Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30012544
Length (bp)1035
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30012544) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30012544) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin (SMED30012544) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin (SMED30012544) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012544

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30012544SMESG000078683.1 dd_Smed_v4_1003_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012544SMESG000078683.1 dd_Smed_v4_1003_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30012544SMESG000078683.1 dd_Smed_v6_1003_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012544SMESG000078683.1 OX_Smed_1.0.08024ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30012544SMESG000078683.1 dd_Smed_v4_1003_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30012544SMESG000078683.1 dd_Smed_v4_1003_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN5 (tetraspanin 5 [Source:HGNC Symbol;Acc:HGNC:17753])

HSP 1 Score: 67.3958 bits (163), Expect = 3.533e-12
Identity = 61/197 (30.96%), Postives = 93/197 (47.21%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFN---EFNEWKSSNVT----GNPIACCQFRPT 695
            KY + G N+IF+ + +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD+N    FN    SN +    G P +CC   P 
Sbjct:   16 KYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEY------WQCCGAFGADDWNLNIYFNC-TDSNASRERCGVPFSCCTKDPA 192          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN5 (tetraspanin 5 [Source:HGNC Symbol;Acc:HGNC:17753])

HSP 1 Score: 56.9954 bits (136), Expect = 4.982e-10
Identity = 31/89 (34.83%), Postives = 49/89 (55.06%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILL 392
            KY + G N+IF+ + +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL
Sbjct:    7 KYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLL 82          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN5 (tetraspanin 5 [Source:HGNC Symbol;Acc:HGNC:17753])

HSP 1 Score: 59.3066 bits (142), Expect = 7.972e-10
Identity = 34/96 (35.42%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILL-YIYVFL 410
            KY + G N+IF+ + +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL +  VFL
Sbjct:   16 KYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFL 98          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN17 (tetraspanin 17 [Source:HGNC Symbol;Acc:HGNC:13594])

HSP 1 Score: 59.3066 bits (142), Expect = 2.902e-9
Identity = 62/204 (30.39%), Postives = 96/204 (47.06%), Query Frame = 3
Query:  123 AKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLEN----YK-DLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFN--------EFNEWKSSNVTGNPIACCQFRPT 695
             KY L G N++F+++    L IG+W   +K V+S IS++    G            +D + +  +V+G +  V+GF GC GA++EN  LL  +   +  I  L+LA  I+A V K+ I     R   N+F+ N    Y+ D++  N   F Q +        CCGA G +D+N        + N   S    G P +CC   P 
Sbjct:   17 GKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISALTDLGG------------LDPVWL-FVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI-----RDQLNLFINNNVKAYRDDIDLQNLIDFAQEY------WSCCGARGPNDWNLNIYFNCTDLN--PSRERCGVPFSCCVRDPA 194          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN17 (tetraspanin 17 [Source:HGNC Symbol;Acc:HGNC:13594])

HSP 1 Score: 59.3066 bits (142), Expect = 3.107e-9
Identity = 62/204 (30.39%), Postives = 96/204 (47.06%), Query Frame = 3
Query:  123 AKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLEN----YK-DLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFN--------EFNEWKSSNVTGNPIACCQFRPT 695
             KY L G N++F+++    L IG+W   +K V+S IS++    G            +D + +  +V+G +  V+GF GC GA++EN  LL  +   +  I  L+LA  I+A V K+ I     R   N+F+ N    Y+ D++  N   F Q +        CCGA G +D+N        + N   S    G P +CC   P 
Sbjct:   17 GKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISALTDLGG------------LDPVWL-FVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI-----RDQLNLFINNNVKAYRDDIDLQNLIDFAQEY------WSCCGARGPNDWNLNIYFNCTDLN--PSRERCGVPFSCCVRDPA 194          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-6 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:G4RWX0])

HSP 1 Score: 64.6994 bits (156), Expect = 7.556e-12
Identity = 46/178 (25.84%), Postives = 92/178 (51.69%), Query Frame = 3
Query:  117 KFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSS 650
            K  KY    +N +FF++   ++G+ IW+ VDK+ ++ ++S +K D S   +  V++  ++      +VIG   LV+GF GCCG+  E+   + IY  LV  +  +++  I++  V K  + +  +  +++  +  Y     ++     Q    +   L+CCGA+G  D+  +  + +S
Sbjct:    8 KCVKYFFWLINFLFFVLGAIIVGLSIWMLVDKNSLNTVASTVKVDLS-QILSQVNIQQLNSFLYVAIVIGGALLVLGFFGCCGSCCESICAISIYFILVLILFVVEVVAIVLYFVNKTNLQQGFQTIWRDELVSKYNTQQQIH-----QVLDQIQSSLQCCGASGCSDYIPYGAFPTS 179          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-11 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526])

HSP 1 Score: 58.151 bits (139), Expect = 1.726e-9
Identity = 66/212 (31.13%), Postives = 92/212 (43.40%), Query Frame = 3
Query:  102 MSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRIS-SMLKADGSVHAIG--DVSV--SLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLN-------SVNPN---FFTQSFSMLMIQLKCCGATGRDDFNEFNE--WKSSNVTGN--PIACC 680
            +S   +  K+ L   NL+F L  L  LGIG+WL +DK  +  ++ +  K  G     G  D++   + V      L V G I +V+ F GCCGA KE + LL  Y    S  + L LAI I A +         E  F++I   + K  N       S NP        ++  +MI+  CCG   +    EFN   W   N      P ACC
Sbjct:   11 LSCTARALKFSLFIFNLVFLLCGLICLGIGLWLVLDKYAIDNLAFATAKVQGYDQDAGLRDLATKPTAVRQFGYLLFVGGFIVIVVAFLGCCGAAKEWRPLLCCY----SSCLMLILAIQIAATIYAFLHSHMFENDFRDILHSSLKMYNGTDNMKVSNNPQDGLLVKTAWDKIMIEKSCCGVDSK--IGEFNNSGWYQLNHGRYQFPPACC 216          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-11 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526])

HSP 1 Score: 58.151 bits (139), Expect = 1.726e-9
Identity = 66/212 (31.13%), Postives = 92/212 (43.40%), Query Frame = 3
Query:  102 MSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRIS-SMLKADGSVHAIG--DVSV--SLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLN-------SVNPN---FFTQSFSMLMIQLKCCGATGRDDFNEFNE--WKSSNVTGN--PIACC 680
            +S   +  K+ L   NL+F L  L  LGIG+WL +DK  +  ++ +  K  G     G  D++   + V      L V G I +V+ F GCCGA KE + LL  Y    S  + L LAI I A +         E  F++I   + K  N       S NP        ++  +MI+  CCG   +    EFN   W   N      P ACC
Sbjct:   11 LSCTARALKFSLFIFNLVFLLCGLICLGIGLWLVLDKYAIDNLAFATAKVQGYDQDAGLRDLATKPTAVRQFGYLLFVGGFIVIVVAFLGCCGAAKEWRPLLCCY----SSCLMLILAIQIAATIYAFLHSHMFENDFRDILHSSLKMYNGTDNMKVSNNPQDGLLVKTAWDKIMIEKSCCGVDSK--IGEFNNSGWYQLNHGRYQFPPACC 216          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-13 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q9NET3])

HSP 1 Score: 56.6102 bits (135), Expect = 7.182e-9
Identity = 45/175 (25.71%), Postives = 79/175 (45.14%), Query Frame = 3
Query:  120 FAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVS--LMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNE 638
            +AKY +   N++F +V   LL +G+WL+ D    + IS   +      A+ +       + A S  ++V+GA+ +V+   GCCG    ++  L IY  +V  ++   L+  I    KK+ +   +     N  +++Y       P    +S   L    +CCG  G  DF  F +
Sbjct:   56 WAKYGIFTANIVFLIVGGLLLAMGVWLRTDSRFRNFISERYR-----QAVQEAFWEAPTLFAFSYIIIVLGAVMMVVAMLGCCGITGRSRPFLIIYSMVVFLLLVATLSCGIYLLYKKDGLDVELSDAL-NYMVQHYYQ----GPGVVQESLDHLQTAFRCCGNAGCSDFRVFRQ 220          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076507)

HSP 1 Score: 66.6254 bits (161), Expect = 3.215e-12
Identity = 75/248 (30.24%), Postives = 106/248 (42.74%), Query Frame = 3
Query:  123 AKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIY-VFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQS--FSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGN---PIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIAN-KESESVNKIGCVTHLWEVLSKKTK 845
            AKY+L   N IFF++   + G+G+WL VDK     + ++LK   S           ++ LA  L+VIGA+   + F G  GAM+E++ LL  Y  FL+     L L   IVA          +  + KN FL+      S+  N    S  ++ LM    CCG     DF+    W   N  GN   P ACC  +   KL                D +C  N  +S S  K GC     E L ++ +
Sbjct:   10 AKYLLCIFNFIFFVLGTIIFGVGLWLAVDK---HSLIALLKLVESERIEQFTQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLI-----LLLIAEIVAGGLGAFFKDKVRAESKN-FLQTTITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAW--VNGKGNRTIPDACCILKDVAKLVPR-------------DEDCTTNPSDSNSFYKKGCYEVFTEWLIRQRE 233          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076506)

