 179          
BLAST of Ras-related protein Rab-39B vs. Ensembl Nematostella
Match: EDO43047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZT6])

HSP 1 Score: 151.369 bits (381), Expect = 1.693e-44
Identity = 81/209 (38.76%), Postives = 134/209 (64.11%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIRLG 699
            +S  +++ F+ ++IG +  GKS ++  F EGKF +    T+GV+F S+I+ +  K  +KLQ+WDTAGQE+FRS+T+SYYR +  A+LV+DI+ R +F+ L  W  +A+     N    ++VG+K D++++R+V+  EA  FA +   + +++ETSA+TG+NVE  F   +  ++NKI+  +     D+ G  GI+ G DP   + IR G
Sbjct:    1 MSETYDFLFKFLVIGSAGTGKSCILHQFIEGKFKQDSSHTIGVEFGSKIVNVGGK-SVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDISSRETFNSLTNWLTDARTLASPNI-VIILVGNKKDLDADREVTFLEASRFAQEN--ELMFLETSALTGENVEEGFLKCSRTILNKIESGELDP--DRMG-SGIQYG-DPSMRRSIRPG 201          
BLAST of Ras-related protein Rab-39B vs. Ensembl Nematostella
Match: EDO34945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMW9])

HSP 1 Score: 140.969 bits (354), Expect = 1.366e-40
Identity = 77/187 (41.18%), Postives = 119/187 (63.64%), Query Frame = 1
Query:   82 FFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGG 642
            FF+Y F+I+LIGD  VGK+ +V+ F  G F E    T+GVDF  R +++ +K +IKLQ+WDTAGQE+FR+IT+SYYR+    ++ +DITK  +F +++ W ++ +     N    ++VG+K D+E ER+VS  +A + A+   G    +ETSA    N+E  F  LA ++ N+ +E    E +D GG
Sbjct:    9 FFDYLFKIVLIGDPGVGKTCIVQRFRSGTFVERNGSTIGVDFTMRSVQVDNK-KIKLQIWDTAGQERFRTITQSYYRSCNGVIIAYDITKCDTFKNVIRWGEDVQKYAPENAIK-LLVGNKKDLEREREVSLEDAVNCASH-YGMLDVLETSAKDATNIEAAFYRLARELKNRCEEGSGLENIDDGG 192          
BLAST of Ras-related protein Rab-39B vs. Ensembl Medaka
Match: ENSORLT00000010480.2 (RAB39B, member RAS oncogene family [Source:NCBI gene;Acc:101157815])

HSP 1 Score: 197.978 bits (502), Expect = 3.546e-62
Identity = 96/200 (48.00%), Postives = 139/200 (69.50%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            +   + YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++ +W +EA+  ++ +   F++VGHK D+E++RQV+ +EA   +        YIETSA    NVE  F+ L   + + ++     ++  Q GW+G+K G  P
Sbjct:    1 MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIETGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHDWLEEARSHVQPHTIVFMLVGHKCDLETQRQVTQQEAEKLSGAY--GMRYIETSARDAINVEHAFTELTRDIFDLVRSG---DITIQEGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. Ensembl Medaka
Match: rab42a (ras-related protein Rab-39B [Source:NCBI gene;Acc:101162224])

HSP 1 Score: 196.052 bits (497), Expect = 2.033e-61
Identity = 94/197 (47.72%), Postives = 136/197 (69.04%), Query Frame = 1
Query:   73 LSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMG 663
            +   + YQFRIIL+GDS VGKSSL++ F++G +S++ DPTVGVDF++R ++I   ++IKLQLWDTAGQE+FRSIT SYYRNSV  +LVFD+T R +FDH+ EW++E    +  +   ++++GHK+D++ +R+VS  EA   A + +G   Y+ETSA    NVE  F  L   +   +   K  E+  + GWDG+K G
Sbjct:    1 MDALWQYQFRIILLGDSTVGKSSLLKRFTDGIYSDVADPTVGVDFYARSLDIEPGVKIKLQLWDTAGQERFRSITTSYYRNSVGGLLVFDLTNRKTFDHVREWHKEVSEHILPHHMVYILIGHKSDLQKDRKVSRDEAEQLAAE-LG-IRYVETSAKCNSNVERAFELLTRDIYELM---KMGEIETRDGWDGVKSG 192          
BLAST of Ras-related protein Rab-39B vs. Ensembl Medaka
Match: RAB39B (ras-related protein Rab-39B [Source:NCBI gene;Acc:101174040])

