Hexosyltransferase

Overview
NameHexosyltransferase
Smed IDSMED30012533
Length (bp)1411
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hexosyltransferase (SMED30012533) t-SNE clustered cells

Violin plots show distribution of expression levels for Hexosyltransferase (SMED30012533) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hexosyltransferase (SMED30012533) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hexosyltransferase (SMED30012533) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012533

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012533SMESG000050398.1 SmedASXL_009287SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012533SMESG000050398.1 SmedASXL_009287SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30012533SMESG000050398.1 dd_Smed_v4_24931_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012533SMESG000050398.1 SMED_08129_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012533SMESG000050398.1 SMED_08129_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012533SMESG000050398.1 SMESG000023958.1 SMED_08129_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012533SMESG000050398.1 SMESG000023958.1 SMED_08129_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 88.5817 bits (218), Expect = 7.271e-19
Identity = 64/236 (27.12%), Postives = 117/236 (49.58%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTK-IDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIP------KNLLACH 1275
            +V++V SS   L +R  IR++W  +      Q + +F LG         S  +TK +D ES  + DI+Q +F+D Y N T K M  +++  ++  +  +++  D D F++   L E + K+    +  RF  G++     PIR   S W+VS   Y ++ YPP+ +G   + S  +A  +  +   + Y  ++DV +G+ + +LNI    L +   + P  +       + ++ACH
Sbjct:   59 LVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLG------TTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKK---NRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACH 285          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 88.5817 bits (218), Expect = 7.271e-19
Identity = 64/236 (27.12%), Postives = 117/236 (49.58%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTK-IDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIP------KNLLACH 1275
            +V++V SS   L +R  IR++W  +      Q + +F LG         S  +TK +D ES  + DI+Q +F+D Y N T K M  +++  ++  +  +++  D D F++   L E + K+    +  RF  G++     PIR   S W+VS   Y ++ YPP+ +G   + S  +A  +  +   + Y  ++DV +G+ + +LNI    L +   + P  +       + ++ACH
Sbjct:   59 LVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLG------TTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKK---NRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACH 285          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 88.5817 bits (218), Expect = 7.271e-19
Identity = 64/236 (27.12%), Postives = 117/236 (49.58%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTK-IDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIP------KNLLACH 1275
            +V++V SS   L +R  IR++W  +      Q + +F LG         S  +TK +D ES  + DI+Q +F+D Y N T K M  +++  ++  +  +++  D D F++   L E + K+    +  RF  G++     PIR   S W+VS   Y ++ YPP+ +G   + S  +A  +  +   + Y  ++DV +G+ + +LNI    L +   + P  +       + ++ACH
Sbjct:   59 LVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLG------TTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKK---NRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACH 285          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 88.5817 bits (218), Expect = 7.271e-19
Identity = 64/236 (27.12%), Postives = 117/236 (49.58%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTK-IDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIP------KNLLACH 1275
            +V++V SS   L +R  IR++W  +      Q + +F LG         S  +TK +D ES  + DI+Q +F+D Y N T K M  +++  ++  +  +++  D D F++   L E + K+    +  RF  G++     PIR   S W+VS   Y ++ YPP+ +G   + S  +A  +  +   + Y  ++DV +G+ + +LNI    L +   + P  +       + ++ACH
Sbjct:   59 LVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLG------TTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKK---NRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACH 285          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 88.1965 bits (217), Expect = 9.913e-19
Identity = 64/236 (27.12%), Postives = 117/236 (49.58%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTK-IDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIP------KNLLACH 1275
            +V++V SS   L +R  IR++W  +      Q + +F LG         S  +TK +D ES  + DI+Q +F+D Y N T K M  +++  ++  +  +++  D D F++   L E + K+    +  RF  G++     PIR   S W+VS   Y ++ YPP+ +G   + S  +A  +  +   + Y  ++DV +G+ + +LNI    L +   + P  +       + ++ACH
Sbjct:   63 LVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLG------TTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKK---NRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACH 289          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: C54C8.3 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O02231])

HSP 1 Score: 63.929 bits (154), Expect = 6.433e-11
Identity = 61/240 (25.42%), Postives = 107/240 (44.58%), Query Frame = 1
Query:  580 ENNIVIIVKSSIGNLEKRNGIRRSWASK---ECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVI-GILMFKLNIYPNHLRNIHMYKPNPI----PKNLLACH 1275
            E +I+IIV S   +  +RN +R++W SK   E     + +  F +G     +    ++  +  L    Y DI+  +  DNY   TYK +AI+ Y V        +  +D+D    P  L E  ++        R  G  +   A   R+    WYV   +Y  + +P Y +G   ++++  A+ + K   +  +  ++DV + GIL   L I   +L   + Y P+ I    P +++A H
Sbjct:   75 EKDILIIVASRTDSYARRNILRQTWMSKANSEIVANGRMKPLFLVGLTPGEYKMKKMVMQEAKL----YGDIIVVDMNDNYEELTYKSLAILLYGVSKAPRYQMIGKIDEDVMFFPDKLTELYDQGFIDATPLRIYGLKMQSGANIFRDKTHRWYVPESSYSCSKFPEYVSGMLYMVTWEAAQQIIKSTKYRDFIQVEDVFLTGILAEDLGISVKNLPEFYKY-PSDIEESNPGDVIAWH 309          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: T15D6.5 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9XU74])

HSP 1 Score: 61.2326 bits (147), Expect = 5.611e-10
Identity = 62/236 (26.27%), Postives = 110/236 (46.61%), Query Frame = 1
Query:  586 NIVIIVKSSIGNLEKRNGIRRSW---ASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQAR-PIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVI-GILMFKLNIYPNHLRNIHMYK-PNPIPKNLLACH 1275
            +I++IV S  G++ +R  +R++W   A+ +     + QV F +G V      D  +   +  E+  + DI+  N  D Y N  +KV++++ Y     S+   +  +DDD    P  L   +++ + I+     + GY+       +RN    WYV   AY    YP Y  G F LI+   A  + +   F  + +++D +I GI+   L I  + L  +  Y+  N   K +L+ H
Sbjct:  127 DILMIVASRPGSVSRRKVLRKTWMNKANSKIIRNGRMQVLFLVGMV----AGDRDLMKAVKKEAESFGDIIVMNLEDTYDNLPFKVLSLLLYGTNKASDFKIIGKIDDDVIFFPDRLTPLLDENV-IDSSSYSIYGYLSQDDELVVRNETKPWYVPETAYNCTKYPVYALGPFYLITNKAANLIVENSRFQNFMTVEDALIAGIIAEGLGIQRHSLPMVFRYRFDNTDGKKILSWH 357          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: E03H4.11 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O17750])

HSP 1 Score: 60.4622 bits (145), Expect = 1.005e-9
Identity = 63/241 (26.14%), Postives = 110/241 (45.64%), Query Frame = 1
Query:  580 ENNIVIIVKSSIGNLEKRNGIRRSWASK---ECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGY-IWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVI-GILMFKLNIYPNHLRNIHMYKPNPIPK----NLLACH 1275
            E +I++IV S   +  +RN +R++W +K   E     + +  F +G     +    ++  +  L    Y DI+  +  D Y   TYK +AI+ Y V        +  +D+D    P  L    E+ I I+  P    GY I   AR  R+    WYV   +Y  + +P Y +G   ++++  A+ + K   +  +  ++DV + GIL   L I   +L   + Y PN I +    +++A H
Sbjct:  114 EKDILMIVASRTDSYARRNIMRQTWMNKSDSEIVANGRMKPLFLVGLTPGDYKMKKMVMQEAKL----YGDIIVVDMNDTYEELTYKSLAILLYGVSKAPRYQMIGKIDEDVIFFPDKLTALYEQGI-IDATPLCAYGYKIQAGARIFRDKNDRWYVPESSYSCSKFPEYVSGMLYMVTWEAAQQIIKSTKYRDFIQVEDVFLTGILAEDLGISVRNLPKFYKY-PNDIDESKSVDIIAWH 348          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: bre-5 (Beta-1,3-galactosyltransferase bre-5 [Source:UniProtKB/Swiss-Prot;Acc:Q95US5])

HSP 1 Score: 60.077 bits (144), Expect = 1.083e-9
Identity = 75/268 (27.99%), Postives = 116/268 (43.28%), Query Frame = 1
Query:  439 SFQDFSYPSNVNFYKILQLNDTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVK-YESETP-YLVIVDDDYFLDPSVLV---ETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXX-XXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRN 1224
            SF DFS+P        L+  + ++  K   Y P+     N +K  +        +KSS  N   R  +R++W         +    F +G+V +       I  +ID+ES  Y DI+  + ID+Y NNT K+   +DY     +  +P +  +VDDDY +    LV   +T +KE  + +      G++ +   P R  +    +S   Y    Y P   AG   L S  +AR  N +   LK    DDV  GIL   +N+   H  N
Sbjct:   44 SFGDFSWP--------LETRNLQLRSKFTKY-PQCKFSGNGQKIIIII------IKSSAKNGPMRESVRKTWGVFRMIDGVEVMPIFIVGRVENME-----IMRRIDVESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPDFTFLVDDDYLVHIPNLVKFAKTKQKEELVYE------GFV-FDTSPFRLKIHKHSISLNEYPFSRYPPYVSAGAVFLTSETIARFRNSIRK-LKMFPFDDVFTGILAKTVNVAATHNEN 283          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: C47F8.5 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O62114])