HSP 1 Score: 66.6254 bits (161), Expect = 3.215e-12
Identity = 75/248 (30.24%), Postives = 106/248 (42.74%), Query Frame = 3
Query:  123 AKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIY-VFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQS--FSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGN---PIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIAN-KESESVNKIGCVTHLWEVLSKKTK 845
            AKY+L   N IFF++   + G+G+WL VDK     + ++LK   S           ++ LA  L+VIGA+   + F G  GAM+E++ LL  Y  FL+     L L   IVA          +  + KN FL+      S+  N    S  ++ LM    CCG     DF+    W   N  GN   P ACC  +   KL                D +C  N  +S S  K GC     E L ++ +
Sbjct:   10 AKYLLCIFNFIFFVLGTIIFGVGLWLAVDK---HSLIALLKLVESERIEQFTQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLI-----LLLIAEIVAGGLGAFFKDKVRAESKN-FLQTTITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAW--VNGKGNRTIPDACCILKDVAKLVPR-------------DEDCTTNPSDSNSFYKKGCYEVFTEWLIRQRE 233          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076508)

HSP 1 Score: 66.6254 bits (161), Expect = 3.215e-12
Identity = 75/248 (30.24%), Postives = 106/248 (42.74%), Query Frame = 3
Query:  123 AKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIY-VFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQS--FSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGN---PIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIAN-KESESVNKIGCVTHLWEVLSKKTK 845
            AKY+L   N IFF++   + G+G+WL VDK     + ++LK   S           ++ LA  L+VIGA+   + F G  GAM+E++ LL  Y  FL+     L L   IVA          +  + KN FL+      S+  N    S  ++ LM    CCG     DF+    W   N  GN   P ACC  +   KL                D +C  N  +S S  K GC     E L ++ +
Sbjct:   10 AKYLLCIFNFIFFVLGTIIFGVGLWLAVDK---HSLIALLKLVESERIEQFTQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLI-----LLLIAEIVAGGLGAFFKDKVRAESKN-FLQTTITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAW--VNGKGNRTIPDACCILKDVAKLVPR-------------DEDCTTNPSDSNSFYKKGCYEVFTEWLIRQRE 233          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp26A (gene:FBgn0031760 transcript:FBtr0332600)

HSP 1 Score: 56.9954 bits (136), Expect = 4.922e-9
Identity = 56/209 (26.79%), Postives = 96/209 (45.93%), Query Frame = 3
Query:   96 RKMSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIY-VFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYK-DLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVT-------GNPIACCQFRPT 695
            R+ S I    KY+L   N+I +L +L +L +GIW   +K +   I+ +       H I       +D  A  L+++G +T ++GF G  GA++EN  LL  Y +FL   ++       +   +K +   K    +    F+ +Y+ D +  N   + Q        L+CCG  G  D++  N +  S++        G P +CC+ RP 
Sbjct:   10 RETSEISCCLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARL-------HFIA------LDP-AFVLIILGGVTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDADQQNLIDWIQE-----DWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQ 199          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp26A (gene:FBgn0031760 transcript:FBtr0113024)

HSP 1 Score: 56.9954 bits (136), Expect = 6.409e-9
Identity = 56/209 (26.79%), Postives = 96/209 (45.93%), Query Frame = 3
Query:   96 RKMSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIY-VFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYK-DLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVT-------GNPIACCQFRPT 695
            R+ S I    KY+L   N+I +L +L +L +GIW   +K +   I+ +       H I       +D  A  L+++G +T ++GF G  GA++EN  LL  Y +FL   ++       +   +K +   K    +    F+ +Y+ D +  N   + Q        L+CCG  G  D++  N +  S++        G P +CC+ RP 
Sbjct:   10 RETSEISCCLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARL-------HFIA------LDP-AFVLIILGGVTFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHYREDADQQNLIDWIQE-----DWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQ 199          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan5a (tetraspanin 5a [Source:ZFIN;Acc:ZDB-GENE-041010-145])

HSP 1 Score: 69.3218 bits (168), Expect = 4.997e-13
Identity = 67/237 (28.27%), Postives = 105/237 (44.30%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHL 818
            KY + G N+IF+L+ +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   I+A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD      FN  +   S    G P +CC   P      + + N +   D    P+    ++   ++  GCV   
Sbjct:   16 KYFIFGFNIIFWLLGVAFLGIGLWAWSEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGILAFVFKDWIKDQLNFFINNNIRAYRDDIDLQNLIDFTQEY------WECCGAFGADDWNLNIYFNCTDSNPSREKCGVPFSCCTKDPA-----EDVINTQCGYDVRAKPDA---EQKTYIHVKGCVPQF 225          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan17 (tetraspanin 17 [Source:ZFIN;Acc:ZDB-GENE-030131-3673])

HSP 1 Score: 67.0106 bits (162), Expect = 2.800e-12
Identity = 71/240 (29.58%), Postives = 103/240 (42.92%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFN--------EFNEWKSSNVTGNPIACCQFRPT-------------LKLSLDSLKN----------EKNLLDNLV 752
            KY L G N+IF+L+    LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   I+A V K+ I   +     N       D++  N   F Q +        CCGA G +D+N        +FN   S    G P +CC   P              L++ LD  K           EK L DNL+
Sbjct:   18 KYFLFGFNIIFWLLGAAFLGIGLWAWAEKGVLSNISSITDLGG------------FDPVWL-FIVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGLIFFLELTAGILAFVFKDWIKDQLNFFINNNVKAYRDDIDLQNLIDFAQEY------WSCCGAHGPNDWNLNIYFNCTDFN--PSRERCGVPFSCCVKDPAEDVLNTQCGYDVRLQVELDQQKYIYTKGCVGQFEKWLQDNLI 236          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd151l (CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-040426-1868])

HSP 1 Score: 62.7734 bits (151), Expect = 3.574e-11
Identity = 47/189 (24.87%), Postives = 91/189 (48.15%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKS-VVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGN--PIACCQ 683
            KY+L   N +F+L  + ++ +GIW  ++KS  +S +SS       ++A+           A  L++ G I ++ G  GCC   KE + LL +Y  L+  I  L++   ++A +  ++++  ++   +   ++ Y   N       T++   L  + KCCG+    D+ +    +SS   G   P +CC+
Sbjct:   17 KYLLFTFNFLFWLAGVAVMAVGIWTVIEKSDYISLLSS------KIYAVS----------AYILIMAGVIVMITGVLGCCATFKEQRRLLRVYFVLLLCIFLLEILAGVLAYIYYQQLNDELKENLRETMVQKY---NQSEQEHVTKAVDKLQQEFKCCGSNSSSDWVDSAWIRSSEADGRLVPDSCCK 186          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan9a (tetraspanin 9a [Source:ZFIN;Acc:ZDB-GENE-060503-632])

HSP 1 Score: 63.1586 bits (152), Expect = 8.964e-11
Identity = 57/186 (30.65%), Postives = 95/186 (51.08%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGNPIACCQ 683
            KY++   NLIF+L    LLG+GIWL V +   +  S               S+S  +M+    + IGAI +V GF GC GA+KENK LL  +  ++  I+  +L ++I+  V  +K+ +  ++  K+  L  Y   N++       +++++  + KCCG TG  D+++  + K       P  CCQ
Sbjct:  107 KYMMFVFNLIFWLCGCGLLGVGIWLSVSQGSFATFSPSFP-----------SLSAANMV----IAIGAIVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILLILFFVYSDKVSENAKQDLKDG-LALYNTDNNIG---LRNAWNIIQAEWKCCGVTGYTDWHDALKEKVV-----PDRCCQ 268          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan9a (tetraspanin 9a [Source:ZFIN;Acc:ZDB-GENE-060503-632])

HSP 1 Score: 62.003 bits (149), Expect = 1.166e-10
Identity = 57/186 (30.65%), Postives = 95/186 (51.08%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGNPIACCQ 683
            KY++   NLIF+L    LLG+GIWL V +   +  S               S+S  +M+    + IGAI +V GF GC GA+KENK LL  +  ++  I+  +L ++I+  V  +K+ +  ++  K+  L  Y   N++       +++++  + KCCG TG  D+++  + K       P  CCQ
Sbjct:   10 KYMMFVFNLIFWLCGCGLLGVGIWLSVSQGSFATFSPSFP-----------SLSAANMV----IAIGAIVMVTGFLGCLGAIKENKCLLLSFFIVLLIILLAELILLILFFVYSDKVSENAKQDLKD-GLALYNTDNNIG---LRNAWNIIQAEWKCCGVTGYTDWHDALKEKVV-----PDRCCQ 171          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: rergl (RERG/RAS-like [Source:Xenbase;Acc:XB-GENE-6037390])