HSP 1 Score: 195.282 bits (495), Expect = 3.866e-61
Identity = 96/194 (49.48%), Postives = 133/194 (68.56%), Query Frame = 1
Query:   91 YQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++  W +EA+  ++ +   F++VGHK D+E++RQV+  EA   A        Y+ETSA    NVE  F  L   +   ++     ++  Q GW+G+K G  P
Sbjct:    7 YQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHNWLEEARSHVQPHSIVFLLVGHKCDLEAQRQVTQHEAEKLAGAY--GMRYVETSARDAINVEKAFVDLTRDIFELVRNG---DIKIQDGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. Ensembl Medaka
Match: RAB39B (ras-related protein Rab-39B [Source:NCBI gene;Acc:101174040])

HSP 1 Score: 195.282 bits (495), Expect = 3.866e-61
Identity = 96/194 (49.48%), Postives = 133/194 (68.56%), Query Frame = 1
Query:   91 YQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDP 672
            YQFR+I+IGDS VGKS L+R F+EG+F+++ DPTVGVDFFSR++EI    RIKLQ+WDTAGQE+FRSIT++YYRNSV  +L+FDIT R SF ++  W +EA+  ++ +   F++VGHK D+E++RQV+  EA   A        Y+ETSA    NVE  F  L   +   ++     ++  Q GW+G+K G  P
Sbjct:    7 YQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHNWLEEARSHVQPHSIVFLLVGHKCDLEAQRQVTQHEAEKLAGAY--GMRYVETSARDAINVEKAFVDLTRDIFELVRNG---DIKIQDGWEGVKSGFVP 195          
BLAST of Ras-related protein Rab-39B vs. Ensembl Medaka
Match: si:dkey-34d22.5 (RAB42, member RAS oncogene family [Source:NCBI gene;Acc:101168571])

HSP 1 Score: 172.94 bits (437), Expect = 1.947e-52
Identity = 92/192 (47.92%), Postives = 122/192 (63.54%), Query Frame = 1
Query:   82 FFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIK 657
             + YQFRII++GDS VGKSSL++ ++E  F E  + TVGVDF+   +E+   +R+KLQ WDTAGQE+FRS+T+SYYRNSV  +LVFD+T R SFDH+ EW+ E +  ++ +   FV+VG K+D   ER VS  EA   A        Y+E SA TG NV   F  L  +V   +      E+  Q GWDGIK
Sbjct:    5 LWQYQFRIIMLGDSTVGKSSLLKRYTEDLFLESINQTVGVDFYVSFLEVEPGVRVKLQFWDTAGQERFRSVTRSYYRNSVGGLLVFDMTNRDSFDHIKEWHDEVRERVQPHKVLFVLVGQKSD--RERVVSREEAEKLAGQL--GLPYVEASAKTGHNVRECFELLTRRVYQGLLSG---EVELQEGWDGIK 189          
BLAST of Ras-related protein Rab-39B vs. Planmine SMEST
Match: SMESG000056866.1 (SMESG000056866.1)

HSP 1 Score: 456.833 bits (1174), Expect = 3.881e-164
Identity = 219/219 (100.00%), Postives = 219/219 (100.00%), Query Frame = 1
Query:   70 MLSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIRLGSYDKSYGCC 726
            MLSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIRLGSYDKSYGCC
Sbjct:    1 MLSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIRLGSYDKSYGCC 219          
BLAST of Ras-related protein Rab-39B vs. Planmine SMEST
Match: SMESG000056866.1 (SMESG000056866.1)

HSP 1 Score: 419.853 bits (1078), Expect = 9.363e-150
Identity = 201/201 (100.00%), Postives = 201/201 (100.00%), Query Frame = 1
Query:  124 MVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIRLGSYDKSYGCC 726
            MVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIRLGSYDKSYGCC
Sbjct:    1 MVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTDPGPEQLIRLGSYDKSYGCC 201          
BLAST of Ras-related protein Rab-39B vs. Planmine SMEST
Match: SMESG000076159.1 (SMESG000076159.1)