HSP 1 Score: 58.151 bits (139), Expect = 4.706e-9
Identity = 57/241 (23.65%), Postives = 109/241 (45.23%), Query Frame = 1
Query:  574 LTENNIVIIVKSSIGNLEKRNGIRRSWASK---ECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVI-GILMFKLNIYPNHLRNIHMYK---PNPIPKNLLACH 1275
            L   +I+++V S   +  +RN +R++W +K   E     + +  F +G V   +    ++  +  L    Y D+V  +  D Y +  +K ++++ Y V    E   +  +D+D    P  L+  ++ ++       F G  +      I+   ++WYV   AY    YP Y AG F L +   A+ + K   F  + +++D +I GIL   L I   +L +++ +     +   K +LA H
Sbjct:   98 LRSPDILMMVASRTDSFARRNVLRKTWMNKNYSEIVRDGRMKALFLVGMVSEDYRVRRIVMEEAKL----YGDMVVIDLEDTYDDLPFKSLSLLLYAVSKAPEFKVIGKIDEDVMFFPDKLIPLLDGKVIDPDAAAFYGQLLKEGEPVIKKKDAHWYVPDYAYNCTGYPAYVAGPFYLATRKAAKLVLKFTKFQNFMTVEDSLITGILANDLGIPRKNLEHVYRHDYDIQDNEGKEILAWH 334          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: brn (gene:FBgn0000221 transcript:FBtr0070638)

HSP 1 Score: 92.8189 bits (229), Expect = 1.534e-20
Identity = 61/219 (27.85%), Postives = 105/219 (47.95%), Query Frame = 1
Query:  586 NIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKP 1242
             + +++KS++GN  +R  IRR+W  +   +    +  F LG        DS  +  +  ES ++ DI+Q  F D Y NNT K M  M +     + + + + VDDDY++    +++ + +     Q      G++ +Q  P+R+  S WYVS + Y ++ +PPY   G  ++S    R L      L     DDV +GI+  K  I   H  +   ++P
Sbjct:   79 RLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTA-----EDS--EKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHV-FQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRP 289          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0073310)

HSP 1 Score: 68.1662 bits (165), Expect = 4.863e-12
Identity = 63/203 (31.03%), Postives = 104/203 (51.23%), Query Frame = 1
Query:  592 VIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEK----EITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVI-GIL 1185
            +I+V S++ N+EKR  IR +WA++        +VYF +G V +        Q  +  E+  + D++Q NF D Y N TYK +  + +F +  +    LV VDDD F++   LV+ +      E ++ + P  +     + +R  R+  S W V+YK Y   +YP Y  G  ++ +  + R L +     KY  +DDV+I GIL
Sbjct:  137 LILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSA---KSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGIL 336          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0304987)

HSP 1 Score: 68.1662 bits (165), Expect = 4.863e-12
Identity = 63/203 (31.03%), Postives = 104/203 (51.23%), Query Frame = 1
Query:  592 VIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEK----EITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVI-GIL 1185
            +I+V S++ N+EKR  IR +WA++        +VYF +G V +        Q  +  E+  + D++Q NF D Y N TYK +  + +F +  +    LV VDDD F++   LV+ +      E ++ + P  +     + +R  R+  S W V+YK Y   +YP Y  G  ++ +  + R L +     KY  +DDV+I GIL
Sbjct:  137 LILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSA---KSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGIL 336          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0113143)

HSP 1 Score: 68.1662 bits (165), Expect = 4.863e-12
Identity = 63/203 (31.03%), Postives = 104/203 (51.23%), Query Frame = 1
Query:  592 VIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEK----EITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVI-GIL 1185
            +I+V S++ N+EKR  IR +WA++        +VYF +G V +        Q  +  E+  + D++Q NF D Y N TYK +  + +F +  +    LV VDDD F++   LV+ +      E ++ + P  +     + +R  R+  S W V+YK Y   +YP Y  G  ++ +  + R L +     KY  +DDV+I GIL
Sbjct:  137 LILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSA---KSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGIL 336          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0113142)

HSP 1 Score: 68.1662 bits (165), Expect = 4.863e-12
Identity = 63/203 (31.03%), Postives = 104/203 (51.23%), Query Frame = 1
Query:  592 VIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEK----EITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVI-GIL 1185
            +I+V S++ N+EKR  IR +WA++        +VYF +G V +        Q  +  E+  + D++Q NF D Y N TYK +  + +F +  +    LV VDDD F++   LV+ +      E ++ + P  +     + +R  R+  S W V+YK Y   +YP Y  G  ++ +  + R L +     KY  +DDV+I GIL
Sbjct:  137 LILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSA---KSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGIL 336          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2078])

HSP 1 Score: 87.4261 bits (215), Expect = 4.346e-18
Identity = 61/217 (28.11%), Postives = 107/217 (49.31%), Query Frame = 1
Query:  565 KDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPR--FLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            K N +   +V+++ +    LE RN IR++W ++     + F   F LG++      ++  Q+ +D ES  ++DI+Q +F+D Y N T K +  M +  +Y     Y++  D D F++   L++ + K  T    PR  +  GY+     P RN  S WY+  + Y    YP + +G   + S  MA  +      ++   ++DV +GI + KL I P
Sbjct:  157 KCNESSPFLVLLIAAEPRQLEARNAIRQTWGNESVAMGYGFVRLFLLGRI-----PNAYPQSSVDEESLQHHDIIQQDFLDTYYNLTIKTLMGMSWVARYCPHARYVMKTDSDMFVNTEYLIQKLLKPNTA---PRQNYFTGYLMRGYAPNRNKDSKWYMPPELYSSERYPIFCSGTGYVFSGDMAAKIYNASLSIRRLHLEDVYVGICLAKLRIDP 365          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2078])

HSP 1 Score: 87.4261 bits (215), Expect = 4.346e-18
Identity = 61/217 (28.11%), Postives = 107/217 (49.31%), Query Frame = 1
Query:  565 KDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPR--FLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            K N +   +V+++ +    LE RN IR++W ++     + F   F LG++      ++  Q+ +D ES  ++DI+Q +F+D Y N T K +  M +  +Y     Y++  D D F++   L++ + K  T    PR  +  GY+     P RN  S WY+  + Y    YP + +G   + S  MA  +      ++   ++DV +GI + KL I P
Sbjct:  157 KCNESSPFLVLLIAAEPRQLEARNAIRQTWGNESVAMGYGFVRLFLLGRI-----PNAYPQSSVDEESLQHHDIIQQDFLDTYYNLTIKTLMGMSWVARYCPHARYVMKTDSDMFVNTEYLIQKLLKPNTA---PRQNYFTGYLMRGYAPNRNKDSKWYMPPELYSSERYPIFCSGTGYVFSGDMAAKIYNASLSIRRLHLEDVYVGICLAKLRIDP 365          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: zgc:162952 (zgc:162952 [Source:ZFIN;Acc:ZDB-GENE-070424-98])

HSP 1 Score: 85.8853 bits (211), Expect = 4.953e-18
Identity = 61/226 (26.99%), Postives = 113/226 (50.00%), Query Frame = 1
Query:  532 EPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            +PEV  +K           +++++  ++ + E R  IRR+W              F +GQ   P  +D ++Q  +  ES ++ DI+Q +F+D+Y N T K M IM++   Y     Y + +D D FL+   LV+ +  +   E    ++ G +   A P R+S++ WY+S   Y  ++YPPY +G   + S  +A  ++    F++   ++DV +G+ +  L + P
Sbjct:   60 QPEVCEKKT--------PFLILMIPVTLKDAEARTAIRRTWGQDGLVPGVSILHLFVVGQ---PARSDPVLQEHLQKESKEHGDIIQMDFVDSYQNLTIKTMMIMNWVATYCQSAWYAMKIDADIFLNVHYLVDYLHGQ--GESRKDYITGSVISDAIPHRDSINKWYISEDLYPKSWYPPYVSGAAYVFSTDLAGKISWASRFVQPIPLEDVYVGLCLDVLGVKP 272          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3gnt7l (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7, like [Source:ZFIN;Acc:ZDB-GENE-040718-143])

HSP 1 Score: 83.5741 bits (205), Expect = 5.711e-17
Identity = 58/199 (29.15%), Postives = 99/199 (49.75%), Query Frame = 1
Query:  625 EKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPN-HL 1218
            ++R  +R++W  ++     + +  F LG   +P      +Q  +  E   Y DI+Q++F+D + N T K +  + +F  Y  + P++   DDD F+    LVE I       +    + G    +A+PIRN  S +++  + Y   Y P    GGF L+S  +AR +  +   ++   IDDV +G+ + KLNI P  HL
Sbjct:  160 DRREAVRKTWGKEQEIQGLKIKTLFLLG-TPAPGKDSRNLQALVQYEDRTYGDILQWDFMDTFFNLTLKEVNFLRWFSIYCPDVPFIFKGDDDVFVHTKNLVELIGFRKEENKVENLIVGDAILEAKPIRNRQSKYFIPRELYDKRYPPYLGGGGF-LMSSQVARKVFTVSESVELYPIDDVFVGMCLQKLNIVPEVHL 356          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:ZFIN;Acc:ZDB-GENE-021210-4])

HSP 1 Score: 82.8037 bits (203), Expect = 1.204e-16
Identity = 59/210 (28.10%), Postives = 106/210 (50.48%), Query Frame = 1
Query:  580 ENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            E +++I++KS I   ++R  IR++W  ++     + +  F LG+  S     +  Q  ++ E   Y DI+Q++F+D++ N T K +  + +F  Y  +T Y+   DDD F+    + E +E    ++       G + ++A+PIR   + +Y+    Y    YPPY  GG  L+   +AR L      L+   IDDV +G+ +  L + P
Sbjct:  152 EIDLLIVIKSVITQFDRREVIRKTWGKEQVLNGKRIKTLFLLGKS-SNLEERANHQKLLEYEDYIYGDILQWDFMDSFFNLTLKEIHFLKWFSSYCPKTQYIFKGDDDVFVSVPNIFEYLEISGNLKD---LFVGDVLFKAKPIRKKQNKYYIPQALYNKTLYPPYAGGGGFLMDGALARKLYGACETLELYPIDDVFLGMCLEVLQVTP 357          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000027493.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:7556014:7559433:-1 gene:ENSXETG00000012877.1 transcript:ENSXETT00000027493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 7.361e-20
Identity = 68/236 (28.81%), Postives = 118/236 (50.00%), Query Frame = 1
Query:  523 FPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIH 1230
            F   P+V  E+N          +V++V ++    E+RN IR++W  +          YF LG   +P   + LI+     ES  YNDI+Q +FID+Y N T K +  +++   +  +T +++  D D F++P  LVE + K+    Q      G +     PIR+  S WY+S   Y    YPP+ +G   + S  +A+ +  +   + +  ++DV +G+ + KL I   +L+N+H
Sbjct:   20 FQLRPKVQCERN-------PPFLVLLVTTNHSQKEERNVIRQTWGKERLIGDKLVSTYFLLGAGTNPRLQEELIE-----ESNTYNDIIQRDFIDSYYNLTLKTIMGIEWICTHCPQTTFVMKTDTDMFVNPLYLVELLVKK---NQTTDLFTGSLRLHDAPIRDINSKWYISTAEYPQAKYPPFCSGTGYVFSVDVAQRIQNVSSTVPFFKLEDVYVGMCLEKLEI---NLQNLH 237          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: meis2 (Meis homeobox 2 [Source:Xenbase;Acc:XB-GENE-487675])