HSP 1 Score: 72.0182 bits (175), Expect = 6.970e-14
Identity = 66/237 (27.85%), Postives = 106/237 (44.73%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHL 818
            KY + G N+IF+L+ +  LG+G+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ I   ++    N       D++  N   FTQ +       +CCGA G DD      FN  +   S    G P +CC   P      + + N +   D    P      + E+++  GCV   
Sbjct:   16 KYFIFGFNVIFWLLGITFLGVGLWAWSEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLQFFINNNIRAYRDDIDLQNLIDFTQEY------WQCCGAFGADDWNLNIYFNCTDANASRERCGVPFSCCTKDPA-----EDVINTQCGYDVRQKPEL---DQQETIHTKGCVPQF 225          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: tspan17 (tetraspanin 17 [Source:NCBI gene;Acc:448429])

HSP 1 Score: 62.7734 bits (151), Expect = 1.178e-10
Identity = 60/196 (30.61%), Postives = 87/196 (44.39%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPT 695
            KY L G N++F+L+    L IG+W   +K V+S ISS+    G             D + +  +V GA+  V+GF GC GA++EN  LL  +   +  I  L+L   I+A V K+ I   +     N       D++  N   F Q +        CCGA G +D      FN  +   S    G P +CC   P 
Sbjct:   18 KYFLFGFNIVFWLLGAAFLAIGLWAWAEKGVLSNISSITDLGG------------FDPVWL-FIVTGAVMFVLGFAGCIGALRENTTLLKFFSVFLGLIFFLELTAGILAFVFKDWIKDQLNFFINNNVKAYRDDIDLQNLIDFAQEY------WSCCGAHGPNDWNLNIYFNCTDSNPSRERCGVPFSCCVKDPA 194          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: tspan17 (tetraspanin 17 [Source:NCBI gene;Acc:448429])

HSP 1 Score: 62.3882 bits (150), Expect = 1.778e-10
Identity = 60/196 (30.61%), Postives = 87/196 (44.39%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPT 695
            KY L G N++F+L+    L IG+W   +K V+S ISS+    G             D + +  +V GA+  V+GF GC GA++EN  LL  +   +  I  L+L   I+A V K+ I   +     N       D++  N   F Q +        CCGA G +D      FN  +   S    G P +CC   P 
Sbjct:   18 KYFLFGFNIVFWLLGAAFLAIGLWAWAEKGVLSNISSITDLGG------------FDPVWL-FIVTGAVMFVLGFAGCIGALRENTTLLKFFSVFLGLIFFLELTAGILAFVFKDWIKDQLNFFINNNVKAYRDDIDLQNLIDFAQEY------WSCCGAHGPNDWNLNIYFNCTDSNPSRERCGVPFSCCVKDPA 194          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: ENSXETT00000012721.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:49362206:49376296:1 gene:ENSXETG00000005063.1 transcript:ENSXETT00000012721.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 2.537e-10
Identity = 66/223 (29.60%), Postives = 106/223 (47.53%), Query Frame = 3
Query:  117 KFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRI---SSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDF---NEFNEWKSSNVTGNPIACCQF-RPTLKLSLDSLKNEKNLLDNLVDPNC 764
            KF  Y++   N++ F+  + LL +GIWL  D     R+   + +L A G +                 L++IG    ++GF GC GA+++NK LL ++  LV     ++L  +I+A   ++ +    + +F       YK  N+     F+QS++ +MI L CCG +G +DF   + F+E   S  T  P ACC+   P     LD  K  +N  D   D  C
Sbjct:    7 KFVTYMMFLFNVLIFIGGVCLLAVGIWLVADPDGFQRVVISNPLLSAGGYI-----------------LLIIGIALSLLGFLGCFGAIRKNKTLLLLFFVLVLLFFIMELTGVILALSYQKTVK---QEQFLVELQRFYKGDNA--SEVFSQSWNTIMIALSCCGISGLNDFGNRSHFHEMYPS--TPWPDACCRRDNPVSGKILDREKCMQNTPDFTNDQGC 205          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd9 (CD9 protein [Source:NCBI gene;Acc:549743])

HSP 1 Score: 60.4622 bits (145), Expect = 4.081e-10
Identity = 43/162 (26.54%), Postives = 76/162 (46.91%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATG 611
            KY+L   N IF+L    +LGIG+WL+ D     +  +M +AD +  A       L+          GA+ +++GF GCCGA++E++ +L ++    +F++ +    I           K ++ + K  + + Y      N N    +   + + L CCG TG
Sbjct:   11 KYLLFAFNFIFWLAGTAVLGIGLWLRFD----PQTKAMFEADQNTGAFYTGVYILIGA--------GALMMLVGFLGCCGAIQESECMLGLF---FAFLLVIFAVEIAAGIWGFTNKDKVVD-ELKTFYKDTYTKYMKSNDNALKDTLKAIHLALNCCGMTG 156          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan5 (tetraspanin 5 [Source:MGI Symbol;Acc:MGI:1928096])

HSP 1 Score: 67.3958 bits (163), Expect = 2.425e-12
Identity = 61/197 (30.96%), Postives = 93/197 (47.21%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFN---EFNEWKSSNVT----GNPIACCQFRPT 695
            KY + G N+IF+ + +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD+N    FN    SN +    G P +CC   P 
Sbjct:   16 KYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEY------WQCCGAFGADDWNLNIYFNC-TDSNASRERCGVPFSCCTKDPA 192          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan1 (tetraspanin 1 [Source:MGI Symbol;Acc:MGI:1914055])

HSP 1 Score: 63.1586 bits (152), Expect = 4.438e-11
Identity = 55/188 (29.26%), Postives = 88/188 (46.81%), Query Frame = 3
Query:  117 KFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGNPIACC 680
            KF K ++   NL+ FL    LL +GIW+ VD       +S LK  GS   +   ++  V+ +   L+  GA+  ++GF GC GA  ENK +L ++     F + L + I  +A      ++ T+  +F  + +    + +      FTQ ++  M +L CCG     DFN     K + V   P  CC
Sbjct:    5 KFIKVMMFLFNLLIFLCGAALLAVGIWVSVDG------TSFLKVFGS---LSSSAMQFVN-VGYFLIAAGAVLFILGFLGCYGAHSENKCVLMMF-----FSILLIIFIAEIAGAVVALVYTTLAEQFLTLLVVPAIEKDYGYQTDFTQVWNTTMEELHCCGFNNYTDFNASRFVKENKVFPPP--CC 175          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan1 (tetraspanin 1 [Source:MGI Symbol;Acc:MGI:1914055])

HSP 1 Score: 63.1586 bits (152), Expect = 5.334e-11
Identity = 55/188 (29.26%), Postives = 88/188 (46.81%), Query Frame = 3
Query:  117 KFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGNPIACC 680
            KF K ++   NL+ FL    LL +GIW+ VD       +S LK  GS   +   ++  V+ +   L+  GA+  ++GF GC GA  ENK +L ++     F + L + I  +A      ++ T+  +F  + +    + +      FTQ ++  M +L CCG     DFN     K + V   P  CC
Sbjct:    5 KFIKVMMFLFNLLIFLCGAALLAVGIWVSVDG------TSFLKVFGS---LSSSAMQFVN-VGYFLIAAGAVLFILGFLGCYGAHSENKCVLMMF-----FSILLIIFIAEIAGAVVALVYTTLAEQFLTLLVVPAIEKDYGYQTDFTQVWNTTMEELHCCGFNNYTDFNASRFVKENKVFPPP--CC 175          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan5 (tetraspanin 5 [Source:MGI Symbol;Acc:MGI:1928096])

HSP 1 Score: 59.3066 bits (142), Expect = 4.879e-10
Identity = 34/96 (35.42%), Postives = 53/96 (55.21%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILL-YIYVFL 410
            KY + G N+IF+ + +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL +  VFL
Sbjct:   16 KYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFL 98          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan3 (tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098])