HSP 1 Score: 156.762 bits (395), Expect = 2.732e-46
Identity = 89/217 (41.01%), Postives = 134/217 (61.75%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLD-QGGWDGIKMGTDPGPE-QLIRLG-SYDKSYGCC 726
            ++Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R+I I  K ++KLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +F+HL  W ++A+     N    +++G+K+D+E+ R V   E   FA +     +++ETSA T  NVE  F + A  +  KI+E     +LD     +GIK+G    P      LG +   S GCC
Sbjct:    3 YSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGK-QVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSSSNM-VIMLIGNKSDLEARRDVKREEGEAFAREH--GLVFMETSAKTAANVEEAFINTAKAIYEKIQEG----VLDINNEANGIKLGPQHTPSGSTAGLGQNRSSSGGCC 211          
BLAST of Ras-related protein Rab-39B vs. Planmine SMEST
Match: SMESG000017457.1 (SMESG000017457.1)

HSP 1 Score: 154.066 bits (388), Expect = 2.718e-45
Identity = 83/196 (42.35%), Postives = 127/196 (64.80%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLD-QGGWDGIKMGTD 669
            ++Y F+ I+IGD+ VGKS L+  F++ +F  + D T+GV+F +R+I I  K ++KLQ+WDTAGQE FRSIT+SYYR +  A+LV+DIT+R +FDHL  W ++A+     N    +++G+K+D+E+ R V   E   FA +     +++ETSA T  NVE  F + A  +  KI+E     +LD     +GIK+G +
Sbjct:    3 YSYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGK-QVKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFDHLTTWLEDARQHSSSNM-VIMLIGNKSDLENRRDVKREEGESFAHEH--GLVFMETSAKTALNVEEAFINTAKAIYGKIQEG----VLDINNEANGIKLGPN 190          
BLAST of Ras-related protein Rab-39B vs. Planmine SMEST
Match: SMESG000043454.1 (SMESG000043454.1)