HSP 1 Score: 89.7373 bits (221), Expect = 2.970e-19
Identity = 66/243 (27.16%), Postives = 122/243 (50.21%), Query Frame = 1
Query:  502 TKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIH 1230
            +  + + F   P++  E+N          +V++V ++    E RN IR++W  +          YF LG   +P      +Q ++  ES  YNDI+Q +FID+Y N T K +  +++   +  +T +++  D D F++P  LVE + K+    Q      G +     PIRN+ S +Y+S   Y    YPP+ +G   + S  +A+ +  +   + +  ++DV +G+ + K+NI   +L+N+H
Sbjct:   44 SATVRETFQLRPKIQCERN-------PPFLVLLVTTTHSQKEARNVIRQTWGKERLIGDKLVSTYFLLGAGTNPR-----LQGELTGESNTYNDIIQRDFIDSYYNLTLKTIMGIEWICTHCPQTTFVMKTDTDMFVNPLYLVELLVKK---NQTTDVFTGSLRLHDAPIRNNHSKYYISTTEYPLAKYPPFCSGTGYVFSVDVAQKIQNVSSTVPFFKLEDVFVGMCLEKVNI---NLQNLH 268          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000027497.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:7442414:7443358:1 gene:ENSXETG00000012871.1 transcript:ENSXETT00000027497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 5.342e-19
Identity = 72/263 (27.38%), Postives = 127/263 (48.29%), Query Frame = 1
Query:  442 FQDFSYPSNVNFYKILQLNDTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIH 1230
             QDF       FY     + T  + + F   P++  E+N          +V++V ++    E+RN IR++W  +          YF LG   +PH    LI+     ES  YNDI+Q +FID Y N T K +  +++   Y  +T +++  D D F++   LVE + K+    Q   F  G +     P+R+  S WY++ K +    YPP+ +G   + S  +A+ +  +   + +  ++DV +G+ + K+ I   +L+N+H
Sbjct:   26 LQDFCTICGKIFYSPSLRSAT--VRETFQLRPKIQCERN-------PPFLVLLVTTTHSQKEERNVIRQTWGKERLIGDKLVSSYFLLGAGTNPHLQGELIE-----ESNTYNDIIQRDFIDTYYNLTLKTIMGVEWICTYCPQTTFVMKTDTDMFVNTLYLVELLIKK---NQTTDFFTGSLRLDDGPVRDINSKWYINEKEFPGTKYPPFCSGTGYVFSVDVAQKIQNVSSTVPFFKLEDVFVGMCLEKVKI---NLQNLH 268          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: ENSXETT00000027495.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:7488344:7489261:-1 gene:ENSXETG00000012875.1 transcript:ENSXETT00000027495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 6.262e-19
Identity = 71/239 (29.71%), Postives = 119/239 (49.79%), Query Frame = 1
Query:  523 FPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTL---NKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIH 1230
            F  +P+V  E+N          +V++V ++   LE RN IR++W  K      +   YF LG V +    + LI+     ES  YNDI+Q +FID Y N T K +  +++   +  +T +L+  D D F++   LVE + K+    Q      G +     PIR+  S WY+S K +  + Y P+ +G   + S  +A  +   +  +PF K   ++DV +G+ + KL I    L+++H
Sbjct:   42 FLLKPKVQCERN-------PPFLVLLVTTTHSQLEARNAIRQTWGKKRQIGDKRVFTYFLLGTVTNLRLQEELIE-----ESNTYNDIIQRDFIDTYYNLTLKTIMGVEWICTHCPQTTFLMKTDTDMFVNTLYLVELLVKK---NQTTNLFTGSLREDDEPIRDMNSKWYISEKEFPGSKYAPFCSGTGYVFSVDIAHKILNVSSTVPFFK---LEDVYVGMCLEKLEI---KLQDLH 259          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: wdr19 (WD repeat domain 19 [Source:Xenbase;Acc:XB-GENE-920013])

HSP 1 Score: 87.4261 bits (215), Expect = 8.118e-19
Identity = 63/225 (28.00%), Postives = 112/225 (49.78%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIPKNL 1263
            +V++V ++    E+RN IR++W  +          YF LG   +P      +Q ++  ES  YNDI+Q +FID+Y N T K +  +++   +  +T +++  D D F++P  LVE + K+    Q      G +     P+R+  S WY+S   Y    YPP+ +G     S  +A+ +  +   + +  ++DV +G+ + KL I   +L     + P  IP N+
Sbjct:   18 LVLLVTTTHSQKEERNVIRQTWGKERLIGDKLVSTYFLLGAGTNPR-----LQEELTGESNTYNDIIQRDFIDSYYNLTLKTIMGIEWICTHCPQTTFVMKTDTDMFVNPLYLVELLVKK---NQTTNLFTGSLKPHDAPVRDINSKWYISTTEYPLAKYPPFCSGTGYAFSVDVAQRIQNVSGSVPFFKLEDVYVGMCLEKLEINLENLHTEPTFFPYKIPFNI 234          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt5 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 [Source:MGI Symbol;Acc:MGI:2136878])

HSP 1 Score: 94.7449 bits (234), Expect = 4.390e-21
Identity = 70/238 (29.41%), Postives = 116/238 (48.74%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMA---RTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIP------KNLLACH 1275
            +V++V SS   L  R  IR++W  +      Q + +F LG   S    D+       LES  + DI+Q +F D Y N T K M  M++   +  +T Y++  D D F++   L E + K+    +  RF  GYI     PIR   + W+VS   Y ++ YPP+ +G   + S  +A     +++ +PF+K   ++DV +G+ + KL I P  L     + P  +       + ++ACH
Sbjct:   57 LVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDA-----TTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELLLKK---NKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIK---LEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVACH 283          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt5 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 [Source:MGI Symbol;Acc:MGI:2136878])

HSP 1 Score: 94.7449 bits (234), Expect = 4.390e-21
Identity = 70/238 (29.41%), Postives = 116/238 (48.74%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMA---RTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIP------KNLLACH 1275
            +V++V SS   L  R  IR++W  +      Q + +F LG   S    D+       LES  + DI+Q +F D Y N T K M  M++   +  +T Y++  D D F++   L E + K+    +  RF  GYI     PIR   + W+VS   Y ++ YPP+ +G   + S  +A     +++ +PF+K   ++DV +G+ + KL I P  L     + P  +       + ++ACH
Sbjct:   57 LVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDA-----TTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELLLKK---NKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIK---LEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVACH 283          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:MGI Symbol;Acc:MGI:1349461])

HSP 1 Score: 81.6481 bits (200), Expect = 3.120e-16
Identity = 63/228 (27.63%), Postives = 106/228 (46.49%), Query Frame = 1
Query:  532 EPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPR--FLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            EPE   EK+          +++++ +  G +E R  IR++W ++      Q    F LG        +  +Q  I  ES  Y+DI+Q  ++D Y N T K +  M++   Y   TPY++  D D F++   L   I K +  +  PR  +  GY+     P RN  S WY+    Y    YP + +G   + S  +A  + K+   ++   ++DV +GI + KL + P
Sbjct:  142 EPEKCQEKS--------PFLILLIAAEPGQIEARRAIRQTWGNETLAPGIQIIRVFLLGISI---KLNGYLQHAIQEESRQYHDIIQQEYLDTYYNLTIKTLMGMNWVATYCPHTPYVMKTDSDMFVNTEYL---IHKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAKLRVDP 355          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3gnt6 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 (core 3 synthase) [Source:MGI Symbol;Acc:MGI:3039603])

HSP 1 Score: 80.4925 bits (197), Expect = 6.419e-16
Identity = 59/252 (23.41%), Postives = 118/252 (46.83%), Query Frame = 1
Query:  487 LQLNDTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTK--IDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMY 1236
            L+    +  P+L+   P+    + +         +++ VKSS  + E+R  IRR+W  +   +  Q    F +G    P  A    Q    + LE+ +Y D++Q++F D ++N T K + ++D+  ++     +L+  DDD F+  + ++  +E + + E +     G +   + P+R S S ++V  + +    YP Y +GG  L+S    R L      +    IDD  +G+ + +  + P+  + I  +
Sbjct:   88 LRYRHCRRFPQLWDAPPKCAGPRGV--------FLLLAVKSSPAHYERRELIRRTWGQERSYSGRQVLRLFLVG-TSPPEEAAREPQLADLLSLEAREYGDVLQWDFSDTFLNLTLKHLHLLDWTAEHCPGVSFLLSCDDDVFVHTANVLSFLEVQ-SPEHH--LFTGQLMVGSVPVRESGSKYFVPPQIFPGVAYPAYCSGGGFLLSRYTVRNLRSAAHHVPLFPIDDAYMGMCLQQAGLAPSSHQGIRPF 327          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:MGI Symbol;Acc:MGI:2384394])