HSP 1 Score: 59.6918 bits (143), Expect = 7.940e-10
Identity = 50/205 (24.39%), Postives = 96/205 (46.83%), Query Frame = 3
Query:  123 AKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGNPIACCQFRPTLKLSLDSLKNEKNL 737
            +K +L+ LNLIF+  +  L  +G ++             +  D   H   DV        AV ++ +GA+  +IG  GCC  ++E++  L  +VF++  +   ++ ++++  V + K+   ++R  + +    YK  N  N +  +++   +  QL CCG     D+   + +K +     P++CC  R T K    SL N  +L
Sbjct:    9 SKTVLVFLNLIFWGAAGILCYVGAYV------------FITYDDYDHFFEDVYTLFP---AVVIIAVGALLFIIGLIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKV----YKTYNGTNSDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCC--RETAKSCNGSLANPSDL 192          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q17QJ5|TSN5_BOVIN (Tetraspanin-5 OS=Bos taurus OX=9913 GN=TSPAN5 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.543e-11
Identity = 61/197 (30.96%), Postives = 93/197 (47.21%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFN---EFNEWKSSNVT----GNPIACCQFRPT 695
            KY + G N+IF+ + +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD+N    FN    SN +    G P +CC   P 
Sbjct:   16 KYFIFGFNVIFWFLGIAFLGIGLWAWNEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEY------WQCCGAFGADDWNLNIYFNC-TDSNASRERCGVPFSCCTKDPA 192          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q68VK5|TSN5_RAT (Tetraspanin-5 OS=Rattus norvegicus OX=10116 GN=Tspan5 PE=2 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 1.696e-11
Identity = 61/197 (30.96%), Postives = 93/197 (47.21%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFN---EFNEWKSSNVT----GNPIACCQFRPT 695
            KY + G N+IF+ + +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD+N    FN    SN +    G P +CC   P 
Sbjct:   16 KYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEY------WQCCGAFGADDWNLNIYFNC-TDSNASRERCGVPFSCCTKDPA 192          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P62080|TSN5_MOUSE (Tetraspanin-5 OS=Mus musculus OX=10090 GN=Tspan5 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.696e-11
Identity = 61/197 (30.96%), Postives = 93/197 (47.21%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFN---EFNEWKSSNVT----GNPIACCQFRPT 695
            KY + G N+IF+ + +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD+N    FN    SN +    G P +CC   P 
Sbjct:   16 KYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEY------WQCCGAFGADDWNLNIYFNC-TDSNASRERCGVPFSCCTKDPA 192          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P62079|TSN5_HUMAN (Tetraspanin-5 OS=Homo sapiens OX=9606 GN=TSPAN5 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 1.696e-11
Identity = 61/197 (30.96%), Postives = 93/197 (47.21%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFN---EFNEWKSSNVT----GNPIACCQFRPT 695
            KY + G N+IF+ + +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD+N    FN    SN +    G P +CC   P 
Sbjct:   16 KYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEY------WQCCGAFGADDWNLNIYFNC-TDSNASRERCGVPFSCCTKDPA 192          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q99J59|TSN1_MOUSE (Tetraspanin-1 OS=Mus musculus OX=10090 GN=Tspan1 PE=2 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 3.731e-10
Identity = 55/188 (29.26%), Postives = 88/188 (46.81%), Query Frame = 3
Query:  117 KFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGNPIACC 680
            KF K ++   NL+ FL    LL +GIW+ VD       +S LK  GS   +   ++  V+ +   L+  GA+  ++GF GC GA  ENK +L ++     F + L + I  +A      ++ T+  +F  + +    + +      FTQ ++  M +L CCG     DFN     K + V   P  CC
Sbjct:    5 KFIKVMMFLFNLLIFLCGAALLAVGIWVSVDG------TSFLKVFGS---LSSSAMQFVN-VGYFLIAAGAVLFILGFLGCYGAHSENKCVLMMF-----FSILLIIFIAEIAGAVVALVYTTLAEQFLTLLVVPAIEKDYGYQTDFTQVWNTTMEELHCCGFNNYTDFNASRFVKENKVFPPP--CC 175          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1I8GD10 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006680g1 PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.590e-22
Identity = 90/295 (30.51%), Postives = 145/295 (49.15%), Query Frame = 3
Query:  102 MSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKA-------DGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKN------IFLENY-KDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVT------GNPIACCQFRPTLKLSLDSLKNE--KNLLDNLVDPNCIANKESESVNKIGCVTHLWEVLSKKTKXXXXXXXXXXXXXXXCIIFACCVIN 920
            MS     AK IL   N++FFL+    +G+GIW+ V+KS + R+ +++ A        G + ++ + +  LV +    L+ IGA TLV+GFCGCCGA+KE+K LL +Y FLV  ++ +++   I+AAV + +I    E           + + +Y  D  S N    T   + L +   CCGA    D    + W  SN +        PI CCQ R   K +  +        L   LVDP+C     ++      C + + + + K    ++G+  G+ + E+ CII ACC++ 
Sbjct:    1 MSCSTSLAKMILFIFNIVFFLLGAASVGVGIWVAVNKSDLFRVINLIDARVDQGDNKGQIDSVANQN-GLVTVAGFILIGIGAFTLVVGFCGCCGAVKESKCLLGMYAFLVGLVLAVEVTAAILAAVYQARIRTAAEDGMYGLQEKMFVAMTDYLSDSTSDNNKTVTTLINYLQMSFDCCGAKKPGDIANSSSWLLSNRSWEGRELQTPITCCQIRQDQKTAAAAPGYNWVSKLNGTLVDPSCPFTGTTQHTKT--CYSGIMDFIGKFAGPLIGVCAGIAVFELFCIIVACCLVR 292          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267ERG2 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023279g1 PE=3 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 3.655e-22
Identity = 91/295 (30.85%), Postives = 146/295 (49.49%), Query Frame = 3
Query:  102 MSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKA-------DGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKN------IFLENY-KDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVT------GNPIACCQFRPTLKLSLDSLKNE--KNLLDNLVDPNCIANKESESVNKIGCVTHLWEVLSKKTKXXXXXXXXXXXXXXXCIIFACCVIN 920
            MS     AK IL   N++FFL+    +G+GIW+ V+KS + R+ +++ A        G + ++ + +  LV +    L+ IGA TLV+GFCGCCGA+KE+K LL +Y FLV  ++ +++A  I+AAV + +I    E           + + +Y  D  S N    T   + L +   CCGA    D    + W  SN +        PI CCQ R   K +  +        L   LVDP+C     ++      C + + + + K    ++G+  G+ + E+ CII ACC++ 
Sbjct:    1 MSCSTSLAKMILFIFNIVFFLLGAASVGVGIWVAVNKSDLFRVINLIDARVDQGDNKGQIDSVANQN-GLVMVAGFILIGIGAFTLVVGFCGCCGAVKESKCLLGMYAFLVGLVLAVEVAAAILAAVYQARIRTAAEDGMYGLQEKMFVAMTDYLSDSTSDNNKTVTTLINYLQMSFDCCGAKKPGDIANSSSWLLSNRSWEGRELQTPITCCQIRQDQKTAAAAPGYNWVSKLNGTLVDPSCPFTGTTQHTKT--CYSGIMDFIGKFAGPLIGVCAGIAVFELFCIIVACCLVR 292          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267EJW2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032479g1 PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 5.081e-21
Identity = 94/288 (32.64%), Postives = 153/288 (53.12%), Query Frame = 3
Query:  123 AKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHA-IGDVSVSLVDMLAVS-----LMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIER---KFKNIF---LENYKDLNSVNPNFFTQSFSMLMIQL--KCCGATGRDDFNEFNEWKSSNVT--GN----PIACCQFRPTLKLS-LDSLKNEKNLLDNLVDPNCIANK--ESESVNKIGCVTHLWEVLSKKTKXXXXXXXXXXXXXXXCIIFACCVI 917
            AK IL   N+ FF+  +  LG+GIW+ V+K+ + R  +++ +  +  A  GD+S       AV+     L+ +G  TL++GFCGCCGAMKE+K LL IY  LV  ++ L++   I+AAV +  +H + E+   + +N F   + +Y  +   N      +F +  +QL  +CCGA    D    + W +SN T  G     P+ CC+ R   K + +D   N  N  D+L D  C       +  +N   C   L E +S+ +K ++ I +G+ + E++ I+FACC+I
Sbjct:    8 AKMILFIFNVAFFIFGIASLGLGIWVAVNKNDLFRFINLVDSQVTEGANQGDISSVANQSGAVTAAGYVLIGLGLFTLLVGFCGCCGAMKESKCLLMIYAGLVGLVLVLEITAAIMAAVFQSHVHNSAEKGMLRVQNRFFVAMPDYLRMQGTNGANALATFLINYVQLMFECCGARTIGDIANSSSWTASNRTFAGKELKVPLTCCRLRENRKNAVMDPRYNWTNFADDLQDSGCPYKPVGGNGGLNNATCYNSLLEYVSQYSKPIIIICVGIGLFEILGILFACCLI 295          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267G481 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032479g3 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.362e-20
Identity = 92/290 (31.72%), Postives = 150/290 (51.72%), Query Frame = 3
Query:  117 KFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHA-IGDVSVSLVDMLAVS-----LMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIER---KFKNIF---LENYKDLNSVNPNFFTQSFSMLMIQL--KCCGATGRDDFNEFNEWKSSNVT--GN----PIACCQFRPTLKLS-LDSLKNEKNLLDNLVDPNCIANK--ESESVNKIGCVTHLWEVLSKKTKXXXXXXXXXXXXXXXCIIFACCVI 917
              AK IL   N+ FF+  +  LG+GIW+ V+K+ + R  +++ +  +  A  GD+S       AV+     L+ +G  TL++GFCGCCGAMKE+K LL IY  LV  ++ L++   I+AAV +  +  + E    + +N F   + +Y  +   N      +F +  +QL  +CCGA    D    + W +SN T  G     P+ CC+ R   K + +D   N  N  D+L D  C       +  +N   C   L E +S+ +K ++ I + + + E++ I+FACC+I
Sbjct:    6 SLAKMILFIFNVAFFIFGIASLGLGIWVAVNKNDLFRFINLVDSQVTEGANQGDISSVANQSGAVTAAGYVLIGLGLFTLLVGFCGCCGAMKESKCLLMIYAGLVGLVLVLEITAAIMAAVFQSHVRNSAEAGMLRVQNRFFVAMPDYLRVQGTNGANALATFLINYVQLMFECCGARTIGDIANSSSWTASNRTFAGKELKVPLTCCRLRENRKNAVMDPRYNWTNFADDLQDSGCPYKPLGGNGGLNNATCYNSLLEYVSQYSKPIIIICVAIGLFEILGILFACCLI 295          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267EJG0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032479g2 PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.982e-20
Identity = 92/290 (31.72%), Postives = 149/290 (51.38%), Query Frame = 3
Query:  117 KFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHA-IGDVSVSLVDMLAVS-----LMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIER---KFKNIF---LENYKDLNSVNPNFFTQSFSMLMIQL--KCCGATGRDDFNEFNEWKSSNVT--GN----PIACCQFRPTLKLS-LDSLKNEKNLLDNLVDPNCIANK--ESESVNKIGCVTHLWEVLSKKTKXXXXXXXXXXXXXXXCIIFACCVI 917
              AK IL   N+ FF+  +  LG+GIW+ V+K+ + R  +++ +  +  A  GD+S       AV+     L+ +G  TL++GFCGCCGAMKE+K LL IY  LV  ++ L++   I+AAV +  +  + E    + +N F   + +Y  +   N      +F +  +QL  +CCGA    D    + W +SN T  G     P+ CC+ R   K   +D   N  N  D+L D  C       +  +N   C   L E +S+ +K ++ I + + + E++ I+FACC+I
Sbjct:    6 SLAKMILFIFNVAFFIFGIASLGLGIWVAVNKNDLFRFINLVDSQVTEGANQGDISSVANQSGAVTAAGYVLIGLGLFTLLVGFCGCCGAMKESKCLLMIYAGLVGLVLVLEITAAIMAAVFQSHVRNSAEAGMLRVQNRFFVAMPDYLRVQGTNGANALATFLINYVQLMFECCGARTIGDIANSSSWTASNRTFAGKELKVPLTCCRLRENRKNDVMDPRYNWTNFADDLQDSGCPYKPLGGNGGLNNATCYNSLLEYVSQYSKPIIIICVAIGLFEILGILFACCLI 295          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan5a (tetraspanin-5 [Source:NCBI gene;Acc:103038323])