HSP 1 Score: 152.91 bits (385), Expect = 5.987e-45
Identity = 86/194 (44.33%), Postives = 124/194 (63.92%), Query Frame = 1
Query:   85 FNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRIIEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDHLLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDCLYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGT 666
            + + F+ I+IGD+ VGKS L+  F++ +F +  D T+GV+F  R I I DK   KLQ+WDTAGQE FRSIT+SYYR S AA+LV+DITK+ +F  +L W ++A+     N    +++G+K+D+ESERQVS  E   F+ +     L++ETSA T  NV+  F   AN +  KI++       + G   GIK+GT
Sbjct:    3 YAFLFKFIIIGDTGVGKSCLLLQFTDKRFQQTHDMTIGVEFGVRTITI-DKSLTKLQVWDTAGQEAFRSITRSYYRGSAAALLVYDITKKETFTSVLSWLEDARQNASSNLVV-ILIGNKSDLESERQVSTYEGEAFSKE--HGLLFLETSAKTCDNVDEAFIITANHIYQKIQDGTINCENETG---GIKLGT 189          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-39B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB39B7.528e-6350.00RAB39B, member RAS oncogene family [Source:HGNC Sy... [more]
RAB39A6.046e-6253.03RAB39A, member RAS oncogene family [Source:HGNC Sy... [more]
RAB142.974e-4843.58RAB14, member RAS oncogene family [Source:HGNC Sym... [more]
RAB147.925e-4838.86RAB14, member RAS oncogene family [Source:HGNC Sym... [more]
RAB2A8.257e-4643.01RAB2A, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-391.240e-6551.52RAB family [Source:UniProtKB/TrEMBL;Acc:Q18969][more]
rab-142.613e-4745.25RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874][more]
rab-142.613e-4745.25RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874][more]
unc-1083.839e-4641.41pep chromosome:WBcel235:I:3824947:3826514:1 gene:W... [more]
unc-1084.931e-4641.41pep chromosome:WBcel235:I:3822883:3826514:1 gene:W... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab391.623e-6550.75gene:FBgn0029959 transcript:FBtr0307272[more]
Rab391.623e-6550.75gene:FBgn0029959 transcript:FBtr0071072[more]
Rab144.194e-5045.05gene:FBgn0015791 transcript:FBtr0343678[more]
Rab144.194e-5045.05gene:FBgn0015791 transcript:FBtr0080626[more]
Rab141.616e-4945.05gene:FBgn0015791 transcript:FBtr0080627[more]
back to top
BLAST of Ras-related protein Rab-39B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab39bb1.112e-6351.55RAB39B, member RAS oncogene family b [Source:ZFIN;... [more]
rab39ba7.876e-6351.03RAB39B, member RAS oncogene family a [Source:ZFIN;... [more]
rab42a1.413e-6148.22RAB42, member RAS oncogene family a [Source:ZFIN;A... [more]
rab42b6.760e-5244.50RAB42, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab141.102e-4742.31RAB14, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr6a14.286e-6351.55nuclear receptor subfamily 6 group A member 1 [Sou... [more]
RAB2A1.382e-4542.00RAB2A, member RAS oncogene family [Source:NCBI gen... [more]
hus11.504e-4541.07HUS1 checkpoint clamp component [Source:Xenbase;Ac... [more]
olfml2b8.070e-4439.66olfactomedin like 2B [Source:Xenbase;Acc:XB-GENE-9... [more]
map41.633e-4338.24microtubule associated protein 4 [Source:Xenbase;A... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab392.935e-6354.04RAB39, member RAS oncogene family [Source:MGI Symb... [more]
Rab39b4.740e-6350.00RAB39B, member RAS oncogene family [Source:MGI Sym... [more]
Rab145.441e-4838.86RAB14, member RAS oncogene family [Source:MGI Symb... [more]
Rab423.223e-4740.37RAB42, member RAS oncogene family [Source:MGI Symb... [more]
Rab2a4.112e-4643.01RAB2A, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BHD0|RB39A_MOUSE2.053e-6254.04Ras-related protein Rab-39A OS=Mus musculus OX=100... [more]
sp|Q8BHC1|RB39B_MOUSE3.315e-6250.00Ras-related protein Rab-39B OS=Mus musculus OX=100... [more]
sp|Q96DA2|RB39B_HUMAN3.615e-6250.00Ras-related protein Rab-39B OS=Homo sapiens OX=960... [more]
sp|Q17QU4|RB39B_BOVIN1.268e-6149.50Ras-related protein Rab-39B OS=Bos taurus OX=9913 ... [more]
sp|Q14964|RB39A_HUMAN2.904e-6153.03Ras-related protein Rab-39A OS=Homo sapiens OX=960... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PR493.427e-7956.19Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0V0J9793.537e-7654.01Uncharacterized protein OS=Schistocephalus solidus... [more]
Q86EN05.333e-7655.33RAB39, member RAS oncogene family OS=Schistosoma j... [more]
A0A430Q3C12.664e-7555.33Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
V4AZJ33.025e-7552.73Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab39ba2.998e-6350.52ras-related protein Rab-39B [Source:NCBI gene;Acc:... [more]
ENSAMXT00000003791.21.569e-6250.00ras-related protein Rab-39B-like [Source:NCBI gene... [more]
rab42a5.498e-6249.48ras-related protein Rab-39B-like [Source:NCBI gene... [more]
rab42b5.310e-5344.85ras-related protein Rab-39B [Source:NCBI gene;Acc:... [more]
rab42b5.310e-5344.85ras-related protein Rab-39B [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB2B9.646e-4941.10RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
ENSPMAT00000002219.13.683e-4840.80pep scaffold:Pmarinus_7.0:GL483980:50:9020:-1 gene... [more]
rab2a8.201e-4739.63RAB2A, member RAS oncogene family [Source:ZFIN;Acc... [more]
RAB2B1.762e-4543.26RAB2B, member RAS oncogene family [Source:HGNC Sym... [more]
rab4b1.321e-3938.66RAB4B, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT314.722e-3937.69Rab family GTPase; involved in the exocytic pathwa... [more]
YPT321.180e-3837.19Rab family GTPase involved in the exocytic pathway... [more]
YPT64.319e-3639.16Rab family GTPase; required for endosome-to-Golgii... [more]
YPT14.623e-3435.32Rab family GTPase; involved in the ER-to-Golgi ste... [more]
SEC42.322e-3339.08Rab family GTPase; essential for vesicle-mediated ... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO321766.956e-6352.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366871.284e-4641.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433191.963e-4643.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430471.693e-4438.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349451.366e-4041.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000010480.23.546e-6248.00RAB39B, member RAS oncogene family [Source:NCBI ge... [more]
rab42a2.033e-6147.72ras-related protein Rab-39B [Source:NCBI gene;Acc:... [more]
RAB39B3.866e-6149.48ras-related protein Rab-39B [Source:NCBI gene;Acc:... [more]
RAB39B3.866e-6149.48ras-related protein Rab-39B [Source:NCBI gene;Acc:... [more]
si:dkey-34d22.51.947e-5247.92RAB42, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-39B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056866.13.881e-164100.00SMESG000056866.1[more]
SMESG000056866.19.363e-150100.00SMESG000056866.1[more]
SMESG000076159.12.732e-4641.01SMESG000076159.1[more]
SMESG000017457.12.718e-4542.35SMESG000017457.1[more]
SMESG000043454.15.987e-4544.33SMESG000043454.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012555 ID=SMED30012555|Name=Ras-related protein Rab-39B|organism=Schmidtea mediterranea sexual|type=transcript|length=1006bp
GTTTAATTTAATTTTTTTGGAATCACATGATAAAATTATAAATTAATTTA
AGTTATAAAATTTTTTAACATGTTAAGTCCATTTTTTAATTATCAATTTC
GAATTATTTTAATTGGTGATAGCATGGTTGGAAAATCATCTTTAGTTCGA
TGTTTTAGTGAAGGAAAATTCAGTGAAATATGTGATCCCACTGTGGGTGT
TGATTTTTTTTCTAGAATTATTGAAATACCAGATAAAATAAGAATTAAAT
TACAACTATGGGATACAGCAGGTCAAGAAAAATTTAGATCGATAACTAAA
TCATATTACCGAAATTCAGTTGCTGCTGTTCTCGTATTTGATATAACAAA
AAGAAGTTCTTTTGATCATTTATTGGAGTGGTATCAAGAGGCCAAATTAT
GTATGAAATGCAATTGTCCGACGTTTGTAATAGTCGGACATAAAGCTGAC
ATGGAATCAGAAAGACAAGTTAGTGCCAGAGAAGCGAGACATTTTGCTAC
AGATACGATTGGGGATTGCTTGTATATTGAAACTTCAGCAGTTACTGGAC
AAAATGTTGAAATTGTGTTTAGTAGTTTAGCTAATCAAGTTGTTAATAAA
ATTAAAGAAAACAAATTTCAAGAATTATTGGATCAGGGTGGTTGGGATGG
AATAAAGATGGGTACTGATCCGGGACCTGAACAGTTAATACGATTAGGAT
CGTATGATAAATCCTATGGTTGTTGCTGATATTTTCGCTGTGGTATATAC
ACATTTTGTAAATGATCTCATTTTTAATGTTTCCTTTGATATAATATATT
TATCATTGATTTGTAAAGTTTTAATCGTATTTATAGTAAAACGCTTATGT
GGAATTATTTGCTATTAAATTATTGTAATTAATTTTAAGTATTTTAGAAA
ACTTTTGTATAAGGATGCTCTATACTTGTAGTTTGAGTCGATTTTATAAT
TAACATTTTGAACTGCTGTTTTTGATAATGTCCGTTTTTTGTTATGACTT
CCGGTG
back to top