HSP 1 Score: 77.7962 bits (190), Expect = 5.199e-15
Identity = 60/211 (28.44%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASK---ECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPN 1212
            ++++VKS I   ++R  IR++W  +           +  F LG   S     +  Q  +  E   Y DI+Q++F+D++ N T K +  + +   Y    P++   DDD F++P+ L+E +      E       G +   ARPIR   + +Y+    Y    YPPY  GG  L+S  +AR L+     L+   IDDV +G+ +  L + P 
Sbjct:  132 MLVVVKSVITQHDRREVIRQTWGHEWESAGLGRGAVRTLFLLGTA-SKQEERTHYQQLLAYEDRLYADILQWDFLDSFFNLTLKEIHFLKWLDIYCPNVPFVFKGDDDVFVNPTNLLEFLSDRQPQEN---LFVGDVLKHARPIRKKDNKYYIPAVMYGKATYPPYAGGGGFLMSGSLARQLHHACDTLELFPIDDVFLGMCLEVLGVKPT 338          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q9JI67|B3GT5_MOUSE (Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 3.071e-20
Identity = 70/238 (29.41%), Postives = 116/238 (48.74%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMA---RTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIP------KNLLACH 1275
            +V++V SS   L  R  IR++W  +      Q + +F LG   S    D+       LES  + DI+Q +F D Y N T K M  M++   +  +T Y++  D D F++   L E + K+    +  RF  GYI     PIR   + W+VS   Y ++ YPP+ +G   + S  +A     +++ +PF+K   ++DV +G+ + KL I P  L     + P  +       + ++ACH
Sbjct:   57 LVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDA-----TTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELLLKK---NKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIK---LEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVACH 283          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q24157|BRN_DROME (Beta-1,3-galactosyltransferase brn OS=Drosophila melanogaster OX=7227 GN=brn PE=2 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.538e-19
Identity = 61/219 (27.85%), Postives = 105/219 (47.95%), Query Frame = 1
Query:  586 NIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKP 1242
             + +++KS++GN  +R  IRR+W  +   +    +  F LG        DS  +  +  ES ++ DI+Q  F D Y NNT K M  M +     + + + + VDDDY++    +++ + +     Q      G++ +Q  P+R+  S WYVS + Y ++ +PPY   G  ++S    R L      L     DDV +GI+  K  I   H  +   ++P
Sbjct:   79 RLTMLIKSAVGNSRRREAIRRTWGYEGRFSDVHLRRVFLLGTA-----EDS--EKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFYLFVDDDYYVSAKNVLKFLGRGRQSHQPELLFAGHV-FQTSPLRHKFSKWYVSLEEYPFDRWPPYVTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRP 289          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q9N294|B3GT5_PANPA (Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan paniscus OX=9597 GN=B3GALT5 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 9.546e-19
Identity = 64/236 (27.12%), Postives = 117/236 (49.58%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTK-IDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIP------KNLLACH 1275
            +V++V SS   L +R  IR++W  +      Q + +F LG         S  +TK +D ES  + DI+Q +F+D Y N T K M  +++  ++  +  +++  D D F++   L E + K+    +  RF  G++     PIR   S W+VS   Y ++ YPP+ +G   + S  +A  +  +   + Y  ++DV +G+ + +LNI    L +   + P  +       + ++ACH
Sbjct:   59 LVLLVTSSHKQLAERMAIRQTWGKERTVKGKQLKTFFLLG------TTSSAAETKEVDQESQRHGDIIQKDFLDGYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKK---NRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSESVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCRFRRIVACH 285          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q9N293|B3GT5_GORGO (Beta-1,3-galactosyltransferase 5 (Fragment) OS=Gorilla gorilla gorilla OX=9595 GN=B3GALT5 PE=3 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 2.832e-18
Identity = 75/284 (26.41%), Postives = 131/284 (46.13%), Query Frame = 1
Query:  445 QDFSYPSNVNFYKILQLNDTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTK-IDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIP------KNLLACH 1275
            Q F Y  +VNF K L   D +  P   P+                   +V++V SS   L +R  IR++W  +      Q + +F LG         S  +TK +D ES  + DI+Q +F+D Y N T K M  +++  ++  +  +++  D D F++   L E + K+    +  RF  G++     PIR   S W+VS   Y ++ YPP+ +G   + S  +A  +  +   + Y  ++DV +G+ + +LNI    L +   + P  +       + ++ACH
Sbjct:   34 QSFVYKKDVNFLK-LPDTDCRQTP---PF-------------------LVLLVTSSHKQLAERMAIRQTWGKERTVKGKQLKTFFLLG------TTSSAAETKEVDQESRRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKK---NRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSESVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCRFRRIVACH 285          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q9N295|B3GT5_PANTR (Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan troglodytes OX=9598 GN=B3GALT5 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.187e-18
Identity = 64/236 (27.12%), Postives = 117/236 (49.58%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTK-IDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIP------KNLLACH 1275
            +V++V SS   L +R  IR++W  +      Q + +F LG         S  +TK +D ES  + DI+Q +F+D Y N T K M  +++  ++  +  +++  D D F++   L E + K+    +  RF  G++     PIR   S W+VS   Y ++ YPP+ +G   + S  +A  +  +   + Y  ++DV +G+ + +LNI    L +   + P  +       + ++ACH
Sbjct:   59 LVLLVTSSHRQLAERMAIRQTWGKERTVKGKQLKTFFLLG------TTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKK---NRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSESVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCRFRRIVACH 285          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A4S2LBY2 (Hexosyltransferase OS=Opisthorchis felineus OX=147828 GN=CRM22_008735 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 2.522e-42
Identity = 100/274 (36.50%), Postives = 165/274 (60.22%), Query Frame = 1
Query:  451 FSYPSNVNFYKILQL----NDTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQF--QVYFALGQVYSPHNADSLI--QTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMY-KPN 1245
            F+YP ++N ++I  L    +++K+ P++ P    ++ ++ + K++     ++ +VKS   N  +R  IRRSW +  C  +     +  F LGQ+   + +   I  Q K++LE T Y+DIVQF+F+D+Y NNTYK+++ M++         ++ I+DDD+ + P  L++TI  ++T  QYP ++ G +   A+P R+  S WYV Y AY ++ YP YP GG ++IS PM + L+ +MP+  Y  IDDV++GIL+ KL I P HL  IH + KP 
Sbjct:   36 FAYPPDMNLFQIYDLVRTKDNSKLPPRMMPKFRALLYDRGVCKESPLPK-LLFLVKSVHRNFAQREQIRRSWGNPMCAKSTGVISRTVFLLGQLKDKNASQEAIVLQRKLELEQTKYHDIVQFDFVDSYANNTYKILSGMEFVCSECPMARFVAILDDDFLVHPINLIKTIN-QVTEFQYPIYVAGGVISSAQPRRSPFSKWYVPYNAYPFHIYPDYPTGGTIIISMPMVKLLSTVMPYTAYLYIDDVLLGILLHKLGINPVHLDGIHFFAKPT 307          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A4S2L9Z5 (Hexosyltransferase OS=Opisthorchis felineus OX=147828 GN=CRM22_008735 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 4.412e-42
Identity = 98/270 (36.30%), Postives = 163/270 (60.37%), Query Frame = 1
Query:  451 FSYPSNVNFYKILQL----NDTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQF--QVYFALGQVYSPHNADSLI--QTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMY 1236
            F+YP ++N ++I  L    +++K+ P++ P    ++ ++ + K++     ++ +VKS   N  +R  IRRSW +  C  +     +  F LGQ+   + +   I  Q K++LE T Y+DIVQF+F+D+Y NNTYK+++ M++         ++ I+DDD+ + P  L++TI  ++T  QYP ++ G +   A+P R+  S WYV Y AY ++ YP YP GG ++IS PM + L+ +MP+  Y  IDDV++GIL+ KL I P HL  IH +
Sbjct:   66 FAYPPDMNLFQIYDLVRTKDNSKLPPRMMPKFRALLYDRGVCKESPLPK-LLFLVKSVHRNFAQREQIRRSWGNPMCAKSTGVISRTVFLLGQLKDKNASQEAIVLQRKLELEQTKYHDIVQFDFVDSYANNTYKILSGMEFVCSECPMARFVAILDDDFLVHPINLIKTIN-QVTEFQYPIYVAGGVISSAQPRRSPFSKWYVPYNAYPFHIYPDYPTGGTIIISMPMVKLLSTVMPYTAYLYIDDVLLGILLHKLGINPVHLDGIHFF 333          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A419PDI8 (Hexosyltransferase OS=Clonorchis sinensis OX=79923 GN=b3gnt5-a PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 3.744e-41
Identity = 106/289 (36.68%), Postives = 170/289 (58.82%), Query Frame = 1
Query:  451 FSYPSNVNFYKILQL----NDTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQF--QVYFALGQVYSPHNAD---SLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETP---YLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMY-KPN-PIPKNLLACH 1275
            F YP ++N +KI  L    ++ K+ P+  P    ++ ++++ KD+     ++ +VKS   N  +R  IR SW +  C  +     +  F LGQ+    NA    S++Q K++LE   Y+DIVQFNF+D+Y NNTYK+++ M++     SE P   ++ I+DDD+ + P  L++TI  ++T  QYP ++ G +     P R+  S WYV Y+ Y +  YP YP GG ++IS PM + L+ +MP+  Y  IDDV++GI++ KL I P HL  IH++ KP   I +N ++ H
Sbjct:   36 FQYPPDMNLFKIYDLVRTKDNRKLPPRTMPKFRALLYDRHVCKDSPVPK-LLFLVKSIHSNFAQREQIRNSWGNPMCAKSTGVISRTVFLLGQLKD-RNASREASVLQRKLELEQKKYHDIVQFNFVDSYANNTYKILSAMEF---ASSECPMARFVAILDDDFLVHPVNLIKTIN-QVTDFQYPIYIAGDVISAGEPRRSPFSKWYVPYRVYPFYIYPDYPTGGTIIISMPMVKLLSTVMPYTAYLYIDDVLLGIILHKLGINPVHLDGIHLFSKPAFLIEQNFISAH 318          
BLAST of Hexosyltransferase vs. TrEMBL
Match: H2KTU4 (Hexosyltransferase (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_106211 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.033e-40
Identity = 106/289 (36.68%), Postives = 170/289 (58.82%), Query Frame = 1
Query:  451 FSYPSNVNFYKILQL----NDTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQF--QVYFALGQVYSPHNAD---SLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETP---YLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMY-KPN-PIPKNLLACH 1275
            F YP ++N +KI  L    +++K+ P+  P    ++ ++++ KD+     ++ +VKS   N  +R  IR SW +  C  +     +  F LGQ+    NA    S +Q K++LE   Y+DIVQFNF+D+Y NNTYK+++ M++     SE P   ++ I+DDD+ + P  L++TI  ++T  QYP ++ G +     P R+  S WYV Y+ Y +  YP YP GG ++IS PM + L+ +MP+  Y  IDDV++GI++ KL I P HL  IH++ KP   I +N ++ H
Sbjct:   61 FQYPPDMNLFKIYDLVRTKDNSKLPPRTMPKFRALLYDRHVCKDSPVPK-LLFLVKSIHSNFAQREQIRNSWGNPMCAKSTGVISRTVFLLGQLKD-RNASREASELQRKLELEQKKYHDIVQFNFVDSYANNTYKILSAMEF---ASSECPMARFVAILDDDFLVHPVNLIKTIN-QVTDFQYPIYIAGDVISAGEPRRSPFSKWYVPYRVYPFYIYPDYPTGGTIIISMPMVKLLSTVMPYTAYLYIDDVLLGIILHKLGINPVHLDGIHLFSKPAFLIEQNFISAH 343          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A2H1CGM1 (Hexosyltransferase OS=Fasciola hepatica OX=6192 GN=D915_06123 PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 6.467e-39
Identity = 98/276 (35.51%), Postives = 158/276 (57.25%), Query Frame = 1
Query:  457 YPSNVNF---------YKILQLNDTKVIPKLFPY--EPEVMNE----KNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECK--TTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHM 1233
            YP NVN          YK    N   + P  FP    P  + E    + I  +N T  +I+ ++KS + + ++R  IR +W++  C      + Q  FALG   SP +A   ++TK+  E   YND++QF F+D+Y NNTYK+M  +DY  +   +T +++IVDDD+ ++ + +++TI  E+T  +Y  ++ G ++Y  +P R   S W+VSYK Y Y  +PPYP+GG ++IS P+ R L   MPF+K+  IDD  +GI+++K  I P  L  +++
Sbjct:   23 YPLNVNLNDTYTKLSLYKTWMPNVHSINPANFPLIRAPLSLCEPVLIQTISPENKTYLDILFVIKSRLHSFDQRRTIRNTWSNATCALMAGARIQTVFALGTTASPESA---LETKLHEEHDRYNDLLQFGFVDSYYNNTYKIMTALDYISRTCQDTKFVIIVDDDFLVNLNNIIQTIS-EVTTAEYSTYISGLVFYTQQPDRRPWSKWFVSYKEYPYRLFPPYPSGGTVVISMPVVRLLAAGMPFVKFFWIDDAYMGIVLYKYGIIPKLLPGVYL 294          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3gnt7l (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7, like [Source:ZFIN;Acc:ZDB-GENE-040718-143])