HSP 1 Score: 69.707 bits (169), Expect = 2.936e-13
Identity = 60/196 (30.61%), Postives = 91/196 (46.43%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPT 695
            KY + G N+IF+L+ +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD      FN  +   S    G P +CC   P 
Sbjct:   17 KYFIFGFNIIFWLLGVAFLGIGLWAWSEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLNFFINNNIRAYRDDIDLQNLIDFTQEY------WECCGAFGADDWNLNIYFNCTDSNPSREKCGVPFSCCTKDPA 193          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan5a (tetraspanin-5 [Source:NCBI gene;Acc:103038323])

HSP 1 Score: 69.3218 bits (168), Expect = 3.609e-13
Identity = 60/196 (30.61%), Postives = 91/196 (46.43%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPT 695
            KY + G N+IF+L+ +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD      FN  +   S    G P +CC   P 
Sbjct:   17 KYFIFGFNIIFWLLGVAFLGIGLWAWSEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLNFFINNNIRAYRDDIDLQNLIDFTQEY------WECCGAFGADDWNLNIYFNCTDSNPSREKCGVPFSCCTKDPA 193          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan5a (tetraspanin-5 [Source:NCBI gene;Acc:103038323])

HSP 1 Score: 69.3218 bits (168), Expect = 3.965e-13
Identity = 60/196 (30.61%), Postives = 91/196 (46.43%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPT 695
            KY + G N+IF+L+ +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD      FN  +   S    G P +CC   P 
Sbjct:   17 KYFIFGFNIIFWLLGVAFLGIGLWAWSEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLNFFINNNIRAYRDDIDLQNLIDFTQEY------WECCGAFGADDWNLNIYFNCTDSNPSREKCGVPFSCCTKDPA 193          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan5a (tetraspanin-5 [Source:NCBI gene;Acc:103038323])

HSP 1 Score: 68.9366 bits (167), Expect = 4.141e-13
Identity = 60/196 (30.61%), Postives = 91/196 (46.43%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPT 695
            KY + G N+IF+L+ +  LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD      FN  +   S    G P +CC   P 
Sbjct:   17 KYFIFGFNIIFWLLGVAFLGIGLWAWSEKGVLSNISSITDLGG------------FDPVWL-FLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLNFFINNNIRAYRDDIDLQNLIDFTQEY------WECCGAFGADDWNLNIYFNCTDSNPSREKCGVPFSCCTKDPA 193          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan17 (tetraspanin-17 [Source:NCBI gene;Acc:103026657])

HSP 1 Score: 67.3958 bits (163), Expect = 2.098e-12
Identity = 61/198 (30.81%), Postives = 91/198 (45.96%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFN--------EFNEWKSSNVTGNPIACCQFRPT 695
            KY L G N+IF+L+    LGIG+W   +K V+S ISS+    G             D + +  +V+G +  ++GF GC GA++EN +LL  +   +  I  L+L   I+A V K+ I   +     N       D++  N   F Q + +      CCGA G +D+N        E N   S    G P +CC   P 
Sbjct:   18 KYFLFGFNIIFWLLGAAFLGIGLWAWAEKGVLSNISSITDLGG------------FDPVWL-FIVVGGVMFILGFAGCIGALRENTVLLKFFSVFLGLIFFLELTAGILAFVFKDWIKDQLNFFINNNVKAYRDDIDLQNLIDFAQEYWL------CCGAHGPNDWNLNIYFNCTELN--PSRERCGVPFSCCVKDPA 194          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan17 (tetraspanin 17 [Source:ZFIN;Acc:ZDB-GENE-030131-3673])

HSP 1 Score: 56.225 bits (134), Expect = 1.908e-9
Identity = 56/196 (28.57%), Postives = 89/196 (45.41%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNE---FN---EWKSSNVTGNPIACCQFRPT 695
            +YI+   N IF LV    L IG+W   +K V+S +SS+    G             D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   ++A V K+ +   +     N       D++  N   F Q +       +CCGA G  D++E   FN   + +S    G P +CC   P 
Sbjct:    1 EYIIFSHNYIFQLVGAAFLAIGLWAWAEKGVLSNLSSITDLKG------------FDPVWL-FIVVGTVMFILGFAGCIGALRENTYLLKFFSTFLGLIFFLELTAGVLAFVFKDWLRDQLNFFIYNNVKAYRDDIDLQNLIDFAQDY------WQCCGAHGPLDWDENIYFNCSIKNRSREKCGVPFSCCVKDPA 177          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 51.6026 bits (122), Expect = 6.683e-8
Identity = 52/221 (23.53%), Postives = 99/221 (44.80%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKS-VVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGN--PIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKE 779
            KY+LL  N IF+L    ++ +G+W  V+K   +S ++S                S     A  L++ G++ ++ G  GCC  ++E +  L  Y  L+  I  L++   I+A + ++++ + ++       +E+Y      +    T +   L  + KCCG+   +D+   +  K +   G   P +CC+  PT +       +  N+  N V+  CI   E
Sbjct:   18 KYVLLVFNFIFWLTGAGVMAVGVWTLVEKGDYLSLLAS----------------STFAATAYILILAGSVVMLTGLLGCCAVVRERRGCLAAYCGLLLLIFLLEVIAGILAYLYRQQLSEELKSHMNKTIVESY---GQPDQQRVTDAMDKLQQEFKCCGSHDWNDWQRSDWVKVAAAEGRLVPDSCCK-SPTTRCG--RRDHPSNI--NRVEGGCITKLE 214          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 47.3654 bits (111), Expect = 1.961e-6
Identity = 40/151 (26.49%), Postives = 69/151 (45.70%), Query Frame = 3
Query:  249 DGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSS---NVTGN---PIACCQ 683
            D   H + D  V L  ++ V+   +G    V+G  GCC  ++E+K  L  +  L+  I  L++   ++    + ++   +ER    +F E     N  + N  +++   +  QLKCCG         + +WK     N TGN   PI+CC+
Sbjct:   41 DSYRHFLEDRYVLLAPLVVVA---VGIFLFVVGIVGCCATVRESKCGLSTFFILLLMIFSLEVVAALLGYAYRGQVKDKVERTISQVFNE----YNGTDSNTASRAIDYVQHQLKCCGV------KNYLDWKDRPWFNHTGNNSVPISCCR 178          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO46715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD1])