protein sequence of SMED30012555-orf-1

>SMED30012555-orf-1 ID=SMED30012555-orf-1|Name=SMED30012555-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=220bp
MLSPFFNYQFRIILIGDSMVGKSSLVRCFSEGKFSEICDPTVGVDFFSRI
IEIPDKIRIKLQLWDTAGQEKFRSITKSYYRNSVAAVLVFDITKRSSFDH
LLEWYQEAKLCMKCNCPTFVIVGHKADMESERQVSAREARHFATDTIGDC
LYIETSAVTGQNVEIVFSSLANQVVNKIKENKFQELLDQGGWDGIKMGTD
PGPEQLIRLGSYDKSYGCC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006909phagocytosis
GO:0006970response to osmotic stress
GO:0008219cell death
GO:0030587sorocarp development
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005886plasma membrane
GO:0016020membrane
GO:0031164contractile vacuolar membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 33..49
score: 32.27
coord: 115..128
score: 30.66
coord: 52..74
score: 47.05
coord: 10..31
score: 40.75
coord: 152..174
score: 38.66
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 10..177
e-value: 4.7E-70
score: 248.7
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 12..177
e-value: 3.6E-13
score: 48.6
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 15..216
e-value: 2.1E-4
score: 13.7
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 7..177
e-value: 2.7E-21
score: 86.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 6..187
e-value: 1.8E-58
score: 199.0
NoneNo IPR availablePANTHERPTHR24073:SF916RAS-RELATED PROTEIN RAB-39Bcoord: 6..198
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 6..198
NoneNo IPR availablePROSITEPS51419RABcoord: 5..219
score: 30.293
IPR001806Small GTPasePFAMPF00071Rascoord: 11..175
e-value: 4.2E-50
score: 169.5
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 8..168
e-value: 2.5E-23
score: 80.6
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 7..182