HSP 1 Score: 89.3521 bits (220), Expect = 5.901e-19
Identity = 65/212 (30.66%), Postives = 108/212 (50.94%), Query Frame = 1
Query:  586 NIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP-NHL 1218
            +++++VKS I   E+R  +RR+W ++      + +  F LG   SP      +Q  ++ E   Y DI+Q++F D + N T K +  + +F  Y + TP++   DDD F+    LVE I+      +      G    +A PIRN  S +Y+  + +   Y P    GGF++ S+ +AR L  +   L+   IDDV +G+ + KL   P +HL
Sbjct:  141 DVLLVVKSVIEQHERREAVRRTWGAERTVRGRRVRTLFLLG-TPSPGKDARNLQKLLEYEDRIYGDILQWDFQDTFFNLTLKEVNFLRWFNIYCAHTPFVFKGDDDVFVSTDNLVELIDFRSDEGRARELFVGDTISKAIPIRNQHSKYYIPRELFDKPYPPYVGGGGFLMSSW-IARQLFVVSEGLELFPIDDVFLGMCLQKLGRTPESHL 350          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:NCBI gene;Acc:103046609])

HSP 1 Score: 83.9593 bits (206), Expect = 3.602e-17
Identity = 59/208 (28.37%), Postives = 106/208 (50.96%), Query Frame = 1
Query:  586 NIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            ++++++KS I   ++R  IR++W  ++     + +  F LG   S  +  +  Q  ++ E   Y DI+Q++F+D++ N T K    + +F  Y     Y+   DDD F+    ++E +E    ++       G + ++ARPIR   + +Y+ +  Y   YYPPY  GG  L+  P+AR L      L+   IDDV +G+ +  L + P
Sbjct:  147 HLLMVIKSIISQHDRREVIRQTWGKEQVINGKRIKTLFLLG-TSSVESERANHQKLLEYEDYIYGDILQWDFMDSFFNLTLKETHFLKWFSTYCGNVRYIFKGDDDVFVSVQNIMEYLEDSSDVKN---LFAGDVLFKARPIRRKENKYYIPHALYNKTYYPPYAGGGGFLMDGPLARKLYLASETLELYPIDDVFLGMCLEVLQVTP 350          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: si:ch211-250e5.2 (beta-1,3-galactosyltransferase 2-like [Source:NCBI gene;Acc:111197654])

HSP 1 Score: 80.8777 bits (198), Expect = 3.418e-16
Identity = 62/219 (28.31%), Postives = 108/219 (49.32%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPR--FLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYK 1239
            +V++V  +   LE RN IR +W ++         V F +G    P       Q +++LES  Y+D++Q +F+D Y+N T K M IMD+      +  Y + VD D FL+    ++ +   +   + PR  ++ G + +    IR+  S WYV  + Y  +YYP Y  G   + S  + + L ++   ++  +I+D  +G  + KL I P+   N   +K
Sbjct:  127 LVLMVPVAPHELEARNAIRSTWGNETVVQGKTVTVLFLVGL---PGIKTEKQQEELNLESQKYHDLIQSDFMDTYLNLTIKTMVIMDWLATRCPQAAYSMKVDSDMFLN----LDNMMNLLLAPETPRINYITGMVMWNRPVIRDPASKWYVPQELYPEDYYPTYLLGMGYIFSNDLPKKLVEVSKDIQPFNIEDAYVGTCLKKLGIAPSTPPNPSQFK 338          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: zgc:194679 (zgc:194679 [Source:ZFIN;Acc:ZDB-GENE-030131-2847])

HSP 1 Score: 80.4925 bits (197), Expect = 3.911e-16
Identity = 73/229 (31.88%), Postives = 112/229 (48.91%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADS--LIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPR--FLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYN-SIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIPKN 1260
            +V++V  + GN E R  IRR+W S+         +YF LG+     NA++   +Q  +  ES+ ++DI+Q +FID+Y N T K M IM++   Y     Y + VD D FL+ + LV        + Q PR  +L G + Y A   R+  S WY     +  + YPPY  G   + S  + + L      L+ N  I+DV IG++M  L I      +  ++   P P N
Sbjct:  112 LVLMVPVAAGNKEAREIIRRTWGSETKVMDQLVSMYFMLGET----NAENKQYMQEMLQNESSTHHDIIQSDFIDSYNNLTIKTMVIMEWLASYCHMASYAMKVDSDIFLNVNKLVS------VVLQAPRENYLTGLMAYDAIVHRDPNSKWYFPEAVFPRSSYPPYALGLGYVFSMDLPKKLVDGAKQLEQNIYIEDVNIGLIMDHLKISYTSHSDQSLFNVFPFPFN 330          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3galt2 (beta-1,3-galactosyltransferase 2 [Source:NCBI gene;Acc:103041183])

HSP 1 Score: 79.7221 bits (195), Expect = 1.182e-15
Identity = 59/209 (28.23%), Postives = 103/209 (49.28%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPR--FLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            +++++ +  G +E RN IR++W ++       F   F LG   S    +S  Q+ I+ ES   +DI+Q  ++D Y N T K +  M++  ++     Y++  D D F++   L   I+K +  E  PR  +  GY+     P RN  S WY+  + Y    YP + +G   + S  MA  + +    ++   ++DV +GI + KL I P
Sbjct:  159 LILLIAAEPGQVEARNAIRQTWGNESVAMGLGFVRLFLLGMGSS---TNSYPQSAIEEESLQNHDIIQQEYMDTYYNLTIKTLMGMNWVAEHCPHANYVMKTDSDMFVNTEYL---IKKLLKPELPPRHNYFTGYLMRGYAPNRNKDSKWYMPPELYSSERYPIFCSGTGYVFSGDMAAKIYQASLSIRRLHLEDVYVGICLAKLRIDP 361          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2078])

HSP 1 Score: 86.6557 bits (213), Expect = 2.210e-19
Identity = 58/210 (27.62%), Postives = 107/210 (50.95%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSL-IQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEK-EITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPN 1212
            +V+++ S    L+ R  IR +W ++        +  F LG   +P  A SL +Q+ ++ ES  + D++Q NF+D Y N T K M  + +  ++ S+  Y++  D D F++   LV T+ K E+     P +  GY+     P RN  S WY+  + Y    YP + +G   ++S  +A  + ++   ++   ++DV +G+ + KL + P 
Sbjct:   11 LVLLISSVPAQLDARQAIRDTWGNESLVPGIVIKRLFLLGA--APAEAGSLRVQSLLEEESRRHGDLLQQNFVDTYYNLTLKTMMGLHWVSEHCSDAAYVMKTDSDMFVNVEFLVSTVLKPELHQPSLPDYFTGYLMRGYSPNRNPESKWYMPVEVYPGERYPTFCSGTGYVLSGTLAARVYRVSLTIRRLHLEDVYVGLCLAKLRVTPT 218          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2078])