HSP 1 Score: 60.8474 bits (146), Expect = 1.030e-10
Identity = 46/190 (24.21%), Postives = 87/190 (45.79%), Query Frame = 3
Query:  123 AKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNE---FN-EWKSSNVTGNPIACC 680
            +KY +  LN I ++VS+  +G+G W   +K   + + +++ +                  ++ L+ +G    ++ FCGC GA++EN++LL IY+ +++ +  L++    ++    E+    +    K   +    DL+  N     QS       LKCCG     D+N    FN   ++    G P +CC
Sbjct:    7 SKYFIFTLNFIVWVVSIVFIGVGSWAHSEKDKYNTMGNLVASP-----------------SIILIAVGIFMFLVAFCGCIGALRENRVLLKIYMVVLAVLFTLEIIAGFLSFFFVEETRSKVSSAIKLFVVHYQDDLDLQNAIDGIQS------NLKCCGGYSYHDWNHNKYFNCSAQAVEACGVPHSCC 173          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK24])

HSP 1 Score: 58.151 bits (139), Expect = 7.024e-10
Identity = 58/189 (30.69%), Postives = 94/189 (49.74%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKF-KNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGAT-GRDDFNEFNEWKSSNVTGN-PIACCQ 683
            KY+L   N +F++  + ++ +GIW +V     +  +S++   G   A            A  ++  GA+ + IGF GCCGA+KENK  L +Y FL+  I  L++A  I+A  K++K+  ++E+   ++I L    D    N    T++        KCCGAT G  D+     W  SN     P +CC+
Sbjct:   10 KYLLFAFNFVFWIAGIAVMSVGIWTRVS---ANEYASLMGQSGFTAA------------ANIMIAAGALVMFIGFVGCCGAVKENKCFLLLYFFLLLVIFVLEIASGILAYTKRDKVISSVEKALNQSISL----DYGQSNKEKATKAVDRAQSIFKCCGATQGPKDWAN-TAWAKSNTNQTVPESCCK 178          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK25])

HSP 1 Score: 56.6102 bits (135), Expect = 2.237e-9
Identity = 67/270 (24.81%), Postives = 114/270 (42.22%), Query Frame = 3
Query:  117 KFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILL--YIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGN--PIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHLWEVLSKKTKXXXXXXXXXXXXXXXCIIFACCV 914
            K  KY+L   N  F+L  L +LGIGIW KVD     +  S L + G              + A +++  GA    +GF GCCGA+KE++ +L  ++   L   +   K   +    +K   +   ++ + K    E  ++    +        + L I+LKCCG     D+   ++WK         P++CC                    +N     C  +   + V   GCV  L   + K   L+  I +G+ I++++ +IF+CC+
Sbjct:    5 KCMKYLLFVFNFFFWLSGLAVLGIGIWTKVD---AGQFDSFLGSSG------------YSIPAWTMIGAGAFVTFVGFFGCCGAVKESRCMLATWLKYLLTILLSLSKQVNLFELYLKFFLLWHQVQEEIKINLDEQIRNTYGYDSE-VESHINNLQIRLKCCGGERPGDWLG-SKWKRDLNKDKIVPLSCCT-------------------ENANKTTCYKDDTYKEVYSSGCVNELKTFVDKHMILIGAIAVGISIVQLLGMIFSCCL 238          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO30837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZN5])

HSP 1 Score: 55.4546 bits (132), Expect = 6.049e-9
Identity = 50/206 (24.27%), Postives = 92/206 (44.66%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGN--PIACCQFRPTLKLSLDSLKNEKNL 737
            K++L G N +F+L+ L +L +GIW ++  S   ++SS   A  +   IG                IG +  +IGF GCCGA+KE+  LL  +  ++  +  ++L   I   + + +I   +        L++Y +        F  +++ +   LKCCG+    D+     W   N      P +CC+       +L+ L + + +
Sbjct:   14 KFLLFGFNALFWLMGLSVLAVGIWARIQFSDYMKLSSHDYATAAYILIG----------------IGFLIAIIGFIGCCGALKEHTCLLKTFGVILGLLFLVELGTAITGYIFRSEIKTGLSDGLDTA-LKDYPEQG------FKDAWNDMQKNLKCCGSRNYTDWFMV-AWAGPNTKNGSVPESCCKDTKVKSCNLEVLSHPETI 195          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO30838 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZN7])

HSP 1 Score: 51.6026 bits (122), Expect = 1.458e-8
Identity = 31/89 (34.83%), Postives = 47/89 (52.81%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILL 392
            K++L G N +F+L+ L +L +GIW ++  S   ++SS   A  +   IG                IG +  +IGF GCCGA+KE+  LL
Sbjct:   14 KFLLFGFNALFWLMGLSVLAVGIWARIQFSDYMKLSSHDYATAAYILIG----------------IGFLIAIIGFIGCCGALKEHTCLL 86          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan5b (tetraspanin-5 [Source:NCBI gene;Acc:101171701])

HSP 1 Score: 71.633 bits (174), Expect = 7.522e-14
Identity = 68/237 (28.69%), Postives = 109/237 (45.99%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHL 818
            KY + G N++F+L+ + L+GIGIW   +K V+S ISS+    G            +D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   I+A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD      FN  +   S    G P +CC   P      + + N +   D    P+   +++ + +N  GCV   
Sbjct:   17 KYFIFGFNILFWLLGMALVGIGIWAWSEKGVLSNISSITDLGG------------LDPVWL-FVVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGILAFVFKDWIKDQLNLFINNNIRAYRDDIDLQNLIDFTQEY------WECCGAFGVDDWNLNIYFNCTDGNPSREKCGVPFSCCTKDPA-----EDVINTQCGYDIRAKPD---SEQKDYINVKGCVPQF 226          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan5b (tetraspanin-5 [Source:NCBI gene;Acc:101171701])

HSP 1 Score: 71.2478 bits (173), Expect = 9.690e-14
Identity = 68/237 (28.69%), Postives = 109/237 (45.99%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHL 818
            KY + G N++F+L+ + L+GIGIW   +K V+S ISS+    G            +D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   I+A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD      FN  +   S    G P +CC   P      + + N +   D    P+   +++ + +N  GCV   
Sbjct:   17 KYFIFGFNILFWLLGMALVGIGIWAWSEKGVLSNISSITDLGG------------LDPVWL-FVVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGILAFVFKDWIKDQLNLFINNNIRAYRDDIDLQNLIDFTQEY------WECCGAFGVDDWNLNIYFNCTDGNPSREKCGVPFSCCTKDPA-----EDVINTQCGYDIRAKPD---SEQKDYINVKGCVPQF 226          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan5b (tetraspanin-5 [Source:NCBI gene;Acc:101171701])

HSP 1 Score: 71.2478 bits (173), Expect = 9.690e-14
Identity = 68/237 (28.69%), Postives = 109/237 (45.99%), Query Frame = 3
Query:  126 KYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHL 818
            KY + G N++F+L+ + L+GIGIW   +K V+S ISS+    G            +D + +  +V+G +  ++GF GC GA++EN  LL  +   +  I  L+L   I+A V K+ I   +     N       D++  N   FTQ +       +CCGA G DD      FN  +   S    G P +CC   P      + + N +   D    P+   +++ + +N  GCV   
Sbjct:   17 KYFIFGFNILFWLLGMALVGIGIWAWSEKGVLSNISSITDLGG------------LDPVWL-FVVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGILAFVFKDWIKDQLNLFINNNIRAYRDDIDLQNLIDFTQEY------WECCGAFGVDDWNLNIYFNCTDGNPSREKCGVPFSCCTKDPA-----EDVINTQCGYDIRAKPD---SEQKDYINVKGCVPQF 226          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan17 (tetraspanin-17 [Source:NCBI gene;Acc:101157787])

HSP 1 Score: 70.4774 bits (171), Expect = 2.704e-13
Identity = 67/225 (29.78%), Postives = 103/225 (45.78%), Query Frame = 3
Query:   39 RNSLTIKVQIIREKFIF*FRKMSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDD------FNEFNEWKSSNVTGNPIACCQFRPT 695
            + + TI  ++ R++  F   K + +    KYIL G N+IF+L+    L IG+W   +K V+S ISS+    G            +D + +  +V+G +  ++GF GC GA++EN +LL  +   +  I  L+L   I+A V K+ I   +     N       D++  N   F Q +        CCGA G DD      FN  N   S    G P +CC   P 
Sbjct:   28 QTATTIPGRMSRKRRHF---KGTEVSCCVKYILFGFNIIFWLLGAAFLSIGLWAWAEKGVLSNISSITDLGG------------LDPVWL-FIVVGGVMFILGFAGCIGALRENTVLLKFFSVFLGLIFFLELTTGILAYVFKDWIKDQLNLFINNNVKAYRDDIDLQNLIDFAQEY------WSCCGAHGPDDWNLNMYFNCTNSNPSRERCGVPFSCCVKDPA 230          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: cd9a (CD9 antigen [Source:NCBI gene;Acc:101173781])

HSP 1 Score: 67.3958 bits (163), Expect = 1.223e-12
Identity = 50/176 (28.41%), Postives = 90/176 (51.14%), Query Frame = 3
Query:  114 EKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAI-GDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNE 638
            E   KY++   NL+F+L    +L IG+WL++D     +   +L+ + S +A    V V         L+  GA+ +V+GF GCCGA++E+  +L ++ F +  +  +++A  I     + K+ + I     + +++ YKD  S       ++  ++  QLKCCG  G+D    F E
Sbjct:    8 ETCVKYLMFAFNLVFWLAGTTVLAIGLWLRLD----PQNKVLLEEENSPYAFYAGVYV---------LIGAGALIMVVGFLGCCGAIRESPCMLGVFFFFLLILFAIEVAAGIWGFSNQTKVVEDI----SSFYMQTYKDYTSTGDERVKETLRLIQAQLKCCGP-GKDTDESFKE 165          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000078683.1 (SMESG000078683.1)

HSP 1 Score: 481.485 bits (1238), Expect = 8.005e-173
Identity = 281/281 (100.00%), Postives = 281/281 (100.00%), Query Frame = 3
Query:  102 MSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGNPIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHLWEVLSKKTKXXXXXXXXXXXXXXXCIIFACCVINKSYEKLKN 944
            MSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFIVGLKLAIIIVAAVKKEKIHKTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGNPIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHLWEVLSKKTKLVLGILIGVMILEVICIIFACCVINKSYEKLKN
Sbjct:    1 MSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFIVGLKLAIIIVAAVKKEKIHKTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGNPIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHLWEVLSKKTKLVLGILIGVMILEVICIIFACCVINKSYEKLKN 281          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019443.1 (SMESG000019443.1)

HSP 1 Score: 150.599 bits (379), Expect = 5.074e-43
Identity = 95/279 (34.05%), Postives = 165/279 (59.14%), Query Frame = 3
Query:  102 MSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNE-WKSSNVTGN---PIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHLWEVLSKKTKXXXXXXXXXXXXXXXCIIFACCVINKS 926
            MSF E  AK +L+  N+ FFL+   +LGIGIW+K+DKS +  +   +K + +  +  + + SL D +A+ L+V+GAIT + GFCGCCGA+KE++ LL++Y   V+ ++  ++ + I A V+K K+   +E    ++    +  + S NP+ FT++ + +M ++KCCG    +DF    + WK +    N   PI CC+ + +     ++  N   L D LVDP C   K ++ +N  GC++ L E +     +V+ + +G+ + E++CI+FACCV  ++
Sbjct:    1 MSFCESIAKLLLIIFNICFFLIGALILGIGIWVKIDKSNLFEMLRNIKLEETASSFDNTNSSLFDTIAIFLIVLGAITFITGFCGCCGAIKESQCLLFLYSLFVTVVIVGQIGVGIYAGVQKNKVQYYLESSLVSVLENEFNGIISPNPSMFTKALTAIMFEMKCCGIRNENDFKITKQNWKQTIQGQNQVHPIGCCKIKQSFSFDSENKLNYTILSDILVDPLCPVTKATK-LNYEGCISVLIEKIRNNLTIVISVCVGLGLFEMLCIVFACCVARRN 278          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000078545.1 (SMESG000078545.1)

HSP 1 Score: 145.976 bits (367), Expect = 3.130e-41
Identity = 101/284 (35.56%), Postives = 164/284 (57.75%), Query Frame = 3
Query:  102 MSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFN-EWKS---SNVTGNPIACCQFRPTLKLSLDSLKNEKNLLDNL----VDPNC--IANKESESVNKIGCVTHLWEVLSKKTKXXXXXXXXXXXXXXXCIIFACCVINK 923
            M   E F+K +L+  N++FF++    LG+GIW+KVDKS +  I   +  DG+  +    S S ++++A+ L+V+G  T +IGFCGCCGA+KEN  LLY+Y FLV  ++ +++ I I A V+K K    I++    I    +  + S N   FT+ F+ +M++LKCCG   ++DFN     W+    +    NPI CC  +     +     N+K +LD +     +P+C    N+    +N  GC   L ++++K   +V+G+ +G+ + E+ CIIFACCVI+K
Sbjct:    1 MGCCESFSKTLLIIFNVLFFILGGVFLGVGIWVKVDKSNLFEIMRKVNLDGTASSFDSSSSSFLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFLVGVVILIEVGIGIYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQIIDNKTQANPIGCCAEKEVYVYN----TNDKFVLDKVKPFFKNPDCPTTTNRTQAKLNPTGCSQSLIDLINKNLGIVIGVCVGLGLFEIFCIIFACCVISK 280          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000078589.1 (SMESG000078589.1)

HSP 1 Score: 145.206 bits (365), Expect = 5.470e-41
Identity = 100/278 (35.97%), Postives = 160/278 (57.55%), Query Frame = 3
Query:  102 MSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFN-EW--KSSNVTGNPIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNC-IANKESESVNKIGCVTHLWEVLSKKTKXXXXXXXXXXXXXXXCIIFACCVINK 923
            M F + F+K IL+  N++FF++   +LG+GIW+KVDKS +  I   +K +GS  +  +   +++D++A+ L+V GA T V GFCGCCGA+KEN+ILL  Y  LV+  V  ++ I I A V+++K    +    KN+  +++    + N   FT+ F+ +M  L+CCG     DFN  N  W   S  +  +P+ CC+    LK +  S    +++ D LV  NC      +  +NK GC+  L ++L +   +V+GI IG+ + E+ CI FAC V  +
Sbjct:    1 MGFCKSFSKIILIIFNVLFFIIGAAILGVGIWVKVDKSNLFEILRKIKIEGSDVSFENTDNTVLDVIAIVLIVFGAFTFVTGFCGCCGAIKENRILLITYSILVAAAVIAEIGIGIYAGVEEKKFVNQLSDSLKNLIKKDFNGAFANNATQFTKIFTAIMFDLQCCGIVDESDFNVTNLNWTISSGKLQSHPVGCCKLNNNLKYNAQSNLKYEDIQDKLVTTNCPFETTVNVELNKDGCINALIKLLKENLGIVIGICIGLGLFEIFCIAFACIVARR 278          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019444.1 (SMESG000019444.1)