HSP 1 Score: 80.8777 bits (198), Expect = 1.593e-17
Identity = 58/209 (27.75%), Postives = 98/209 (46.89%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTH-QFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPR-FLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            +V++V S     E R  IR +WAS+        F+  F LG      +A    Q +I+ ES  + D++Q NF D Y N T K M  + +   +     Y++  D D F++  VLV+ + ++      PR +  GY+     P RN  S WY+    Y    YP + +G   ++S  +A  L +    ++   ++DV +G+ +  L + P
Sbjct:   18 LVVLVASESTEFEAREAIRETWASESVALRGVSFRRLFLLGTASPASDA----QRRIEEESRRHGDLIQQNFTDAYDNLTLKTMMGLHWVSVHCPHASYVMKTDSDMFVNLEVLVKAVLEQQRRRVPPRDYFTGYVMRGFLPNRNPASKWYMPEDMYPGATYPTFCSGTGYVMSATLASRLYRASLAIRRLRLEDVYVGVCLESLGVEP 222          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:13528])

HSP 1 Score: 81.2629 bits (199), Expect = 3.114e-17
Identity = 66/230 (28.70%), Postives = 109/230 (47.39%), Query Frame = 1
Query:  586 NIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDL--ESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLG----GYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNH---LRNIHMYKPNP 1248
             +++ +KS   NLE+R+ IRR+W  +        +  F +G V S    +  +     L  ES ++ DIVQ+NF+D + N T K +  +D+  +  +   Y+   DDD F++   L+E I  E   E+  R  G    GY+     PIR   S ++V  + +  + YPPY  GG +L++   A  + ++   L    IDDV +G  +  L + P      R   +  P P
Sbjct:   52 TLLLAIKSDARNLERRDVIRRTWGREGSVRGRPVRRVFLVG-VPSGEAPERRVHLNALLQEESREHGDIVQWNFLDTFFNLTLKQLLFLDWLHERCAGARYVFDGDDDVFVNTPNLLERIAAE---ERAGRGDGHLYEGYVISNVGPIRAPSSKYFVPVQVHAGDSYPPYVGGGGILMAGRTALDIRRVAGQLAMLPIDDVFLGQCLAALGLAPTRHPAFRTAGISLPAP 277          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3gnt2a (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2a [Source:ZFIN;Acc:ZDB-GENE-090312-192])

HSP 1 Score: 73.559 bits (179), Expect = 1.806e-14
Identity = 52/207 (25.12%), Postives = 102/207 (49.28%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            ++  +KS I + ++R  IR SW ++        +V F LG+  +P + +  +Q  +DLES  Y+DI+Q++F D++ N T K +  + +  +  S+  ++   DDD F++    V  +      ++      G +   A P R+    +Y+    +   Y P    GG+ + S  MAR ++++   +    IDDV +G+ + ++   P
Sbjct:  153 LLFAIKSVIAHFDRRQAIRESWGAETSGNVTVRRV-FLLGRPANP-DLEPNLQHLLDLESKRYSDILQWDFRDSFFNLTLKELLFLKWVEQRCSDVRFIFKGDDDVFVNTDRTVALLSNITAPDKVQNLFLGDVIVNAGPHRDKKVKYYIPESVFEGAYPPYAGGGGY-VYSGEMARRIHQVSRQVMQFPIDDVYVGMCLRRMGFAP 356          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:ZFIN;Acc:ZDB-GENE-021210-4])

HSP 1 Score: 70.0922 bits (170), Expect = 1.418e-13
Identity = 60/223 (26.91%), Postives = 104/223 (46.64%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQ-------FQVYFALG-----------QVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNI 1203
            +++++KSS  N ++R+ IRR+W      TT             F LG                    + +Q  +DLE+  Y D++Q++F D++ N T K +  + +F  Y     Y+   DDD F++   L+  +         P F+ G    QA PIR+  S +++  + YR   YP Y +GG  ++S   A  ++++   +K   IDDV IG+ + K  +
Sbjct:   26 LLLVIKSSPSNFDRRDAIRRTWGRNGVATTTAGDGRPLVVHTLFLLGVRPPSPPSPSDSRDDDRGKRARVQRMVDLEARLYGDLLQWDFHDSFYNLTLKDINFLRWFEAYCPAVAYVYKGDDDVFVNVENLLVYLATFSRDGSAPLFV-GRTQQQAPPIRSVESKYFMPREMYRRWTYPDYASGGGFVMSRAAAVRIHEVSRDIKPFPIDDVWIGMCLEKAGL 247          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO35379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLN2])

HSP 1 Score: 65.0846 bits (157), Expect = 3.873e-12
Identity = 61/218 (27.98%), Postives = 102/218 (46.79%), Query Frame = 1
Query:  589 IVIIVKSSIG---NLEKRNGIRRSWASKECKT--------THQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            +VI++ S +    +L++RN IRR+W +    T        +  F++ F LG+ Y     D ++  KI  E+  YNDIV  +F DNY N   KV     + ++    + +++  DDD +L    L   + K        RF GGY+   A+  R+  +   +S   +  + YPPY  G F + +  +     +L    K   I+D  +GIL+  + I P
Sbjct:    2 VVIMIHSGVHSSVHLDRRNAIRRTWGNGRRSTNDTGSKVDSLSFKLVFLLGKSY-----DKVLDEKIATEAKLYNDIVVGDFHDNYTNLIIKVYMGFKW-IQENMNSKFVIKADDDLYLYLPRLTHRLAKA------ERFFGGYVMTNAQVYRDVNNKHGISKPFFGEDVYPPYCGGPFYVFTSNLLPDFIRLTYHFKPFHIEDAYMGILLRHMGIRP 207          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO48791 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RID3])

HSP 1 Score: 64.3142 bits (155), Expect = 5.458e-12
Identity = 62/211 (29.38%), Postives = 99/211 (46.92%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTL----NKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            ++I+V S+ GN E R+ IRRSW  K  K   +F V F LG    P      I +K+  E   Y D++   F D+Y N   K +  + +  + ES+  + V  DDD ++  + L E + +     Q  R   G +   A+  R     + VSYK Y+  +YP Y  GGF ++S     ++     +  PF      +D  +G+L  ++ I P
Sbjct:    4 LLILVTSAPGNFEARSTIRRSWG-KRGKNDAKFHVVFMLGATKEPE-----ILSKLKEEIGSYGDLIIGKFTDSYSNLPLKSLMSLRWASQIESQ--FTVKTDDDMYIHTTRLYEWLLR----HQTSRLYAGKVRQNAKVNRFRFHRYSVSYKNYQEQFYPAYCYGGFYVLSREALTSVLSVSKRYHPF----PAEDAYLGVLAKEVGITP 198          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO34915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMZ5])

HSP 1 Score: 58.5362 bits (140), Expect = 5.351e-10
Identity = 59/216 (27.31%), Postives = 99/216 (45.83%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTH--------QFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLS---NWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNI 1203
            +V++V S    LE R  IR +W S   +  +        ++ V+FA+G+       D+ + +K   E+  +NDI+  NF D Y N   K      + V  + +  +++  DDD ++  +V    +  + + +   RF GG I+   R IR+  S    W +S   +  N+YPPY  G F +IS  +   L       +   +DD  IGI M  L +
Sbjct:    2 LVVVVNSDPRKLENRQTIRETWGSSHLQREYTISNRDGVKWGVFFAMGKT-----GDTSLDSKTTREAQIHNDILIGNFRDTYNNLIIKTFMSHRWTVTLKCK--FVLKTDDDVYVRLNVFTHWLRLQGSPD---RFYGGDIFKDYRVIRDRCSKWRKWAISKAYFSENFYPPYCGGPFHVISSDIVPYLLSYTSLRRPFHVDDAYIGIAMRDLGV 207          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO33326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI5])

HSP 1 Score: 57.3806 bits (137), Expect = 1.706e-9
Identity = 54/177 (30.51%), Postives = 85/177 (48.02%), Query Frame = 1
Query:  574 LTENNIVII--VKSSIGNLEKRNGIRRSWASKEC---KTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGG 1089
            L   N+ ++  V S   +   R  IR SW ++E    K    ++  F LGQ     ++D      + LE+  Y DIV  +F+D Y N T K + I+ +  K+  +  Y++  D D F++    V  + + + I + P +LG   W +  P RN  S +YVS   +    YPPY AGG
Sbjct:    3 LCTGNVFLLAAVHSCHESFSMREAIRLSWGNQENAINKGKWTWKTVFFLGQ-----SSDDEKNQLLRLEAARYKDIVIGDFLDTYRNLTLKTILILRWAKKHCPQAQYILKTDHDCFVN----VLPLMRLLRIRK-PLYLGRIHW-KNTPTRNKTSKFYVSKAEFSEPVYPPYAAGG 168          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO34506 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP58])

HSP 1 Score: 55.8398 bits (133), Expect = 5.075e-9
Identity = 55/230 (23.91%), Postives = 103/230 (44.78%), Query Frame = 1
Query:  529 YEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKE---CKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            +EPEV      K D  T    ++++ S+ GN  +RN IRR+W   E   C   +     ++   V+   +    +   +  E+  YND++  NF D Y N  +K +  + +         Y++  DDD +L+   +++ ++   T  +  R   G +     PIR+  +  ++ Y  Y     P +  G F ++S  +   L  +  F+K    +DV IG+L+  + + P
Sbjct:    5 WEPEV------KPDIFT----LVLIISAPGNKRQRNAIRRTWGRAENWDCLRLYTNHEEYSYQSVFMVGSTTDAVDNFVMDEAETYNDLLLGNFNDTYSNLLFKSLMGLSW-ASNVVNCSYVIKTDDDVYLNMPKILQWLQ---TRNKTARLYAGKVASGWSPIRDPSNKNFIPYTDYAKKTLPDFCPGTFYVLSRNILHFLLGVARFIKPLQTEDVYIGMLVQAIGLDP 220          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3gnt7l (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7-like [Source:NCBI gene;Acc:101170895])