HSP 1 Score: 134.035 bits (336), Expect = 6.597e-37
Identity = 81/241 (33.61%), Postives = 140/241 (58.09%), Query Frame = 3
Query:  132 ILLGLNLIFF--------LVSLPLLGIGIWLKVDKSVVSRISSMLKADGSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIYVFLVSFXXXXXXXXXXXXXXXXXXXXXTIERKFKNIFLENYKDLNSVNPNFFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTG----NPIACCQFRPTLKLSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHL 818
            I++ L+LI F        ++   +LG+GIW+KVDKS +  +   +  D +  +    + SL D++A+ L+++GA T + GFCGCCGA+KE+  LL++Y FLV+ ++  ++A+ I A+V++ K    +E+    I  +++    S NP+ FT+ F+ LM ++KCCG  G  DFN   +     ++G    +PI CC+ + +   +     N   + + + DPNCI  KE++ +N+ GCV  L
Sbjct:    3 IVMKLHLINFSHYTWTKKIIGAVILGVGIWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTISGRKQIHPIGCCKLKNSFHFNSKEKLNLTVVENTIEDPNCIFEKETK-LNQKGCVVSL 242          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TSPAN53.533e-1230.96tetraspanin 5 [Source:HGNC Symbol;Acc:HGNC:17753][more]
TSPAN54.982e-1034.83tetraspanin 5 [Source:HGNC Symbol;Acc:HGNC:17753][more]
TSPAN57.972e-1035.42tetraspanin 5 [Source:HGNC Symbol;Acc:HGNC:17753][more]
TSPAN172.902e-930.39tetraspanin 17 [Source:HGNC Symbol;Acc:HGNC:13594][more]
TSPAN173.107e-930.39tetraspanin 17 [Source:HGNC Symbol;Acc:HGNC:13594][more]
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tsp-67.556e-1225.84Tetraspanin [Source:UniProtKB/TrEMBL;Acc:G4RWX0][more]
tsp-111.726e-931.13Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526][more]
tsp-111.726e-931.13Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526][more]
tsp-137.182e-925.71Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q9NET3][more]
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tsp66E3.215e-1230.24gene:FBgn0035936 transcript:FBtr0076507[more]
Tsp66E3.215e-1230.24gene:FBgn0035936 transcript:FBtr0076506[more]
Tsp66E3.215e-1230.24gene:FBgn0035936 transcript:FBtr0076508[more]
Tsp26A4.922e-926.79gene:FBgn0031760 transcript:FBtr0332600[more]
Tsp26A6.409e-926.79gene:FBgn0031760 transcript:FBtr0113024[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan5a4.997e-1328.27tetraspanin 5a [Source:ZFIN;Acc:ZDB-GENE-041010-14... [more]
tspan172.800e-1229.58tetraspanin 17 [Source:ZFIN;Acc:ZDB-GENE-030131-36... [more]
cd151l3.574e-1124.87CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
tspan9a8.964e-1130.65tetraspanin 9a [Source:ZFIN;Acc:ZDB-GENE-060503-63... [more]
tspan9a1.166e-1030.65tetraspanin 9a [Source:ZFIN;Acc:ZDB-GENE-060503-63... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rergl6.970e-1427.85RERG/RAS-like [Source:Xenbase;Acc:XB-GENE-6037390][more]
tspan171.178e-1030.61tetraspanin 17 [Source:NCBI gene;Acc:448429][more]
tspan171.778e-1030.61tetraspanin 17 [Source:NCBI gene;Acc:448429][more]
ENSXETT00000012721.12.537e-1029.60pep primary_assembly:Xenopus_tropicalis_v9.1:2:493... [more]
cd94.081e-1026.54CD9 protein [Source:NCBI gene;Acc:549743][more]
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tspan52.425e-1230.96tetraspanin 5 [Source:MGI Symbol;Acc:MGI:1928096][more]
Tspan14.438e-1129.26tetraspanin 1 [Source:MGI Symbol;Acc:MGI:1914055][more]
Tspan15.334e-1129.26tetraspanin 1 [Source:MGI Symbol;Acc:MGI:1914055][more]
Tspan54.879e-1035.42tetraspanin 5 [Source:MGI Symbol;Acc:MGI:1928096][more]
Tspan37.940e-1024.39tetraspanin 3 [Source:MGI Symbol;Acc:MGI:1928098][more]
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17QJ5|TSN5_BOVIN1.543e-1130.96Tetraspanin-5 OS=Bos taurus OX=9913 GN=TSPAN5 PE=1... [more]
sp|Q68VK5|TSN5_RAT1.696e-1130.96Tetraspanin-5 OS=Rattus norvegicus OX=10116 GN=Tsp... [more]
sp|P62080|TSN5_MOUSE1.696e-1130.96Tetraspanin-5 OS=Mus musculus OX=10090 GN=Tspan5 P... [more]
sp|P62079|TSN5_HUMAN1.696e-1130.96Tetraspanin-5 OS=Homo sapiens OX=9606 GN=TSPAN5 PE... [more]
sp|Q99J59|TSN1_MOUSE3.731e-1029.26Tetraspanin-1 OS=Mus musculus OX=10090 GN=Tspan1 P... [more]
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GD101.590e-2230.51Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A267ERG23.655e-2230.85Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A267EJW25.081e-2132.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G4811.362e-2031.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EJG02.982e-2031.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan5a2.936e-1330.61tetraspanin-5 [Source:NCBI gene;Acc:103038323][more]
tspan5a3.609e-1330.61tetraspanin-5 [Source:NCBI gene;Acc:103038323][more]
tspan5a3.965e-1330.61tetraspanin-5 [Source:NCBI gene;Acc:103038323][more]
tspan5a4.141e-1330.61tetraspanin-5 [Source:NCBI gene;Acc:103038323][more]
tspan172.098e-1230.81tetraspanin-17 [Source:NCBI gene;Acc:103026657][more]
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tspan171.908e-928.57tetraspanin 17 [Source:ZFIN;Acc:ZDB-GENE-030131-36... [more]
CD1516.683e-823.53CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
tspan3a1.961e-626.49tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO467151.030e-1024.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359177.024e-1030.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359382.237e-924.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308376.049e-924.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308381.458e-834.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan5b7.522e-1428.69tetraspanin-5 [Source:NCBI gene;Acc:101171701][more]
tspan5b9.690e-1428.69tetraspanin-5 [Source:NCBI gene;Acc:101171701][more]
tspan5b9.690e-1428.69tetraspanin-5 [Source:NCBI gene;Acc:101171701][more]
tspan172.704e-1329.78tetraspanin-17 [Source:NCBI gene;Acc:101157787][more]
cd9a1.223e-1228.41CD9 antigen [Source:NCBI gene;Acc:101173781][more]
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078683.18.005e-173100.00SMESG000078683.1[more]
SMESG000019443.15.074e-4334.05SMESG000019443.1[more]
SMESG000078545.13.130e-4135.56SMESG000078545.1[more]
SMESG000078589.15.470e-4135.97SMESG000078589.1[more]
SMESG000019444.16.597e-3733.61SMESG000019444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012544 ID=SMED30012544|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=1035bp
TTTGATTAAGTTGATCGGATTAATCACTAGCGATTGTCAGAAACAGTTTG
ACAATAAAAGTTCAGATCATTCGAGAAAAATTTATTTTCTGATTCAGGAA
AATGAGTTTCATTGAAAAATTTGCAAAATACATTCTTTTAGGATTGAACT
TGATTTTTTTCCTGGTATCTCTACCTCTTCTTGGAATTGGAATATGGTTG
AAAGTTGACAAATCGGTAGTTAGTCGAATATCCTCGATGTTGAAAGCTGA
TGGATCTGTCCATGCTATTGGAGACGTAAGTGTATCACTGGTAGACATGC
TTGCCGTTTCACTTATGGTCATTGGTGCCATAACTCTTGTTATTGGGTTC
TGTGGATGTTGTGGAGCAATGAAAGAAAATAAAATTCTTCTATACATCTA
TGTGTTTCTGGTATCGTTTATCGTTGGTTTGAAATTGGCTATAATTATCG
TTGCAGCAGTAAAAAAAGAAAAGATACACAAAACTATAGAAAGAAAATTT
AAAAATATTTTTCTTGAAAATTACAAGGATTTAAATTCCGTAAATCCAAA
TTTCTTTACACAAAGTTTTAGTATGCTTATGATACAATTGAAATGTTGTG
GAGCAACTGGTAGAGATGATTTTAATGAATTTAACGAGTGGAAATCCTCA
AACGTCACAGGAAACCCAATTGCTTGTTGTCAATTCAGGCCAACCTTAAA
GTTGTCCTTGGATTCATTAAAAAACGAAAAAAACCTTTTGGATAATTTGG
TTGATCCAAATTGTATTGCAAATAAGGAATCTGAAAGCGTCAACAAAATA
GGATGTGTCACACATTTGTGGGAAGTTCTCTCAAAGAAAACCAAATTGGT
TCTCGGTATTTTGATCGGTGTCATGATACTAGAGGTAATTTGCATAATTT
TTGCCTGTTGTGTTATCAACAAAAGCTATGAGAAATTGAAAAACTGAAAT
TTGAGAACGTAAAATTTCTGAAATACTGCAAAATTTTGGATGTGGAATAT
TTAATATATAATAAAATAATAGATGTGTAAAAAAA
back to top

protein sequence of SMED30012544-orf-1

>SMED30012544-orf-1 ID=SMED30012544-orf-1|Name=SMED30012544-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=282bp
MSFIEKFAKYILLGLNLIFFLVSLPLLGIGIWLKVDKSVVSRISSMLKAD
GSVHAIGDVSVSLVDMLAVSLMVIGAITLVIGFCGCCGAMKENKILLYIY
VFLVSFIVGLKLAIIIVAAVKKEKIHKTIERKFKNIFLENYKDLNSVNPN
FFTQSFSMLMIQLKCCGATGRDDFNEFNEWKSSNVTGNPIACCQFRPTLK
LSLDSLKNEKNLLDNLVDPNCIANKESESVNKIGCVTHLWEVLSKKTKLV
LGILIGVMILEVICIIFACCVINKSYEKLKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 10..33
score: 36.97
coord: 249..275
score: 21.83
coord: 64..90
score: 33.02
coord: 91..119
score: 23.4
IPR000301TetraspaninPIRSFPIRSF002419Tetraspanincoord: 1..281
e-value: 5.0E-37
score: 125.0
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 9..273
e-value: 1.5E-37
score: 129.5
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 9..271
NoneNo IPR availablePANTHERPTHR19282:SF283TETRASPANIN-21coord: 9..271
NoneNo IPR availableCDDcd03156uroplakin_I_like_LELcoord: 125..247
e-value: 1.09969E-15
score: 69.4839
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 11..33
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
NoneNo IPR availableTMHMMTMhelixcoord: 249..271
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 127..245