HSP 1 Score: 88.1965 bits (217), Expect = 1.316e-18
Identity = 62/235 (26.38%), Postives = 118/235 (50.21%), Query Frame = 1
Query:  508 VIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPN 1212
            V+ +   Y P ++N      D   E ++++++KS I   ++R  +RR+W  ++ +   + +  F LG   +  +  +L Q  ++ E   Y DI+Q++F+D + N T K +  + +F  +     ++   DDD F++   L++ I   +   +  +   G    +A PIRN  S +Y+  + Y   Y P    GGF L+S  +AR L  +   L+   IDDV +G+ + +L++ P 
Sbjct:  107 VLHRHCRYFPMIINHPEKCADG--EVHLLMVIKSVIEQHDRREAVRRTWGREQTRDGRKIRTLFLLGTPTTGKDTKNL-QKLLEYEDRIYKDILQWDFMDTFFNLTLKEVNFLKWFDIFCPTVQFVFKGDDDVFVNTPNLLQLIRFRVEEHKEAQLFVGDTISKAIPIRNRQSKYYIPKELYDQPYPPYVGGGGF-LMSSRLARRLLVVSEKLELYPIDDVFLGMCLQRLDVTPE 337          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3galt2 (beta-1,3-galactosyltransferase 2 [Source:NCBI gene;Acc:101155918])

HSP 1 Score: 85.1149 bits (209), Expect = 1.797e-17
Identity = 58/208 (27.88%), Postives = 106/208 (50.96%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEK-EITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            +++++ +     + RN IR++W ++       F   F LG   S   +D+ +Q  I+ ES  Y+DI+Q +++D Y N T K +  M++   Y     Y++  D D F++   L++ + K E+  +Q  R+  GY+     P RN  S WY+  + Y    YP + +G   + S  MA+ + +    ++   ++DV +GI + KL I P
Sbjct:  162 LILLIAAEPRQTDARNAIRQTWGNESVAMGLGFVRLFMLGTGKS---SDTFLQRSIEEESRVYHDIIQQDYMDTYYNLTIKTLMGMNWVATYCPHVSYVMKTDSDMFVNTEYLIQKLLKPELPPKQ--RYFTGYLMRGYAPNRNKDSKWYMPPELYASERYPIFCSGTGYVFSGDMAQLIYQASLGIRRLHLEDVYVGICLAKLRIDP 364          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:ZFIN;Acc:ZDB-GENE-021210-4])

HSP 1 Score: 83.1889 bits (204), Expect = 5.795e-17
Identity = 66/246 (26.83%), Postives = 120/246 (48.78%), Query Frame = 1
Query:  472 NFYKILQLNDTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP 1209
            NF + L     ++ P +F + PE  +          E  ++I++KS     ++R  IR++W  ++     + +  F LG+  +    ++  Q  ++ E   Y DI+Q++F+D++ N T K    + +F  Y     Y+   DDD F+    + E +E   +I+       G +  +A+PIR   + +Y+    Y   YYPPY  GG  L+  P+AR L++    L+   IDDV +G+ +  L++ P
Sbjct:   93 NFQQFLLYRHCRLFPMVFNH-PEKCS---------GEIFLLIVIKSVATQHDRREVIRKTWGKEQVLDGKRVKTLFLLGKPSNEAERENH-QKLVEYEDKIYGDILQWDFLDSFFNLTLKETHFLKWFHTYCPNVRYVFKGDDDVFVSVENIFEYLE---SIKNEKNMFVGDVLVKAKPIRKKENKYYIPEALYNETYYPPYAGGGGFLMDGPLARRLDRAANTLELFPIDDVFLGMCLEVLHVTP 324          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: si:dkey-175m17.6 (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2-like [Source:NCBI gene;Acc:101162771])

HSP 1 Score: 81.6481 bits (200), Expect = 2.818e-16
Identity = 60/223 (26.91%), Postives = 106/223 (47.53%), Query Frame = 1
Query:  589 IVIIVKSSIGNLEKRNGIRRSWA------SKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPR--------FLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNH 1215
            +++ +KS +GN E R  IR +W        +  +     Q  F LG+  S       ++  +DLE+  Y DI+Q++F D + N T K + +  +  +Y     ++   DDD F+    L++ + K+    +  R        FLG  I Y A PIR   + +Y+    Y+  Y P    GG ++ S  +A  L ++   ++   IDDV +G+ + +L + P+H
Sbjct:  176 LLMAIKSQVGNFENRQAIRETWGRSGLVFGETNRKGELVQTVFLLGRQDSSMGPHPDLKNLLDLENQKYGDILQWDFRDAFYNLTLKDLLLWQWIQQYCPTATFIFKGDDDVFVRTDALLDYLHKKKEEHRLWRTNDTEMDLFLGDVI-YNAMPIREPSAKYYIPENFYKGVYPPYAGGGG-VVYSSSLALRLKEVSKRVRLFPIDDVYLGMCLQRLGLLPSH 396          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: ENSORLT00000036352.1 (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 [Source:NCBI gene;Acc:101175309])

HSP 1 Score: 77.7962 bits (190), Expect = 3.180e-15
Identity = 60/236 (25.42%), Postives = 113/236 (47.88%), Query Frame = 1
Query:  577 TENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYP-NHL--RNIHMYKPNPIPKNLLACH 1275
            TE  +++++KSS  N E+R  +R++WA +        +  F  G   +      L +  + +E+ +  DI+Q++F D++ N T K   ++++ VK   +  +L   DDD F +   ++E ++             G++    +P+R + S +YV       N Y PY  GG  L+S   A  + K    +  + IDD  +G+ +FK  + P +HL  + + +  P   P+N   C+
Sbjct:  113 TEPFLLLVIKSSPQNYERREVLRKTWAQERMYKGAWIRRVFISGTSGAGFEKQKLNKL-LKMENEENKDILQWDFADSFYNLTLKQTLLLEWLVKKCPKARFLFNGDDDVFANTDNMIEYLQSINNSYGLKHLFTGHLLTTEKPVRWTGSKYYVPVLIQESNKYEPYCGGGGFLLSAYTASVIYKTSQTIPLHPIDDAYMGMCLFKAGLKPSSHLGVKTLGINLPMNTPENSGPCY 347          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000050398.1 (SMESG000050398.1)

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 325/326 (99.69%), Postives = 326/326 (100.00%), Query Frame = 1
Query:  298 MISGIFSLRTISKTFFSRRXXXXXXXXXXXXXXXXXXXXSGTHEKYDSFQDFSYPSNVNFYKILQLNDTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIPKNLLACH 1275
            MISGIFSLRTISKTFFSRRIAILIFIFILAAFIYFLIVISGTHEKYDSFQDFSYPSNVNFYKILQLN+TKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSYKAYRYNYYPPYPAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIPKNLLACH
Sbjct:    1 MISGIFSLRTISKTFFSRRIAILIFIFILAAFIYFLIVISGTHEKYDSFQDFSYPSNVNFYKILQLNNTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSYKAYRYNYYPPYPAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIPKNLLACH 326          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000065171.1 (SMESG000065171.1)

HSP 1 Score: 126.331 bits (316), Expect = 5.169e-32
Identity = 81/225 (36.00%), Postives = 123/225 (54.67%), Query Frame = 1
Query:  586 NIVIIVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKLNIYPNHLRNIHMYKPNPIPKN 1260
            +++I++KS   N+  R+ IR +W    C      +  F  G ++     +S   T I +E   Y DIVQ +FIDNY NNTYK+M  +++   +   T +L+ VDDDYF+ PS ++  +E  I+     R + GY+W  A P RN    W+VS + Y + YYPPY + G   IS  +A  ++  M + K+   DDV +GI++ KL   P HL N+  +   PI KN
Sbjct:  126 DLLILIKSDPRNINSRDVIRSTWGKLNCWGNRNVKRVFLFGNLFG---NESHKLTHIKMEQEVYQDIVQSDFIDNYYNNTYKLMLAVNWATTHCKNTKFLMFVDDDYFVQPSAVLSYLE-SISTPLRNRLVSGYVWRMAVPQRNKQRKWFVSNEDYPWPYYPPYCSAGNFFISMNVAIDISIAMKYTKFLRFDDVFLGIVLHKLLTVPMHLSNVFSFI--PITKN 344          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000020856.1 (SMESG000020856.1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.003e-12
Identity = 63/211 (29.86%), Postives = 103/211 (48.82%), Query Frame = 1
Query:  571 NLTENNIVII--VKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKL 1197
            NL +  I ++  V+SS  +  +R  IR +W S +    +  ++ F +GQV      D  +Q K+  E  D+ D++Q +F+D Y N T K +  + +   Y S   +++  DDD F+    +V  + +     +  +F+ G +   +RPIR   S W VS + Y   +YPPY AG   +IS      L     F +   IDDV+I   + KL
Sbjct:   59 NLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQV-----TDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPME--KFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 261          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000020765.1 (SMESG000020765.1)

HSP 1 Score: 67.781 bits (164), Expect = 2.558e-12
Identity = 62/215 (28.84%), Postives = 108/215 (50.23%), Query Frame = 1
Query:  559 IKKDNLTENNIVII--VKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKL 1197
            IK+ +L   ++ ++  V+SS  + ++R  IR +W S    +    ++ F +G     ++ +  IQ KI+ ES D+ DI+Q +FID+Y N T K +  + + V Y S   ++   DDD F+    LV  +++ +      + + G I Y   PIR     W ++ + Y  + YPP+  G   +IS    + L     + K+  IDDV I  L+ +L
Sbjct:   50 IKESDLCFGDVYLLTYVQSSSIHFKRRMMIRETWGSLRYVSNDPVKLAFVIG-----YSENFKIQKKIEKESKDFGDIIQGDFIDSYKNLTLKHIVALHWIVNYCSHAQFVSKTDDDTFISIFNLVSYLKEHLNPAD--KLILGKISYNETPIREPGFKWTINSEMYPNDKYPPFLKGFAYVISNAAIKPLFICSYYEKFLFIDDVFITGLVSRL 257          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000023690.1 (SMESG000023690.1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.813e-12
Identity = 62/213 (29.11%), Postives = 98/213 (46.01%), Query Frame = 1
Query:  559 IKKDNLTENNIVII--VKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQTKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVDDDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSXXXXXXXXXXXXXAGGFMLISYPMARTLNKLMPFLKYNSIDDVVI-GILM 1188
            I +  L   N+ ++  V+SS  N E+R  IR +W S +   +   ++ F +G+  S  + D ++      ES  + D+VQ +F+D Y N T K M  + +   +  +  ++   DDD F++  +   T    I +    +F+ G I     PIR     W V    Y    YPPY  G   +IS    R L     + KY  IDDV I GI++
Sbjct:   50 INETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMN-----ESKKFRDLVQADFLDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFIN--IFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVL 255          
The following BLAST results are available for this feature:
BLAST of Hexosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3GALT57.271e-1927.12beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
B3GALT57.271e-1927.12beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
B3GALT57.271e-1927.12beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
B3GALT57.271e-1927.12beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
B3GALT59.913e-1927.12beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C54C8.36.433e-1125.42Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
T15D6.55.611e-1026.27Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
E03H4.111.005e-926.14Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
bre-51.083e-927.99Beta-1,3-galactosyltransferase bre-5 [Source:UniP... [more]
C47F8.54.706e-923.65Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brn1.534e-2027.85gene:FBgn0000221 transcript:FBtr0070638[more]
CG113574.863e-1231.03gene:FBgn0035558 transcript:FBtr0073310[more]
CG113574.863e-1231.03gene:FBgn0035558 transcript:FBtr0304987[more]
CG113574.863e-1231.03gene:FBgn0035558 transcript:FBtr0113143[more]
CG113574.863e-1231.03gene:FBgn0035558 transcript:FBtr0113142[more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3galt24.346e-1828.11UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
b3galt24.346e-1828.11UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
zgc:1629524.953e-1826.99zgc:162952 [Source:ZFIN;Acc:ZDB-GENE-070424-98][more]
b3gnt7l5.711e-1729.15UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt71.204e-1628.10UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000027493.17.361e-2028.81pep primary_assembly:Xenopus_tropicalis_v9.1:2:755... [more]
meis22.970e-1927.16Meis homeobox 2 [Source:Xenbase;Acc:XB-GENE-487675... [more]
ENSXETT00000027497.15.342e-1927.38pep primary_assembly:Xenopus_tropicalis_v9.1:2:744... [more]
ENSXETT00000027495.16.262e-1929.71pep primary_assembly:Xenopus_tropicalis_v9.1:2:748... [more]
wdr198.118e-1928.00WD repeat domain 19 [Source:Xenbase;Acc:XB-GENE-92... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3galt54.390e-2129.41UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3galt54.390e-2129.41UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3galt23.120e-1627.63UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3gnt66.419e-1623.41UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3gnt75.199e-1528.44UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JI67|B3GT5_MOUSE3.071e-2029.41Beta-1,3-galactosyltransferase 5 OS=Mus musculus O... [more]
sp|Q24157|BRN_DROME1.538e-1927.85Beta-1,3-galactosyltransferase brn OS=Drosophila m... [more]
sp|Q9N294|B3GT5_PANPA9.546e-1927.12Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan... [more]
sp|Q9N293|B3GT5_GORGO2.832e-1826.41Beta-1,3-galactosyltransferase 5 (Fragment) OS=Gor... [more]
sp|Q9N295|B3GT5_PANTR3.187e-1827.12Beta-1,3-galactosyltransferase 5 (Fragment) OS=Pan... [more]
back to top
BLAST of Hexosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LBY22.522e-4236.50Hexosyltransferase OS=Opisthorchis felineus OX=147... [more]
A0A4S2L9Z54.412e-4236.30Hexosyltransferase OS=Opisthorchis felineus OX=147... [more]
A0A419PDI83.744e-4136.68Hexosyltransferase OS=Clonorchis sinensis OX=79923... [more]
H2KTU41.033e-4036.68Hexosyltransferase (Fragment) OS=Clonorchis sinens... [more]
A0A2H1CGM16.467e-3935.51Hexosyltransferase OS=Fasciola hepatica OX=6192 GN... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3gnt7l5.901e-1930.66UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt73.602e-1728.37UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
si:ch211-250e5.23.418e-1628.31beta-1,3-galactosyltransferase 2-like [Source:NCBI... [more]
zgc:1946793.911e-1631.88zgc:194679 [Source:ZFIN;Acc:ZDB-GENE-030131-2847][more]
b3galt21.182e-1528.23beta-1,3-galactosyltransferase 2 [Source:NCBI gene... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3galt22.210e-1927.62UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
b3galt21.593e-1727.75UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3GNT33.114e-1728.70UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt2a1.806e-1425.12UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt71.418e-1326.91UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353793.873e-1227.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487915.458e-1229.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349155.351e-1027.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333261.706e-930.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345065.075e-923.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3gnt7l1.316e-1826.38UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3galt21.797e-1727.88beta-1,3-galactosyltransferase 2 [Source:NCBI gene... [more]
b3gnt75.795e-1726.83UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
si:dkey-175m17.62.818e-1626.91N-acetyllactosaminide beta-1,3-N-acetylglucosaminy... [more]
ENSORLT00000036352.13.180e-1525.42N-acetyllactosaminide beta-1,3-N-acetylglucosaminy... [more]
back to top
BLAST of Hexosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050398.10.000e+099.69SMESG000050398.1[more]
SMESG000065171.15.169e-3236.00SMESG000065171.1[more]
SMESG000020856.11.003e-1229.86SMESG000020856.1[more]
SMESG000020765.12.558e-1228.84SMESG000020765.1[more]
SMESG000023690.17.813e-1229.11SMESG000023690.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012533 ID=SMED30012533|Name=Hexosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1411bp
TTCGGGTTTTTTGAATTACTCATGATTTATTACATCACTTATTTGAACAT
AATTCGAAAAATAAATAGTTCGAAACTGTCAATCTTGATCGTTCTAAATT
TTAATCTCGTACACGCCTATTTAAATTTATTTTTAAAATAATGTAGCACT
GATGTGGATGTAACACAGCGGATGATGTGTGCGCACACGTGCACACAATT
AACGTTTGGATGCATCGGATTGGTGTTCCTTTTTATTTGTTCAAAATTTC
TATACATGTATCATAAAGAAAAACTTAATTTTAAAAATTAAGTACAAATG
ATCTCCGGAATATTTTCACTAAGAACAATATCTAAAACTTTCTTTTCAAG
ACGAATTGCGATATTGATTTTTATTTTTATTCTAGCGGCTTTTATTTATT
TTTTAATCGTAATTAGTGGAACACACGAAAAGTATGATTCGTTTCAAGAT
TTTTCCTATCCATCCAATGTAAATTTTTATAAAATTCTTCAGCTAAACGA
TACGAAAGTTATACCGAAATTATTTCCATATGAACCAGAAGTGATGAATG
AAAAAAATATTAAAAAAGATAATCTTACCGAGAACAACATTGTAATTATT
GTCAAATCATCTATTGGCAATCTAGAGAAGCGTAACGGAATTCGTCGAAG
TTGGGCAAGTAAAGAGTGCAAGACAACTCATCAGTTTCAAGTTTATTTTG
CGTTGGGCCAGGTTTACAGCCCTCACAATGCTGATTCATTAATCCAAACA
AAAATTGATCTAGAATCGACAGATTATAATGATATTGTGCAATTCAATTT
CATTGACAATTATATCAATAATACCTACAAAGTGATGGCAATTATGGATT
ATTTTGTTAAATATGAAAGTGAAACACCATATTTGGTCATTGTCGATGAT
GATTATTTCCTCGATCCGTCAGTGCTGGTTGAAACCATTGAAAAGGAAAT
TACAATTGAACAATATCCCAGATTTCTTGGTGGATATATTTGGTATCAAG
CTAGACCAATACGAAATTCGCTCTCAAACTGGTATGTATCATACAAAGCC
TATAGATATAATTATTACCCTCCATATCCAGCGGGGGGTTTCATGTTGAT
TTCTTATCCCATGGCGAGAACTCTCAACAAACTGATGCCATTCTTGAAAT
ACAATTCAATTGATGATGTCGTTATCGGAATTCTCATGTTCAAATTAAAT
ATTTATCCAAATCATTTAAGAAATATCCACATGTATAAACCAAATCCTAT
TCCAAAGAATTTATTGGCTTGTCATAAATTATCTTCGAATTTACTGAATT
TGGGAAAAAAATCAATATCAGAAAAAATGTATAAAAAAGTAGAACTTTTA
TTTAAATATCGATTTTATTTTATGTGAAATTCAATCTATTTTTCGTTTTT
GAAAATCCGCT
back to top

protein sequence of SMED30012533-orf-1

>SMED30012533-orf-1 ID=SMED30012533-orf-1|Name=SMED30012533-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=360bp
MISGIFSLRTISKTFFSRRIAILIFIFILAAFIYFLIVISGTHEKYDSFQ
DFSYPSNVNFYKILQLNDTKVIPKLFPYEPEVMNEKNIKKDNLTENNIVI
IVKSSIGNLEKRNGIRRSWASKECKTTHQFQVYFALGQVYSPHNADSLIQ
TKIDLESTDYNDIVQFNFIDNYINNTYKVMAIMDYFVKYESETPYLVIVD
DDYFLDPSVLVETIEKEITIEQYPRFLGGYIWYQARPIRNSLSNWYVSYK
AYRYNYYPPYPAGGFMLISYPMARTLNKLMPFLKYNSIDDVVIGILMFKL
NIYPNHLRNIHMYKPNPIPKNLLACHKLSSNLLNLGKKSISEKMYKKVEL
LFKYRFYFM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR002659Glyco_trans_31
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: molecular function
TermDefinition
GO:0008378galactosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups