slc39a-8

Overview
Nameslc39a-8 (AKN21673.1)
Smed IDSMED30012526
Length (bp)1371
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc39a-8 (SMED30012526) t-SNE clustered cells

Violin plots show distribution of expression levels for slc39a-8 (SMED30012526) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc39a-8 (SMED30012526) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc39a-8 (SMED30012526) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012526

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30012526SMESG000009752.1 SMESG000009750.1 dd_Smed_v4_4776_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012526SMESG000009752.1 SMESG000009750.1 dd_Smed_v4_4776_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012526SMESG000009752.1 SMESG000009750.1 dd_Smed_v4_4776_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012526SMESG000009752.1 SMESG000009750.1 dd_Smed_v4_4776_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc39a-8 vs. Ensembl Human
Match: SLC39A3 (solute carrier family 39 member 3 [Source:HGNC Symbol;Acc:HGNC:17128])

HSP 1 Score: 123.25 bits (308), Expect = 3.757e-31
Identity = 99/338 (29.29%), Postives = 165/338 (48.82%), Query Frame = 2
Query:  179 IIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIE--KNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            ++G F F+L+       +L     I+T++  +   K  L+  N F GGVFL+T    L P V  K   +L       +YP A   L +GFF+   LE  +   +  +       + +  N+ ++      + +DS      E  F        L +E +        S SVQ      +  A    P++      + L FAL +HS+ EGL   +  E    V++ + V +HE++ A++LG+++A     +  +  L  T +A+IPLGIG+G    LGIE  + + G V + +LQG+A GTF+++ F+EIL  E+  +    LKVL +V+G++V+A M
Sbjct:   12 MVGVFFFMLLG------SLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREKLQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLI---LTFRKEKPSFIDLETFNAGSD------VGSDSEY----ESPFMGGARGHALYVEPHGHGP----SLSVQ-----GLSRAS---PVR-----LLSLAFALSAHSVFEGLALGLQEEGEKVVSLFVGVAVHETLVAVALGISMARSAMPLRDAAKLAVTVSAMIPLGIGLG----LGIESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKELEEKSDRLLKVLFLVLGYTVLAGM 309          
BLAST of slc39a-8 vs. Ensembl Human
Match: SLC39A3 (solute carrier family 39 member 3 [Source:HGNC Symbol;Acc:HGNC:17128])

HSP 1 Score: 123.635 bits (309), Expect = 3.992e-31
Identity = 99/338 (29.29%), Postives = 165/338 (48.82%), Query Frame = 2
Query:  179 IIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIE--KNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            ++G F F+L+       +L     I+T++  +   K  L+  N F GGVFL+T    L P V  K   +L       +YP A   L +GFF+   LE  +   +  +       + +  N+ ++      + +DS      E  F        L +E +        S SVQ      +  A    P++      + L FAL +HS+ EGL   +  E    V++ + V +HE++ A++LG+++A     +  +  L  T +A+IPLGIG+G    LGIE  + + G V + +LQG+A GTF+++ F+EIL  E+  +    LKVL +V+G++V+A M
Sbjct:   12 MVGVFFFMLLG------SLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREKLQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLI---LTFRKEKPSFIDLETFNAGSD------VGSDSEY----ESPFMGGARGHALYVEPHGHGP----SLSVQ-----GLSRAS---PVR-----LLSLAFALSAHSVFEGLALGLQEEGEKVVSLFVGVAVHETLVAVALGISMARSAMPLRDAAKLAVTVSAMIPLGIGLG----LGIESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKELEEKSDRLLKVLFLVLGYTVLAGM 309          
BLAST of slc39a-8 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 102.449 bits (254), Expect = 1.250e-23
Identity = 86/317 (27.13%), Postives = 146/317 (46.06%), Query Frame = 2
Query:  233 LRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASK--KTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVI 1177
            LR P     N+  S   +  L+  + F GGVFL+T L+ L P   +  ++ L       ++P     LA+GFFLV ++E                           ++  +  S  SP   LEE         + L    N     +           P + +A S  P   + L + +L F+L  HS+ EGL   +  +    + + + +L+H+ + A+SL + L     +  VV    +L  F+ + PLGIG+G A  L      +  +  +VL+G+AAGTF+Y+ F+EILP E+ + +Q  LKV++++ GF+++
Sbjct:   52 LRRPG---ANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVME-------------------------QITLAYKEQSGPSP---LEE--------TRALLGTVNGGPQHWHDG--------PGVPQA-SGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGIL--FSCMTPLGIGLGAA--LAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALL 316          
BLAST of slc39a-8 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 102.449 bits (254), Expect = 1.390e-23
Identity = 86/317 (27.13%), Postives = 146/317 (46.06%), Query Frame = 2
Query:  233 LRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASK--KTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVI 1177
            LR P     N+  S   +  L+  + F GGVFL+T L+ L P   +  ++ L       ++P     LA+GFFLV ++E                           ++  +  S  SP   LEE         + L    N     +           P + +A S  P   + L + +L F+L  HS+ EGL   +  +    + + + +L+H+ + A+SL + L     +  VV    +L  F+ + PLGIG+G A  L      +  +  +VL+G+AAGTF+Y+ F+EILP E+ + +Q  LKV++++ GF+++
Sbjct:   52 LRRPG---ANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVME-------------------------QITLAYKEQSGPSP---LEE--------TRALLGTVNGGPQHWHDG--------PGVPQA-SGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGIL--FSCMTPLGIGLGAA--LAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALL 316          
BLAST of slc39a-8 vs. Ensembl Human
Match: SLC39A1 (solute carrier family 39 member 1 [Source:HGNC Symbol;Acc:HGNC:12876])

HSP 1 Score: 102.449 bits (254), Expect = 1.390e-23
Identity = 86/317 (27.13%), Postives = 146/317 (46.06%), Query Frame = 2
Query:  233 LRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASK--KTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVI 1177
            LR P     N+  S   +  L+  + F GGVFL+T L+ L P   +  ++ L       ++P     LA+GFFLV ++E                           ++  +  S  SP   LEE         + L    N     +           P + +A S  P   + L + +L F+L  HS+ EGL   +  +    + + + +L+H+ + A+SL + L     +  VV    +L  F+ + PLGIG+G A  L      +  +  +VL+G+AAGTF+Y+ F+EILP E+ + +Q  LKV++++ GF+++
Sbjct:   52 LRRPG---ANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVME-------------------------QITLAYKEQSGPSP---LEE--------TRALLGTVNGGPQHWHDG--------PGVPQA-SGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGIL--FSCMTPLGIGLGAA--LAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALL 316          
BLAST of slc39a-8 vs. Ensembl Celegans
Match: zipt-2.2 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q19913])

HSP 1 Score: 94.3597 bits (233), Expect = 4.394e-21
Identity = 91/373 (24.40%), Postives = 163/373 (43.70%), Query Frame = 2
Query:  128 AKTLKFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWIL---EIFVHACIHAKTHSHHH----GNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLA-SKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIF--HAHGDRQ 1216
            A  L++I    +FVV   IG  P  ++  R+ K + +N SE           + +L++   F GGVFL+T  + + P +N  + +++        + Y       GFF ++ +     FV        H H H    GN     SD        +S   PK+         K S  +  +    +    ++ E                   K N+L S+    A+  HS++EG    +         +  ++L+H+ V A S+G+ ++ +    V T ++ +  ++ + PLG  +G ++    E N+  D    +L+ +AAGTFIYV F+EI+ +E  N      ++L ++IGF+++ TM++F  H HG   
Sbjct:    4 ATVLQYILAFAMFVVTAAIGIVPLFIV--RVMKRS-QNESE-----------QGYLSYLTCFAGGVFLATCFLDIIPHINEGYEELMETYDLNWHFAYPQFVTCCGFFFIYFIEEFTTFVFGNGQQPGHGHSHSLNKGNKITTTSDGR------LSPGMPKE--------RKGSVNITNLRMEEASTWVVSDE-------------------KSNILKSLTFAVAMSFHSLLEGFALGVQDSKGRIYALFFSLLLHKGVEAFSVGLQISMANSNKVKTVLATILIYSLMAPLGSIMG-SILQNSETNIYKDCAILLLESLAAGTFIYVTFIEIMASEKSNDFNHLKQLLWIIIGFALVTTMQVFFGHEHGGEH 328          
BLAST of slc39a-8 vs. Ensembl Celegans
Match: zipt-2.1 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q6BEU0])

HSP 1 Score: 94.3597 bits (233), Expect = 5.540e-21
Identity = 81/311 (26.05%), Postives = 146/311 (46.95%), Query Frame = 2
Query:  290 FLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPK------QLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLA---SKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIF 1195
            +L++ + F GGVF++T  + + P V   + +IL   +     P   L + +GFF V+++E      I AK               ++  P   ++ D  K      QL+E     +   + L+   D+ +    +  E+    +    DE       K NLL S+    A+  HS++EG    +         + +++L+H+S+ A S+G+ ++   ++K  +V    L+  +A + PLG  +G  +    +K+   D     L+ +AAGTFIYV F+EIL AE  NR  +  ++L + +GF VI  ++ F
Sbjct:   47 WLSYLSCFSGGVFMATCFLDVMPHVQQTYGEILETYNVEFRLPMNQLFICVGFFFVYLIEE-----ITAKVFGSGG-------HGHSHGPPIPLTVDIKKEKVTRVQLIENG--SSSSPETLMIPIDSRTRHSLVVEETAPWVVS---DE-------KRNLLKSLTFAIAMSFHSLLEGFALGVQDSDAAIWTLFLSLLLHKSIEAFSVGLQISRANTEKKGIVMCTILV--YALMTPLGSVLGTLLQNTGDKSFGKDCTIVFLEAMAAGTFIYVTFLEILAAEKENRFNSLKQLLCIGLGFMVILALQFF 331          
BLAST of slc39a-8 vs. Ensembl Celegans
Match: zipt-2.1 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q6BEU0])

HSP 1 Score: 94.3597 bits (233), Expect = 5.540e-21
Identity = 81/311 (26.05%), Postives = 146/311 (46.95%), Query Frame = 2
Query:  290 FLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPK------QLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLA---SKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIF 1195
            +L++ + F GGVF++T  + + P V   + +IL   +     P   L + +GFF V+++E      I AK               ++  P   ++ D  K      QL+E     +   + L+   D+ +    +  E+    +    DE       K NLL S+    A+  HS++EG    +         + +++L+H+S+ A S+G+ ++   ++K  +V    L+  +A + PLG  +G  +    +K+   D     L+ +AAGTFIYV F+EIL AE  NR  +  ++L + +GF VI  ++ F
Sbjct:   47 WLSYLSCFSGGVFMATCFLDVMPHVQQTYGEILETYNVEFRLPMNQLFICVGFFFVYLIEE-----ITAKVFGSGG-------HGHSHGPPIPLTVDIKKEKVTRVQLIENG--SSSSPETLMIPIDSRTRHSLVVEETAPWVVS---DE-------KRNLLKSLTFAIAMSFHSLLEGFALGVQDSDAAIWTLFLSLLLHKSIEAFSVGLQISRANTEKKGIVMCTILV--YALMTPLGSVLGTLLQNTGDKSFGKDCTIVFLEAMAAGTFIYVTFLEILAAEKENRFNSLKQLLCIGLGFMVILALQFF 331          
BLAST of slc39a-8 vs. Ensembl Celegans
Match: zipt-2.4 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:P91348])

HSP 1 Score: 94.7449 bits (234), Expect = 1.070e-20
Identity = 60/162 (37.04%), Postives = 91/162 (56.17%), Query Frame = 2
Query:  722 AHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNL----ASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIF 1195
            AHSH       + S+    ALG HSIIEGL F +    +  + + +++++H+ + A S+G+ L    A +   V+ SI    T A++ PLG  IG+AV    +  L  D+   +LQG+A GTFIYV F E+L  E  N     LK+L+M IGF++I  ++ F
Sbjct:  289 AHSHG------VRSITFVLALGIHSIIEGLAFGVQSGNDTIIALFLSLMVHKLIVAFSVGLQLFRTHAHQIKWVIISI---FTLASMTPLGALIGLAVTSAADNALWKDLTITILQGLAVGTFIYVTFFEVLLHERDNEHPNLLKLLVMFIGFALIGALRGF 441          
BLAST of slc39a-8 vs. Ensembl Celegans
Match: zipt-3 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q09957])

HSP 1 Score: 93.2041 bits (230), Expect = 1.479e-20
Identity = 88/341 (25.81%), Postives = 148/341 (43.40%), Query Frame = 2
Query:  161 IFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEY---PYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLL----GSV-----MLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNL----ASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQA 1135
            +F+       F  +LI+  I  T LR               KT ++F      GVF++T  +GL P V  +   +   ++ +  Y   P     + IGF ++ I E  +H   H+       GN   H+  +   PL    +    +  +E+  + +    L+ ++D+  +  F  + S            H H P  G+      GS+      L   +  HS  EG+   +  + N    +LI VL HE +C +S GV L    AS+K +  +SI L AT    IP G+ +   ++ GIE ++   +    L+G+AAGTF++V  +E+LP E+H+    
Sbjct:    5 LFMTTSAFAVFILLLISTSIPYTFLRT--------CCVNASKTSISFLGCASCGVFIATCFLGLVPHVRHQEMHLRGNQTIVDSYGWIPSTDQLVIIGFLIILITEQIIHGIGHSI------GNGHSHSGHS---PLATSDSIKMNKFHDEE--EGEDHVPLVAMDDDADEIIFRQNTS-----------PHHHAPSSGHCRTAPGGSMNIRVWFLLLGMSVHSFFEGVALGVQNDSNAFWQILIAVLFHEVLCCVSYGVQLAKHNASRKYAWTSSIFLSAT----IPAGMILATTID-GIENDMWQRIGRYWLEGLAAGTFVHVALVELLPMELHSDDSG 310          
BLAST of slc39a-8 vs. Ensembl Fly
Match: Zip89B (gene:FBgn0038412 transcript:FBtr0083266)

HSP 1 Score: 100.908 bits (250), Expect = 1.100e-22
Identity = 101/367 (27.52%), Postives = 170/367 (46.32%), Query Frame = 2
Query:  140 KFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPE--YPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDD----KFLTSESVQVEIE-------------PSI-DEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKV-LMMVIGFSVI 1177
            K  ++ ++F  + I G+ PF+L  +  R T      E QTN   +  +K  L    +F GGV L+T+ + L P V     + L++   I E  +P A L +  GFFL++ +E  +H  +H           ++ +S  NS  L+    ++                  L++++   +D    KF T    Q                 P I D+A +   +  +L G  +++ AL  H + EG+   +    +    M   V  H+ V A  +GV L   +T ++ ++  + TFA + PLGIGIG+ +N G E+     +V+A+LQG A GT IYVVF EIL     ++ ++ L+  L + +GF V+
Sbjct:   56 KVTAMVVLFCASAICGSIPFLL-NRCYRWT------ENQTNARSAIVVKCLL----YFGGGVLLATTFLHLLPEVQEVVEE-LQECGIIGELTFPLAELLMCCGFFLMYFIEEAMHTYVHHHQKDEAGAAFERGHSIRNSHLLKPTEGNATTPTAPPAPLAGTAELGTLSVQNLLQNDLEQQKFATKPQQQANGHGHSHGHGHGHSHLPVIADDADAGDMLASSLRGLFIVS-ALSLHELFEGMAIGLESSASSVWFMFGAVSAHKLVLAFCVGVELIVARTRMLLAVLYVLTFAVVSPLGIGIGILINHG-EETSGPSLVSAILQGFACGTLIYVVFFEIL-----SKNRSGLRAYLALFVGFLVM 403          
BLAST of slc39a-8 vs. Ensembl Fly
Match: Zip42C.1 (gene:FBgn0033096 transcript:FBtr0086139)

HSP 1 Score: 96.6709 bits (239), Expect = 8.632e-22
Identity = 98/377 (25.99%), Postives = 173/377 (45.89%), Query Frame = 2
Query:  140 KFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYA--GLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDE-AHSHVPI---KGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVG---DVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIF--HAHGDRQNMFLNCT 1237
            K +S+ ++ V+  + G+ P++L   R       +P E +++ VV    +  L    FF GGV + T+ + + P V  +  + L++  ++ + P+A   + L  GFFL++ L+  + + +      HH G   +  S  +    R  S       +   +    Q+ + + ++D               E +P  D   HSH+P+    G+    + +  AL  H + EG+   + G  +    M   V  H+ V A  +G+ L   +T    +I  L TF+ + P+GIG+G    LGI + +      + + VLQGIA GT +YVVF EIL  E H   +A   ++  V GF+++  ++I    A GD     L C+
Sbjct:   24 KIVSMVVLVVITVLCGSLPYVL--NRCFHWTKASPEETRSSLVV----RCLL----FFGGGVLICTTFLHMLPEVI-EVVEALQECGSLVKTPFALAEMLLCTGFFLMYALDELMTSLVR-----HHQGKLSRKESVASLAFERGRS-------IRHSVLLNPQAKEEVEVKDT--------------EPQPHKDHHGHSHMPVPADDGSSARGLGIILALSLHELFEGMAIGLEGTVSTVWFMFGAVSAHKLVLAFCVGMELLVARTRSSLAILYLVTFSIVTPIGIGVG----LGISQQVAAGQPSLPSGVLQGIACGTLLYVVFFEIL-IESHAGWRA---LVAAVAGFALMFGLQILSDEAEGDDS---LTCS 352          
BLAST of slc39a-8 vs. Ensembl Fly
Match: Zip42C.2 (gene:FBgn0033097 transcript:FBtr0306802)

HSP 1 Score: 72.4034 bits (176), Expect = 1.049e-13
Identity = 79/353 (22.38%), Postives = 151/353 (42.78%), Query Frame = 2
Query:  140 KFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPE-YPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLM-MVIGFSVIATMKI 1192
            K ++I ++F+V  I    P++L   R  K   R  +        ++  K  L   NF  GGV ++T+ I + P V    N +   R   P  +    + L  GF+L++ +E  +H  +  +                                      + ++  +++TI+D          E ++ EI    +E+    P + N L  + +  AL  H +  G+   +    +    M   + +H+ V A  +G+ +    T  + ++  L  F+ + P+G+GIG+AV+     N     V+ +LQG+A GT IYVVF EI+      +  A +++L+  ++GF ++  ++I
Sbjct:   10 KIVAIVVLFLVTLIFCFIPYLL--DRFYKWTQRPENN-------AREFKVVLCLLNF-GGGVLIATTFIHMLPEVVEVVNALQDCRMLAPTPFGLPEVLLCTGFYLMYCIEETMHFVVRRR--------------------------------------QQRKLREVVTIKD--------AGEELRTEIVVQPEES----PKEPNWLRGLGIIVALSLHELFGGMAIGLEMSVSTVWFMTGAISVHKLVLAFCIGMEIMMAHTRWLLAVVYLLVFSIVTPIGVGIGIAVSESAAANQ-PSTVSGILQGLACGTLIYVVFFEIV-----AKNHAGIRILLSSMVGFVLMFGLQI 296          
BLAST of slc39a-8 vs. Ensembl Fly
Match: Zip88E (gene:FBgn0038312 transcript:FBtr0290018)

HSP 1 Score: 63.1586 bits (152), Expect = 1.473e-10
Identity = 73/332 (21.99%), Postives = 138/332 (41.57%), Query Frame = 2
Query:  311 FCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKA-KQSDKLLTIEDNNSDDKFLTSESVQVEIEP---------SIDEAHSHV-------PIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASK-KTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTA-------VLQGIAAGTFIYVVFMEILP---AEMHN---RKQAPLKVLMMVI-GFSVIATMKIFHAHGD 1210
            F  G+ L+T+L+ + P V  + +             +A +++  GFF+++ ++ F+H         +  G + QH   +++      +T+ P++   +  + A  +   LL+ E N S               P         S+++A++ +       P   ++ G++ L  AL  HS IEGL   +       + +L  V  H+ V    LG+   S  +TS       ++ FA    +GIG+G+         L+ DV  A       ++Q +A GT  YV   E++P   A  H+   R+ A       V+ GF+ +  +  + +  D
Sbjct:   67 FGAGILLATALVHILPEVREQMDS-----------KFAEVAMCGGFFIIYFIDEFIH---------YFFGEAIQHTHAHDA---ETPATEPPRRPTNDNGYGAVDERAPLLSAEPNTSHGHSHHHSHDHDHNHPASASGCNDASVEDANARICHTSHTEPCAQSMTGTLGLFVALSLHSAIEGLAIGVQNSSTKVLFLLGAVACHKFVMGFCLGLEFRSNPQTSFRAQFVGISVFALGAVIGIGLGM---------LIVDVPAAWSSKTLPIVQALAGGTLFYVTVCEVIPREKARWHSNSTRRWAGFAQFATVLAGFATMCIINFYLSDED 366          
BLAST of slc39a-8 vs. Ensembl Zebrafish
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:321324])

HSP 1 Score: 117.087 bits (292), Expect = 3.324e-29
Identity = 90/301 (29.90%), Postives = 145/301 (48.17%), Query Frame = 2
Query:  284 KTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            K  L+F + F GGVFLS  L+ + P   S  +  L+KR     +P     +A GFF V ILE  V +C            ++ H ++  + PL A +  +              +    ++ D        +   V V+        H+H   +     S ML  +L  HS+ EGL   +       + + I +L+H+S+   SL V L       +  +  +  FA + PLGIGIG+ V +  E+   G ++ AVL+G+AAGTFIY+ F+EILP E+++ ++  LKVL ++ GFS++A +
Sbjct:   42 KAVLSFVSCFAGGVFLSACLLDIIPDYLSDIHGELQKRDLDDGFPLPEFIMACGFFTVLILEKMVLSC------------TEGHRNEETA-PLLAPAAPN------------GHAHGHPSVNDLEG-----SGHHVHVDF-------HAHSSFR-----SFMLFLSLSLHSVFEGLAIGLQTTNAKVLEICIAILVHKSIIVFSLSVKLVQSAVKPLWVVLYVTVFAIMSPLGIGIGIVV-IETERQ-AGGLIQAVLEGLAAGTFIYITFLEILPHELNSSERPLLKVLFLLCGFSIMAAL 298          
BLAST of slc39a-8 vs. Ensembl Zebrafish
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:321324])

HSP 1 Score: 117.087 bits (292), Expect = 3.324e-29
Identity = 90/301 (29.90%), Postives = 145/301 (48.17%), Query Frame = 2
Query:  284 KTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            K  L+F + F GGVFLS  L+ + P   S  +  L+KR     +P     +A GFF V ILE  V +C            ++ H ++  + PL A +  +              +    ++ D        +   V V+        H+H   +     S ML  +L  HS+ EGL   +       + + I +L+H+S+   SL V L       +  +  +  FA + PLGIGIG+ V +  E+   G ++ AVL+G+AAGTFIY+ F+EILP E+++ ++  LKVL ++ GFS++A +
Sbjct:   42 KAVLSFVSCFAGGVFLSACLLDIIPDYLSDIHGELQKRDLDDGFPLPEFIMACGFFTVLILEKMVLSC------------TEGHRNEETA-PLLAPAAPN------------GHAHGHPSVNDLEG-----SGHHVHVDF-------HAHSSFR-----SFMLFLSLSLHSVFEGLAIGLQTTNAKVLEICIAILVHKSIIVFSLSVKLVQSAVKPLWVVLYVTVFAIMSPLGIGIGIVV-IETERQ-AGGLIQAVLEGLAAGTFIYITFLEILPHELNSSERPLLKVLFLLCGFSIMAAL 298          
BLAST of slc39a-8 vs. Ensembl Xenopus
Match: slc39a3 (solute carrier family 39 member 3 [Source:NCBI gene;Acc:100124712])

HSP 1 Score: 127.872 bits (320), Expect = 8.463e-33
Identity = 94/314 (29.94%), Postives = 158/314 (50.32%), Query Frame = 2
Query:  254 QTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIF 1195
            + ++  S   +  L+ +N F GGVFL+T    L P V  KF D+L+  +   +YP A   + +GFFL   +E      +  +       + +  N+ ++      + +DS     E     A     L   E  +S      S S+       I E  S  PI+        L FAL +HS+ EGL   +  + N  +++ I V+IHE++ A++LGV++A   T +  +I +    + +IP+GI +G+A+     +N+   + +A+LQGIA GTFI+V F EIL  E+  +    LKVL +V+G++V+A + +F
Sbjct:   30 EADFDKSSRSRKILSLSNSFAGGVFLATCFNALLPAVREKFFDLLKIGNISTDYPLAETIMMVGFFLTVFVE---QTVMTFRKEKPSFIDMETFNAGSD------IGSDSE---FESPFISANHGHNLY--EGGHSHH----SHSLN------IKELSSSSPIR-----LFSLVFALSAHSVFEGLALGLQEDGNKLLSLFIGVVIHETLVAVALGVSMAKVNTHLKDAIKMAVLVSTMIPIGIVVGMAIQSA--QNMASSIASALLQGIAGGTFIFVTFFEILVKELEEKNDRLLKVLFLVLGYTVLAVLVLF 312          
BLAST of slc39a-8 vs. Ensembl Xenopus
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:734036])

HSP 1 Score: 97.0561 bits (240), Expect = 8.145e-22
Identity = 82/311 (26.37%), Postives = 136/311 (43.73%), Query Frame = 2
Query:  254 QTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            Q + V S P +  L+  + F GGVFLST L+ L P   S     L+  +   ++P     LA+GFFLV ++E        A  +    G S++  +   S  L      +P                                  V V++      AHS V +       + L  AL  HS +EG+     G     +   + +L+H+S+ A SL + L   +  V   ++ L  ++ + PLG+G+G+A       + V  +  +VL+G+A G F+Y+ F+EILP E+        +V++++ GFS IA +
Sbjct:   47 QGSTVTSGPQRRSLSLISCFSGGVFLSTCLLDLMPSYLSSIAGALKGLNITLQFPLQEFILAMGFFLVLVMEQV------AMGYKDQAGGSEETGALLGSASLLHSGVGAPH---------------------------------VHVDVN-----AHSAVRM-------MALVLALALHSALEGVALGYQGARGRVMKTCLALLVHKSLIAFSLTLKLGQGRLHVRAMLACLLFYSLMCPLGMGLGMA--WAGSTDPVQQLTRSVLEGLATGAFMYITFLEILPHELSAGYPQIDRVIVLLCGFSAIAAV 304          
BLAST of slc39a-8 vs. Ensembl Xenopus
Match: camk2n2 (calcium/calmodulin-dependent protein kinase II inhibitor 2 [Source:Xenbase;Acc:XB-GENE-960926])

HSP 1 Score: 94.3597 bits (233), Expect = 5.443e-21
Identity = 87/299 (29.10%), Postives = 145/299 (48.49%), Query Frame = 2
Query:  311 FCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILE-IFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPI---KGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIF 1195
            F  G FL   L+ +   V    + I  + S I  YP   L L++GFF V  +E I +  C H          S+    D + +P    + +SP                     + NS +K    E    EI  + + +H+H+ +     +   S++L  +L  HS+ EGL   +   ++  + + I VLIH+ V   SL + L   KT  +  +  + T + + P+GI IG+ V L  +K  +  +V AVL+GIA+GTF+YV F+EILP E++  ++  LK+L + +GF+ +A + I+
Sbjct:   51 FAAGTFLGACLLHV---VAEALSSIATELSYI-AYPMGELILSLGFFFVLFIERIVLQFCYH----------SQPQQLDGSPVP---ATQNSP---------------------EANSTEKQEHPE----EINNAAEVSHNHIHVNLHSYSSFRSLILFLSLSVHSVFEGLAIGLQSNYSSALQIAIAVLIHKGVIVFSLSLKLTQSKTRPLWLLVYVITLSLMSPIGITIGIIVTL--KKTTIITLVQAVLEGIASGTFVYVTFLEILPQELNTAEKPLLKLLFIALGFTAMAVIAIW 305          
BLAST of slc39a-8 vs. Ensembl Xenopus
Match: alkbh6 (alkB homolog 6 [Source:Xenbase;Acc:XB-GENE-5891943])

HSP 1 Score: 76.6406 bits (187), Expect = 6.566e-15
Identity = 79/303 (26.07%), Postives = 142/303 (46.86%), Query Frame = 2
Query:  284 KTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGD-VVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMK 1189
            + +++F +   GGVFL+  L+ + P   +   + +  +    ++P     L  GF +V I+E  V  C  ++T S              + PL +  ++SP         + +Q          + +D         V+        H+H   +     S +L  +L  HSI EG+   +    +  + + I +LIH+S+ A+SL + L          +  +  FA + PLGIGIG+ V   +     G+ +V  VL+G+AAGTF+Y+ F+EILP E+++ K    KV+ +++GFS +A ++
Sbjct:   42 QRWISFISCLAGGVFLAACLLDIIPDFLNDMKEEMINQQIKTDFPLPEFILGTGFLIVLIVERIVLDC--SETMS------------EETTPLLSGGSNSPA--------RQEQPHGHSHSHSGHHNDVEHRRHHFHVDF-------HAHSSFR-----SFILLLSLSLHSIFEGIAIGLQNVQSEVLQIAIAILIHKSIIAVSLSLLLLQSSVQTRWFVLSIVMFALMSPLGIGIGIGV---MHNQTDGNRMVQCVLEGLAAGTFVYITFLEILPHELNSNKWRLPKVIFILLGFSGMAALR 307          
BLAST of slc39a-8 vs. Ensembl Mouse
Match: Slc39a3 (solute carrier family 39 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:2147269])

HSP 1 Score: 122.479 bits (306), Expect = 5.114e-31
Identity = 95/316 (30.06%), Postives = 151/316 (47.78%), Query Frame = 2
Query:  284 KTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKF------LTSESVQVEIEPSIDEAHSH-VPIKGNLLGS------VMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIE--KNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            K  L+  N F GGVFL+T    L P V  K   +L       +YP A   + +GFFL   +E  V                                 + P   ++ + F A          D  SD ++      + + S  +  EP+   AH+H   ++   LG       + L FAL +HS+ EGL   +  E    V++ + V IHE++ A++LG+++A     +  +  L  T +A+IP+GIG+G    LGIE  +++   V +A+LQG+A GTF++V F+EIL  E+  R +  LKVL +V+G++V+A M
Sbjct:   41 KKVLSLCNTFGGGVFLATCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQLV----------------------------LTFRRERPP-FIDLETFNAGS--------DAGSDSEYESPFVGVGNRSHSLYPEPT---AHTHGAGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAIHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLG----LGIESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLAGM 312          
BLAST of slc39a-8 vs. Ensembl Mouse
Match: Slc39a3 (solute carrier family 39 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:2147269])

HSP 1 Score: 121.709 bits (304), Expect = 1.703e-30
Identity = 95/316 (30.06%), Postives = 151/316 (47.78%), Query Frame = 2
Query:  284 KTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKF------LTSESVQVEIEPSIDEAHSH-VPIKGNLLGS------VMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIE--KNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            K  L+  N F GGVFL+T    L P V  K   +L       +YP A   + +GFFL   +E  V                                 + P   ++ + F A          D  SD ++      + + S  +  EP+   AH+H   ++   LG       + L FAL +HS+ EGL   +  E    V++ + V IHE++ A++LG+++A     +  +  L  T +A+IP+GIG+G    LGIE  +++   V +A+LQG+A GTF++V F+EIL  E+  R +  LKVL +V+G++V+A M
Sbjct:   72 KKVLSLCNTFGGGVFLATCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQLV----------------------------LTFRRERPP-FIDLETFNAGS--------DAGSDSEYESPFVGVGNRSHSLYPEPT---AHTHGAGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAIHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLG----LGIESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLAGM 343          
BLAST of slc39a-8 vs. Ensembl Mouse
Match: Slc39a3 (solute carrier family 39 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:2147269])

HSP 1 Score: 121.709 bits (304), Expect = 1.703e-30
Identity = 95/316 (30.06%), Postives = 151/316 (47.78%), Query Frame = 2
Query:  284 KTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKF------LTSESVQVEIEPSIDEAHSH-VPIKGNLLGS------VMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIE--KNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            K  L+  N F GGVFL+T    L P V  K   +L       +YP A   + +GFFL   +E  V                                 + P   ++ + F A          D  SD ++      + + S  +  EP+   AH+H   ++   LG       + L FAL +HS+ EGL   +  E    V++ + V IHE++ A++LG+++A     +  +  L  T +A+IP+GIG+G    LGIE  +++   V +A+LQG+A GTF++V F+EIL  E+  R +  LKVL +V+G++V+A M
Sbjct:   72 KKVLSLCNTFGGGVFLATCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQLV----------------------------LTFRRERPP-FIDLETFNAGS--------DAGSDSEYESPFVGVGNRSHSLYPEPT---AHTHGAGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAIHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLG----LGIESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLAGM 343          
BLAST of slc39a-8 vs. Ensembl Mouse
Match: Slc39a1 (solute carrier family 39 (zinc transporter), member 1 [Source:MGI Symbol;Acc:MGI:1353474])

HSP 1 Score: 102.064 bits (253), Expect = 1.240e-23
Identity = 81/309 (26.21%), Postives = 139/309 (44.98%), Query Frame = 2
Query:  257 TNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASK--KTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVI 1177
             N+  S   +  L+  + F GGVFL+T L+ L P   +  ++ L       ++P     LA+GFFLV ++E          T ++    S  H  +  +  L       P+                    D                  P I +A    P   + L + +L F+L  HS+ EGL   +  +    + + + +L+H+ + A+SL + L     +  VV    +L  F+ + PLGIG+G A  L      +  +  +VL+G+AAGTF+Y+ F+EILP E+   +Q  LKV++++ GF+++
Sbjct:   57 ANHEASASGQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALEALHVTLQFPLQEFILAMGFFLVLVMEQI--------TLAYKEQTSPPHPEETRA--LLGTVNGGPQHW-----------------HDG-----------------PGIPQAGG-TPAAPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRVQVVAGCGIL--FSCMTPLGIGLGAA--LAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELATSEQRILKVILLLAGFALL 316          
BLAST of slc39a-8 vs. Ensembl Mouse
Match: Slc39a2 (solute carrier family 39 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:2684326])

HSP 1 Score: 72.7886 bits (177), Expect = 9.824e-14
Identity = 45/136 (33.09%), Postives = 74/136 (54.41%), Query Frame = 2
Query:  791 HSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPL-KVLMMVIGFSVIATMKIF 1195
            HS+ EGL   +      T+ + + VL H+ +   S+G+ L    T    +   + + A + P+G+ +G+ V  G      G +  AVL+GIAAGTF+YV F+EILP E+    +APL K   +  GF+ +A + ++
Sbjct:  175 HSVFEGLAVGLQATVAATIQLCVAVLAHKGLVVFSVGLRLGKIGTGPRWATFCILSLALMSPVGLALGLTVAGGASGQTQG-LAQAVLEGIAAGTFLYVTFLEILPREL-ACPEAPLAKYSCVAAGFAFMALIALW 308          
BLAST of slc39a-8 vs. UniProt/SwissProt
Match: sp|A4IIC5|S39A3_XENTR (Zinc transporter ZIP3 OS=Xenopus tropicalis OX=8364 GN=slc39a3 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 2.872e-32
Identity = 94/314 (29.94%), Postives = 158/314 (50.32%), Query Frame = 2
Query:  254 QTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIF 1195
            + ++  S   +  L+ +N F GGVFL+T    L P V  KF D+L+  +   +YP A   + +GFFL   +E      +  +       + +  N+ ++      + +DS     E     A     L   E  +S      S S+       I E  S  PI+        L FAL +HS+ EGL   +  + N  +++ I V+IHE++ A++LGV++A   T +  +I +    + +IP+GI +G+A+     +N+   + +A+LQGIA GTFI+V F EIL  E+  +    LKVL +V+G++V+A + +F
Sbjct:   30 EADFDKSSRSRKILSLSNSFAGGVFLATCFNALLPAVREKFFDLLKIGNISTDYPLAETIMMVGFFLTVFVE---QTVMTFRKEKPSFIDMETFNAGSD------IGSDSE---FESPFISANHGHNLY--EGGHSHH----SHSLN------IKELSSSSPIR-----LFSLVFALSAHSVFEGLALGLQEDGNKLLSLFIGVVIHETLVAMALGVSMAKVNTHLKDAIKMAVLVSTMIPIGIVVGMAIQSA--QNMASSIASALLQGIAGGTFIFVTFFEILVKELEEKNDRLLKVLFLVLGYTVLAVLVLF 312          
BLAST of slc39a-8 vs. UniProt/SwissProt
Match: sp|Q5U1X7|S39A3_RAT (Zinc transporter ZIP3 OS=Rattus norvegicus OX=10116 GN=Slc39a3 PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.666e-30
Identity = 103/354 (29.10%), Postives = 166/354 (46.89%), Query Frame = 2
Query:  179 IIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEI---------EPSIDEAHSH-VPIKGNLLGS------VMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIE--KNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            ++G F F+L+       +L     I+ ++  +   K  L+  N F GGVFL+T    L P V  K   +L       +YP A   + +GFFL   +E  V                                 + P   ++ + F A          D  SD ++   ES  V +         EP+   AHSH   ++   LG       + L FAL +HS+ EGL   +  E    V++ + V +HE++ A++LG+++A     +  +  L  T +A+IP+GIG+G    LGIE  +++   V +A+LQG+A GTF++V F+EIL  E+  R +  LKVL +V+G++V+A M
Sbjct:   12 MVGVFFFMLLG------SLLPVKVIEADFEKAHRSKKVLSLCNTFGGGVFLATCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQLV----------------------------LTFRRERPP-FIDLETFNAGS--------DAGSDSEY---ESPFVGVGGRNHGLYPEPT---AHSHGTGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAVHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLG----LGIESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLAGM 312          
BLAST of slc39a-8 vs. UniProt/SwissProt
Match: sp|Q9BRY0|S39A3_HUMAN (Zinc transporter ZIP3 OS=Homo sapiens OX=9606 GN=SLC39A3 PE=1 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 1.804e-30
Identity = 99/338 (29.29%), Postives = 165/338 (48.82%), Query Frame = 2
Query:  179 IIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIE--KNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            ++G F F+L+       +L     I+T++  +   K  L+  N F GGVFL+T    L P V  K   +L       +YP A   L +GFF+   LE  +   +  +       + +  N+ ++      + +DS      E  F        L +E +        S SVQ      +  A    P++      + L FAL +HS+ EGL   +  E    V++ + V +HE++ A++LG+++A     +  +  L  T +A+IPLGIG+G    LGIE  + + G V + +LQG+A GTF+++ F+EIL  E+  +    LKVL +V+G++V+A M
Sbjct:   12 MVGVFFFMLLG------SLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREKLQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLI---LTFRKEKPSFIDLETFNAGSD------VGSDSEY----ESPFMGGARGHALYVEPHGHGP----SLSVQ-----GLSRAS---PVR-----LLSLAFALSAHSVFEGLALGLQEEGEKVVSLFVGVAVHETLVAVALGISMARSAMPLRDAAKLAVTVSAMIPLGIGLG----LGIESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKELEEKSDRLLKVLFLVLGYTVLAGM 309          
BLAST of slc39a-8 vs. UniProt/SwissProt
Match: sp|Q99K24|S39A3_MOUSE (Zinc transporter ZIP3 OS=Mus musculus OX=10090 GN=Slc39a3 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.577e-30
Identity = 95/316 (30.06%), Postives = 151/316 (47.78%), Query Frame = 2
Query:  284 KTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKF------LTSESVQVEIEPSIDEAHSH-VPIKGNLLGS------VMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIE--KNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            K  L+  N F GGVFL+T    L P V  K   +L       +YP A   + +GFFL   +E  V                                 + P   ++ + F A          D  SD ++      + + S  +  EP+   AH+H   ++   LG       + L FAL +HS+ EGL   +  E    V++ + V IHE++ A++LG+++A     +  +  L  T +A+IP+GIG+G    LGIE  +++   V +A+LQG+A GTF++V F+EIL  E+  R +  LKVL +V+G++V+A M
Sbjct:   41 KKVLSLCNTFGGGVFLATCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQLV----------------------------LTFRRERPP-FIDLETFNAGS--------DAGSDSEYESPFVGVGNRSHSLYPEPT---AHTHGAGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVGVAIHETLVAVALGISMARSAVPLRDAAKLAVTVSAMIPVGIGLG----LGIESARSVASSVASALLQGLAGGTFLFVTFLEILAKELEERSEQLLKVLFLVLGYAVLAGM 312          
BLAST of slc39a-8 vs. UniProt/SwissProt
Match: sp|Q5E960|S39A3_BOVIN (Zinc transporter ZIP3 OS=Bos taurus OX=9913 GN=SLC39A3 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 9.012e-30
Identity = 96/338 (28.40%), Postives = 159/338 (47.04%), Query Frame = 2
Query:  179 IIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIE--KNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            ++G F F+L+       +L     I+ ++  +   K  L+  N F GGVFL+T    L P V  K  ++L       +YP A   + +GFF+   LE  V   +  +       + +  N+ +++       +DS      E  F        L  E +                  S+ E     P++      + L FAL +HS+ EGL   +  E    V++ + V IHE++ A++LG+N+A    ++  +  L  T +A+IPLGI +G    LGIE  + +   V + +LQG+A GTF++V F EIL  E+  +    LKVL +V+G++V+A M
Sbjct:   12 MVGMFFFMLLG------SLLPVKIIEMDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREKLKEVLTLAHISTDYPLAETIMLLGFFMTVFLEQLV---LTFRKERPAFIDLETFNASSDA------GSDSEY----ESPFMGGPRGHALYAEPHGHSHGL------------SVQELSRSSPLR-----LLSLVFALSAHSVFEGLALGLQEEGEKVVSLFVGVAIHETLVAVALGINMARSAMALRDAAKLAVTVSAMIPLGISLG----LGIESAQGMPSSVASVLLQGLAGGTFLFVTFFEILAKELEEKSDRLLKVLFLVLGYTVLAGM 309          
BLAST of slc39a-8 vs. TrEMBL
Match: A0A0H3YKI0 (Slc39a-8 OS=Schmidtea mediterranea OX=79327 GN=slc39a-8 PE=2 SV=1)

HSP 1 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 387/387 (100.00%), Postives = 387/387 (100.00%), Query Frame = 2
Query:  122 MDAKTLKFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIFHAHGDRQNMFLNCTSNFSTSLQKSPVHTH 1282
            MDAKTLKFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIFHAHGDRQNMFLNCTSNFSTSLQKSPVHTH
Sbjct:    1 MDAKTLKFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIFHAHGDRQNMFLNCTSNFSTSLQKSPVHTH 387          
BLAST of slc39a-8 vs. TrEMBL
Match: A0A2G9NBN7 (Zinc transporter ZIP3 OS=Lithobates catesbeianus OX=8400 GN=AB205_0115820 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 3.403e-33
Identity = 94/307 (30.62%), Postives = 159/307 (51.79%), Query Frame = 2
Query:  284 KTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACI---HAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIF 1195
            +  L+  N F GGVFL+T    L P V  KF ++L+  +   +YP A   + +GFFL     +FV   I     +  S +   +    SD  S        DS  +           S  + + +DNN  ++  +  +  + I     E     P++      V L FAL +HS+ EGL   +  + +  +N+ I V+IHE++ A+++GVN+A  KTS+  ++ +    + +IP+GI IG+A+     +N+   + +A+LQG+AAGTF++V F EIL  E+ ++    LKVL +V+G++V+A +  F
Sbjct:   40 QRILSLCNSFAGGVFLATCFNALLPAVREKFEEVLKLGNVSTDYPLAETVMLVGFFLT----VFVEQVILTFRKEKRSFYDLETLNVGSDAGS--------DSEYE-----------SPFISSNQDNNQYERGHSHHTHSLNIR----ELSKSGPLR-----LVSLVFALSAHSVFEGLALGLQEQGDKVLNLFIGVIIHETLIAVAMGVNMAKAKTSMGDAVKMAVLVSIMIPIGISIGLAIESA--QNMASSITSALLQGLAAGTFLFVTFFEILVKELEDKYDRLLKVLFLVLGYAVLAILVFF 312          
BLAST of slc39a-8 vs. TrEMBL
Match: A0A1S3J436 (zinc transporter ZIP3 OS=Lingula unguis OX=7574 GN=LOC106169914 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 8.159e-32
Identity = 94/334 (28.14%), Postives = 162/334 (48.50%), Query Frame = 2
Query:  269 VSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRK-RSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLT------SESVQVEIEPSIDEAHS-----------------HVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIFH 1198
            VS   K  ++  N    GVFL T      P V  KF+ I    R +         ++ +GFFL+  LE  +  C   K  +H HG+            + A++ D P++ L+      + S + +  E++N   K         ++S +    P ++  H+                  +  + +++G + L  AL  H + EG+  A+    +  +++ I ++ HES+CAL++G+ LA +     T + L    AA+IP G+GIG+A  LG     VG  ++A+LQGIAAGTFI V+F+E+LP E+H+ +   +KVL + +G+ ++A +   H
Sbjct:   54 VSPKSKLIMSLCNCLSAGVFLGTCFNAFIPHVREKFDGIFSNARWHHDSSSATEFTVIMGFFLILTLEKLIMMC-QKKPMTHSHGHE-----------MTALNLDLPEEELDGYTASEESSAESVDWENSNESQKLCKPKRHSHTKSRKFVSHPQVNHLHNSHMSHDHHSHAGHSHHVEISDQESIIGCISLLLALSVHGLFEGMALALQQSIDKLISLFIAIISHESLCALAMGITLAKQDLQSWTIVKLAVALAAVIPAGMGIGMA--LGQIHGQVGLTISAILQGIAAGTFINVIFLEMLPVEIHSNQYPMVKVLFVFLGYIIMAGLSFAH 373          
BLAST of slc39a-8 vs. TrEMBL
Match: A0A1W2W3D8 (zinc transporter ZIP2-like OS=Ciona intestinalis OX=7719 GN=LOC100179030 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 2.458e-30
Identity = 89/315 (28.25%), Postives = 156/315 (49.52%), Query Frame = 2
Query:  305 NFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSD----KLLTIEDNNSDDKFLTSESV-----------QVEIEPSIDEAHSHVPIKG-NLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILP----AEMHNRKQAPLKVLMMVIGFSVIATMK 1189
            N    GVF ST  + + P    +F  +  +      YP+A L +++GFF V ++E FV  C        +  N+KQ  ++ N I     S +     +E         +     L+  E+N  D K  T   V            V+ +P+   +H H  I   + + +++L FAL +H++ EGL   +    N    +++ VLIH+   A S G++L S K ++ + ++ L  F+ + P+GIG+G A+    E + V + + A+ Q  A+GTF+YV+F+EI+P     E  +R+ +  KV  M+ GF+V+A+++
Sbjct:   47 NCLSAGVFFSTFFMHMLPEAQEEFASVFGETG----YPFAELLVSLGFFFVMLIEQFVLTC--------YDDNAKQKTTEGNMIANSYASANFESSEVERSTLSQNNPNYHTLDLVKDENNGRDRKGSTQTEVIVCEGEQTVIKVVKAKPTQGHSHGHADIPSHSSVRAIILLFALSAHALFEGLAIGLQTSTNALRTLVVAVLIHKMALAFSYGISLISDKANLKSVLTALTIFSIMAPIGIGVGAALTSAKEGDDVIEKIIAITQAFASGTFVYVIFIEIIPHEFTGESSDRRMS--KVTCMMAGFAVMASLQ 347          
BLAST of slc39a-8 vs. TrEMBL
Match: A7SPR1 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g192163 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 3.564e-30
Identity = 96/308 (31.17%), Postives = 148/308 (48.05%), Query Frame = 2
Query:  293 LTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIFHAHGDRQ 1216
            L+  N F  GVF +TS + L P +  KF     + +    +P    +   GFF+V I+E  VH+C H K    H      H+    + PL      +P Q       K +  D    +  N    +  + E  +V+                + L + +L  AL  HSI EGL   ++ E +  V +   V+IH+S+ A S+GV++      +   ++    F+A+ PLGIGIG+AV L    +   ++ +A+LQGIA GTFIYV F EIL  E+    +  LK+L MVIGFSV+  +  F  + +R+
Sbjct:   39 LSLCNCFAAGVFFATSFLDLLPMIREKFKQAFAEANITSPFPIPEFTTCFGFFVVLIVEQVVHSC-HKKARFFH-----GHSHVETTAPL----LGTPPQ--NGYGNKERSEDSFTPL--NERAHQINSQELAEVD----------------STLRTYILVVALSLHSIFEGLALGLLVEVDRLVQIAAAVVIHKSIIAFSMGVSMVKHDMPLRVIVNASFLFSAMGPLGIGIGIAV-LKESTHFSSNLSSAILQGIANGTFIYVTFFEILQNELKGHGKKLLKLLFMVIGFSVVCGLLYFANYMERK 315          
BLAST of slc39a-8 vs. Ensembl Cavefish
Match: SLC39A3 (solute carrier family 39 member 3 [Source:NCBI gene;Acc:103038117])

HSP 1 Score: 119.398 bits (298), Expect = 5.032e-30
Identity = 90/314 (28.66%), Postives = 152/314 (48.41%), Query Frame = 2
Query:  251 IQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIE--KNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            +Q+++  +   +  + F+N F GGVFL+T    L P V  K  ++L+      +YP A   + +GFFL   +E    A +  +       + +  N+  +        +DS             + D        +S               P+  E     P++   L S++L  AL +HS+ EGL   +  +     ++ I V IHE++ A++LGV+ A     +  +  L  T + +IPLGIG+G    +GIE  +NL G +V+ VLQG+AAGTF+++ F EIL  E+ ++    LKVL +V+G+ V+A +
Sbjct:   29 MQSDFDKAARYRRAVAFSNSFGGGVFLATCFNALLPAVRDKVGEVLKMLQATTDYPLAETMMMLGFFLTVFVE---QAVLTFRKERPSFIDLETFNAGGSE-----AGSDS-------------EYDTPFIAPPRSSAAHQNHHSHHHGHFNPA--ELTRAGPLR---LASLVL--ALSAHSVFEGLALGLQEDGAKLGSLFIGVAIHETLAAVALGVSTAKAGLMLRDASKLAVTVSLMIPLGIGLG----MGIETAQNLAGSIVSVVLQGLAAGTFLFITFFEILSRELEDKHDRLLKVLFLVLGYGVLAGL 310          
BLAST of slc39a-8 vs. Ensembl Cavefish
Match: slc39a1 (zinc transporter ZIP1-like [Source:NCBI gene;Acc:103033216])

HSP 1 Score: 104.375 bits (259), Expect = 9.002e-25
Identity = 93/331 (28.10%), Postives = 149/331 (45.02%), Query Frame = 2
Query:  197 FILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNL-VGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            F  I  R+R    R  S  +T+       +  L+F + F GGVFL+  L+ + P   S  +D L+       +P A   +A GFF V ILE  V +C  +++                + PL                               + +D   ++  V V++     +AHS          S ML  +L  HS+ EGL   +       + + I +L+H+S+   SL V L             +  FA + P+GIG+G+ V+   E  L  G +V  +L+G+AAGTFIY+ F+EILP E+++ ++  LKVL +++GFSV+A +
Sbjct:   22 FGFIPARMRW--FRETSGTETH-------QKVLSFISCFAGGVFLAACLLDIIPDYLSDISDQLQGLDG--GFPVAEFIMACGFFTVLILERIVLSCTGSRS--------------EETSPLLGHGHGH-------------------AHGHRSVNDMEGSAHHVHVDL-----QAHSS-------FRSFMLFLSLSLHSVFEGLAIGLQTTDAKVLEICIAILVHKSIIVFSLSVKLVQSAVRPAWVGIYITVFALMSPIGIGVGIGVS---EAKLHSGALVQGILEGMAAGTFIYITFLEILPHELNSPERQLLKVLFILVGFSVMAGL 293          
BLAST of slc39a-8 vs. Ensembl Cavefish
Match: SLC39A1 (zinc transporter ZIP1 [Source:NCBI gene;Acc:103025837])

HSP 1 Score: 60.4622 bits (145), Expect = 9.751e-10
Identity = 70/307 (22.80%), Postives = 124/307 (40.39%), Query Frame = 2
Query:  320 GVFLSTSLIGLYP----GVNSKFNDI-LRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSH-VPIKGNLLGS------------VMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            GVFL++SL+ + P    G+   F+++ +  R  +PE+      LA+GF LV ++E  V A                                    L E+      + + LL   +    D+            P     +S  V  KG   G              +L F+L   S+ EGL   +       +N+ +++L  + + ALSL + L   +   V   + L  F+A  PLG  +G+++           +  + LQG+AAG+F+Y+  ME+L   + +  Q   KV +++ GF+ +  +
Sbjct:   65 GVFLASSLLNMVPSYMIGMTETFSNLGVTLRFPVPEFI-----LAMGFLLVVVIEQVVLA------------------------------------LKEQSGIYMTEKEALLVGSNVQPHDR-----------HPQCSHQYSRTVQFKGRGFGGDADVSSLSTIRIFVLVFSLSLCSVFEGLAVGLQEASGQGLNLSLSLLFRKGLIALSLVIKLTQDQLRRVAVTTCLLLFSATCPLGAVLGISLR-QTHTTPQYQLARSTLQGLAAGSFLYITVMEVLTYALSSSGQRISKVTLLLTGFTAVTVL 318          
BLAST of slc39a-8 vs. Ensembl Sea Lamprey
Match: SLC39A3 (solute carrier family 39 member 3 [Source:HGNC Symbol;Acc:HGNC:17128])

HSP 1 Score: 81.6481 bits (200), Expect = 2.385e-17
Identity = 48/137 (35.04%), Postives = 77/137 (56.20%), Query Frame = 2
Query:  791 HSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEM-HNRKQAPLKVLMMVIGFSVIATMKIFH 1198
            HS  EG+   +       V + + V +HE++ A +LGV++A    +   +  L A F   IP+G+ IG AV       L GD  + VLQG+AAGTF++V F+E+L  EM H ++   LKV ++ +G+++ A +   H
Sbjct:  188 HSAFEGVALGLQETAAKAVGLAVAVGVHETLAAAALGVSMARAGLAPCRAARLAAAFCTAIPVGVAIGAAVE-NGAAGLAGDAASLVLQGLAAGTFLFVAFLEVLAKEMAHGQRDRMLKVALLAVGYALPAGLAFMH 323          
BLAST of slc39a-8 vs. Ensembl Nematostella
Match: EDO34311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPR1])

HSP 1 Score: 130.183 bits (326), Expect = 4.500e-34
Identity = 96/308 (31.17%), Postives = 148/308 (48.05%), Query Frame = 2
Query:  293 LTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIFHAHGDRQ 1216
            L+  N F  GVF +TS + L P +  KF     + +    +P    +   GFF+V I+E  VH+C H K    H      H+    + PL      +P Q       K +  D    +  N    +  + E  +V+                + L + +L  AL  HSI EGL   ++ E +  V +   V+IH+S+ A S+GV++      +   ++    F+A+ PLGIGIG+AV L    +   ++ +A+LQGIA GTFIYV F EIL  E+    +  LK+L MVIGFSV+  +  F  + +R+
Sbjct:   39 LSLCNCFAAGVFFATSFLDLLPMIREKFKQAFAEANITSPFPIPEFTTCFGFFVVLIVEQVVHSC-HKKARFFH-----GHSHVETTAPL----LGTPPQ--NGYGNKERSEDSFTPL--NERAHQINSQELAEVD----------------STLRTYILVVALSLHSIFEGLALGLLVEVDRLVQIAAAVVIHKSIIAFSMGVSMVKHDMPLRVIVNASFLFSAMGPLGIGIGIAV-LKESTHFSSNLSSAILQGIANGTFIYVTFFEILQNELKGHGKKLLKLLFMVIGFSVVCGLLYFANYMERK 315          
BLAST of slc39a-8 vs. Ensembl Medaka
Match: SLC39A3 (solute carrier family 39 member 3 [Source:NCBI gene;Acc:101157119])

HSP 1 Score: 110.153 bits (274), Expect = 1.190e-26
Identity = 86/304 (28.29%), Postives = 142/304 (46.71%), Query Frame = 2
Query:  293 LTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIE--KNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIFH 1198
            L+  N F GGVFL+T    L P V  K   +  +     +YP A   + +GFFL   +E    A +  +       + +  N+  +        +DS             + D        +S D             PS  E     P++  L G   L  AL +HS+ EGL   +  +     ++ + V +HE++ A++LGV++A     +  +I L  T + +IPLG+ +G    +GIE  + L GDV + +LQG+AAGTF++V F EIL  E+ + +   LKVL +++G++ +A +  F 
Sbjct:   43 LSLCNSFGGGVFLATCFNALLPAVREKVAALFEQLKISGDYPLAETMMMVGFFLTVFVE---QAVLTFRREKPSFIDLETFNAGGSE-----AGSDS-------------EYDTPFISSARSSADVARRHGHHHGHFSPS--ELAGAGPLR--LAG---LVLALSAHSVFEGLALGLQEDGAKLGSLFLGVAVHETLAAVALGVSVAKSSLGMQDAIKLGVTVSLMIPLGMVVG----MGIESAQTLGGDVASVLLQGLAAGTFLFVTFFEILSRELEDTRDRLLKVLFLILGYAALAVLVFFK 314          
BLAST of slc39a-8 vs. Ensembl Medaka
Match: slc39a1 (solute carrier family 39 member 1 [Source:NCBI gene;Acc:101170659])

HSP 1 Score: 107.842 bits (268), Expect = 5.487e-26
Identity = 91/316 (28.80%), Postives = 144/316 (45.57%), Query Frame = 2
Query:  254 QTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAH----SHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLV-GDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM 1186
            QTN   S+  +T L+  + F GGVFL+  L+ + P   S  +  L  +     +P     +A GFF V ILE         KT  H                              E+    ++   LL+   N      +T+     ++E S    H    +H P +     S ML  +L  HS+ EGL   +    +  + + I +L+H+S+   SL V L           + +  FA + PLGI IG++V   +E  L  G ++ A+L+G+AAGTFIY+ FMEILP E+++  +  LKVL +++GF+ +A +
Sbjct:   34 QTNG--SETHRTVLSLISCFAGGVFLAACLLDIIPDYLSDISAALDVQKLETSFPLPEFIIAAGFFTVLILE---------KTVMH----------------------------FRERRGAGEERAPLLSGNRNGHGHGAVTTP----DLEDSAHHVHVDFQAHSPFR-----SFMLFLSLSLHSVFEGLAIGLQSTDSKVLEICIAILVHKSIIVFSLSVKLVQSAVQPAWVAAYIFVFAMMSPLGIAIGISV---VEAALTSGALIQAILEGLAAGTFIYITFMEILPHELNSAGKQILKVLFILLGFTTMAAL 298          
BLAST of slc39a-8 vs. Ensembl Medaka
Match: ENSORLT00000030843.1 (solute carrier family 39 member 4 [Source:NCBI gene;Acc:101165941])

HSP 1 Score: 50.0618 bits (118), Expect = 4.397e-6
Identity = 63/272 (23.16%), Postives = 115/272 (42.28%), Query Frame = 2
Query:  401 NIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGL--GFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAP-----LKVLMMVIGFSVIATMKIF 1195
             IP+Y Y  L+   G +L +++E  + + I  + H  H   S  H+ D+  +                ++F+ ++  K     D N      TSE+  VEIE     +  +   +   +   M+T   G H+  +GL  G A    +   +   + VL HE    +     L     SV  ++ LL   +A+I     +G+ + L +  +      T  +  +A G F+YV   ++LP  +H R + P     L+ L ++ G+SV+  + +F
Sbjct:  445 GIPDYTYKMLAALGGIYLFYLMES-IFSLITQENHHQHAEESDPHHCDHGRVL---------------EMFQKERRQK-----DRNQS----TSETDLVEIEKQKSVSDLNEDKRETRMLPYMITIGDGIHNFADGLAVGAAFSLSWKSGLATSVAVLCHELPHEVGDFAILLYSGMSVPRAL-LLNLASAMISF---VGLYIALSVATDFA---TTQWITAVAGGLFMYVGLADMLPTLVHARSRRPWLTFALQNLGLLTGWSVLLLLSLF 684          
BLAST of slc39a-8 vs. Planmine SMEST
Match: SMESG000009752.1 (SMESG000009752.1)

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 386/387 (99.74%), Postives = 387/387 (100.00%), Query Frame = 2
Query:  122 MDAKTLKFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIFHAHGDRQNMFLNCTSNFSTSLQKSPVHTH 1282
            MDAKTLKFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNY+VSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIFHAHGDRQNMFLNCTSNFSTSLQKSPVHTH
Sbjct:    1 MDAKTLKFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYIVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIFHAHGDRQNMFLNCTSNFSTSLQKSPVHTH 387          
BLAST of slc39a-8 vs. Planmine SMEST
Match: SMESG000009750.1 (SMESG000009750.1)

HSP 1 Score: 644.81 bits (1662), Expect = 0.000e+0
Identity = 329/386 (85.23%), Postives = 334/386 (86.53%), Query Frame = 2
Query:  122 MDAKTLKFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIFHAHGDRQNMFLNCTSNFSTSLQKSPVHT 1279
            MDAKTLKFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDIL KRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSD N                                      DKF  SESVQV IE +  EAHSHV I  N+L SVMLTFA+GSHSIIEGLGFAMIGEFNL VNMLITVLIHESVCALSLGVNL+SKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATM+IFHAHGDRQNMFL CTSNFSTSLQKSPVHT
Sbjct:    1 MDAKTLKFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILLKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDKN-------------------------------------KDKFWISESVQVFIESNTVEAHSHVEINDNILSSVMLTFAMGSHSIIEGLGFAMIGEFNLIVNMLITVLIHESVCALSLGVNLSSKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMQIFHAHGDRQNMFLKCTSNFSTSLQKSPVHT 349          

HSP 2 Score: 58.151 bits (139), Expect = 5.503e-9
Identity = 27/27 (100.00%), Postives = 27/27 (100.00%), Query Frame = 3
Query: 1281 IDSWCQSFTTHVHVIFSIFILIYSLNF 1361
            IDSWCQSFTTHVHVIFSIFILIYSLNF
Sbjct:  350 IDSWCQSFTTHVHVIFSIFILIYSLNF 376          
BLAST of slc39a-8 vs. Planmine SMEST
Match: SMESG000069905.1 (SMESG000069905.1)

HSP 1 Score: 109.768 bits (273), Expect = 3.375e-26
Identity = 88/345 (25.51%), Postives = 157/345 (45.51%), Query Frame = 2
Query:  176 FIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLF----KAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEK-NLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIF 1195
            FI+   PFI+I    +K  + + ++ + N    +   T+L+  N F GGVFLST  + ++P +     +   K      +P       IGFF++ I+E  V   I  + +      +K   +D   +P    S   P   + E  F    +++ S+++L      S D+ L   S+        D   +   +    L   +L  A+  HSI EGL   +  E +    + + + +H+ + A ++ + L+     +  +      F+   P G+ +G  VN   E  N    +V  VLQGIA GTF Y+VF EILP E   ++   LK++ +++GF++++   +F
Sbjct:   40 FIVTLIPFIVIRHLSKKWGIESVNKTRENSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKMTSVFPLGPFLTLIGFFMILIIEELV-TFIKNRFYGSKVSPTKVVINDEFIMPTE--SNAWPSSAVNENTFDFDKESRDSNQVL---KKVSVDRELHDHSIDHAHHDHHDHDLNAEALSRGTLSVTILMIAISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQLSKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGVLQGIACGTFFYIVFFEILPEEFGKKQDKILKIVAVILGFALVSLFMLF 378          
BLAST of slc39a-8 vs. Planmine SMEST
Match: SMESG000056994.1 (SMESG000056994.1)

HSP 1 Score: 108.227 bits (269), Expect = 1.069e-25
Identity = 83/348 (23.85%), Postives = 159/348 (45.69%), Query Frame = 2
Query:  161 IFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTDSPKQLLEEQLFK--AKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEK-NLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFSVIATMKIF 1195
            +F+V FI    PFI+I +  +K  + N ++ +      +   T+L+  N F GGVFLST  + ++P +     +   K      +P       +GF+L+ I+E  V   I  + +     ++K+  +    IP  + S    +  + E  F    K  D   T++  +   +           +    + ++    +G L  ++++  A+  HSI EGL   +  E +    + + + +H+ + A ++ + ++     +  +      F+   P G+ +G  VN   E  N    +V  +LQGIA GTF Y+VF EILP E   RK   +K + +++GF++++   +F
Sbjct:   39 VFIVTFI----PFIVIRRLDKKWGIENVNKTRETSKAYRRFTTWLSRINCFAGGVFLSTGFMDIFPEMLESIEEAKIKNKITNSFPLGPFLTLVGFYLILIIEELV-TFIKNRFYGPKVSDNKEVVNHEFIIPTESNSWS--RSTVSESTFDFVEKIRDSNQTMKKASFSRELHDHSIDHAHHDHHEHDLNAEALSRGTLSVTILMI-AISIHSIFEGLALGLQKETSAATRLFLALCLHKYIIATTISLQISKSSLGIKMACLCSGIFSFATPFGVVLGFWVNYLEENGNTSFSMVAGILQGIACGTFFYIVFFEILPQEFGKRKDKIIKTIALILGFALVSLFMLF 378          
BLAST of slc39a-8 vs. Planmine SMEST
Match: SMESG000016934.1 (SMESG000016934.1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.634e-21
Identity = 94/365 (25.75%), Postives = 160/365 (43.84%), Query Frame = 2
Query:  143 FISIPI-------IFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVVSKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPYAGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAMSTD-------------SPKQLLEEQLFKAKQSDKLLTIEDN---NSDDKFLTSESVQVEIEPSIDEAHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLIHESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEKNLVGDVVTAVLQGIAAGTFIYVVFMEILPAEM----HNRKQAPLKVLMM 1156
            +IS+P+       + +V  +I  F  ILI  ++  +  RN    +    V++         + F  GVFLST  + ++P V    +   +K +    +P A     IGFFL+  +E  +   +  K H    G+    N    S      S +             S  +L  + + K++ +D  L    +    +DD F  +E    EI   +    S +           L FA+  H++ EGL   +       + + I + +H+ + A SLG+NLA+ +  +   IS+   F+   P+GIG+G  +    + + V  +V  +L+GIA GTF+YVVF EILP E+    H  + A L  ++M
Sbjct:   18 WISVPVGKAITAVVMLVTVLIAIFLPILIFGKLNLSRQRNSFRDKVQLWVAR--------LSCFAAGVFLSTGFLDIFPDVIKSIDTAGKKLNLNLWFPLASFFTLIGFFLILSIEQLI---LIYKNHLAMIGSGSIKNIKRISPIFEEESQEAFLTEISDVNVNASFDKLAGQGISKSRSTDSDLMDHKHFSETTDDDFNNNELESDEIGNILHHNKSRI---------FALMFAMSFHAVFEGLAIGLGTTIAGILQLFIALSMHKLIIAASLGLNLATAELKLWIKISVAMIFSCASPIGIGLGALIMSQEKGHDVLFLVGGILEGIACGTFLYVVFFEILPHELGHSAHKDRGAKLACVLM 362          
The following BLAST results are available for this feature:
BLAST of slc39a-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC39A33.757e-3129.29solute carrier family 39 member 3 [Source:HGNC Sym... [more]
SLC39A33.992e-3129.29solute carrier family 39 member 3 [Source:HGNC Sym... [more]
SLC39A11.250e-2327.13solute carrier family 39 member 1 [Source:HGNC Sym... [more]
SLC39A11.390e-2327.13solute carrier family 39 member 1 [Source:HGNC Sym... [more]
SLC39A11.390e-2327.13solute carrier family 39 member 1 [Source:HGNC Sym... [more]
back to top
BLAST of slc39a-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zipt-2.24.394e-2124.40Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-2.15.540e-2126.05Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-2.15.540e-2126.05Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-2.41.070e-2037.04Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-31.479e-2025.81Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
back to top
BLAST of slc39a-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Zip89B1.100e-2227.52gene:FBgn0038412 transcript:FBtr0083266[more]
Zip42C.18.632e-2225.99gene:FBgn0033096 transcript:FBtr0086139[more]
Zip42C.21.049e-1322.38gene:FBgn0033097 transcript:FBtr0306802[more]
Zip88E1.473e-1021.99gene:FBgn0038312 transcript:FBtr0290018[more]
back to top
BLAST of slc39a-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc39a13.324e-2929.90solute carrier family 39 member 1 [Source:NCBI gen... [more]
slc39a13.324e-2929.90solute carrier family 39 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc39a-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc39a38.463e-3329.94solute carrier family 39 member 3 [Source:NCBI gen... [more]
slc39a18.145e-2226.37solute carrier family 39 member 1 [Source:NCBI gen... [more]
camk2n25.443e-2129.10calcium/calmodulin-dependent protein kinase II inh... [more]
alkbh66.566e-1526.07alkB homolog 6 [Source:Xenbase;Acc:XB-GENE-5891943... [more]
back to top
BLAST of slc39a-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc39a35.114e-3130.06solute carrier family 39 (zinc transporter), membe... [more]
Slc39a31.703e-3030.06solute carrier family 39 (zinc transporter), membe... [more]
Slc39a31.703e-3030.06solute carrier family 39 (zinc transporter), membe... [more]
Slc39a11.240e-2326.21solute carrier family 39 (zinc transporter), membe... [more]
Slc39a29.824e-1433.09solute carrier family 39 (zinc transporter), membe... [more]
back to top
BLAST of slc39a-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IIC5|S39A3_XENTR2.872e-3229.94Zinc transporter ZIP3 OS=Xenopus tropicalis OX=836... [more]
sp|Q5U1X7|S39A3_RAT1.666e-3029.10Zinc transporter ZIP3 OS=Rattus norvegicus OX=1011... [more]
sp|Q9BRY0|S39A3_HUMAN1.804e-3029.29Zinc transporter ZIP3 OS=Homo sapiens OX=9606 GN=S... [more]
sp|Q99K24|S39A3_MOUSE3.577e-3030.06Zinc transporter ZIP3 OS=Mus musculus OX=10090 GN=... [more]
sp|Q5E960|S39A3_BOVIN9.012e-3028.40Zinc transporter ZIP3 OS=Bos taurus OX=9913 GN=SLC... [more]
back to top
BLAST of slc39a-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKI00.000e+0100.00Slc39a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A2G9NBN73.403e-3330.62Zinc transporter ZIP3 OS=Lithobates catesbeianus O... [more]
A0A1S3J4368.159e-3228.14zinc transporter ZIP3 OS=Lingula unguis OX=7574 GN... [more]
A0A1W2W3D82.458e-3028.25zinc transporter ZIP2-like OS=Ciona intestinalis O... [more]
A7SPR13.564e-3031.17Predicted protein OS=Nematostella vectensis OX=453... [more]
back to top
BLAST of slc39a-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC39A35.032e-3028.66solute carrier family 39 member 3 [Source:NCBI gen... [more]
slc39a19.002e-2528.10zinc transporter ZIP1-like [Source:NCBI gene;Acc:1... [more]
SLC39A19.751e-1022.80zinc transporter ZIP1 [Source:NCBI gene;Acc:103025... [more]
back to top
BLAST of slc39a-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SLC39A32.385e-1735.04solute carrier family 39 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc39a-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc39a-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO343114.500e-3431.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc39a-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC39A31.190e-2628.29solute carrier family 39 member 3 [Source:NCBI gen... [more]
slc39a15.487e-2628.80solute carrier family 39 member 1 [Source:NCBI gen... [more]
ENSORLT00000030843.14.397e-623.16solute carrier family 39 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc39a-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009752.10.000e+099.74SMESG000009752.1[more]
SMESG000009750.15.503e-985.23SMESG000009750.1[more]
SMESG000069905.13.375e-2625.51SMESG000069905.1[more]
SMESG000056994.11.069e-2523.85SMESG000056994.1[more]
SMESG000016934.12.634e-2125.75SMESG000016934.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012526
GenBankAKN21673.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012526 ID=SMED30012526|Name=slc39a-8|organism=Schmidtea mediterranea sexual|type=transcript|length=1371bp
CTGATATTTTTTAAAATTTTCTAATTTATTTTTATTTAAAATTGCTATTA
AAAATTGCAGAGTTATTCCAAATTTAGAAATTTTTGTCTACAGTTGACAA
AGAATCTCAAACAAGGTTTAAATGGATGCCAAAACTCTCAAATTTATCAG
CATTCCAATAATATTTGTTGTGAATTTTATTATTGGAACTTTTCCTTTTA
TATTAATCACCAAACGTATCAGGAAAACAAATCTTCGAAACCCCTCAGAA
ATCCAAACCAATTATGTTGTTTCAAAACCTATGAAAACATTTTTAACATT
TGCCAACTTCTTTTGTGGGGGTGTTTTTCTTTCTACCTCTCTAATTGGAT
TATATCCCGGTGTAAATAGTAAATTCAACGATATTCTCCGAAAACGTTCC
AATATACCAGAATATCCGTATGCAGGTTTGTCACTCGCAATTGGCTTCTT
TTTGGTGTGGATTCTTGAAATTTTTGTTCACGCTTGTATTCATGCAAAAA
CTCATTCACATCACCATGGTAATTCTAAGCAGCACAATTCTGATAATAAC
AGTATCCCATTGCGGGCTATGTCGACAGATTCACCAAAGCAACTTTTGGA
AGAGCAACTATTTAAAGCAAAACAATCAGATAAACTGCTTACTATTGAAG
ATAATAATAGCGATGATAAATTTTTAACTTCAGAATCAGTTCAAGTTGAG
ATTGAACCAAGCATAGATGAAGCGCATAGTCATGTTCCAATTAAAGGTAA
TCTTTTGGGTTCTGTAATGCTGACATTTGCATTGGGCTCTCATTCAATAA
TAGAAGGTCTTGGATTTGCGATGATCGGAGAATTTAATTTGACTGTAAAC
ATGCTAATAACAGTTTTAATTCATGAATCAGTTTGTGCTTTATCTTTGGG
AGTAAATTTAGCGTCAAAAAAGACATCAGTTGTCACATCCATATCCCTGT
TGGCAACATTTGCTGCTCTCATACCACTGGGAATCGGAATAGGCGTGGCA
GTAAATTTGGGCATAGAAAAGAATTTAGTCGGAGATGTAGTGACTGCGGT
TCTTCAGGGAATAGCCGCTGGAACTTTTATTTATGTTGTTTTTATGGAAA
TTCTACCGGCTGAAATGCACAATAGAAAACAAGCTCCTTTGAAAGTGTTG
ATGATGGTCATTGGGTTCTCAGTAATTGCAACAATGAAAATCTTTCACGC
TCACGGAGACAGACAAAATATGTTTTTGAACTGTACCTCTAATTTCTCAA
CCAGTCTCCAGAAATCACCGGTCCACACCCATTGATAGCTGGTGCCAGAG
TTTCACAACTCATGTACATGTGATATTTTCTATTTTTATTTTAATATATT
CCTTAAATTTTTAAAAAAAAA
back to top

protein sequence of SMED30012526-orf-1

>SMED30012526-orf-1 ID=SMED30012526-orf-1|Name=SMED30012526-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MDAKTLKFISIPIIFVVNFIIGTFPFILITKRIRKTNLRNPSEIQTNYVV
SKPMKTFLTFANFFCGGVFLSTSLIGLYPGVNSKFNDILRKRSNIPEYPY
AGLSLAIGFFLVWILEIFVHACIHAKTHSHHHGNSKQHNSDNNSIPLRAM
STDSPKQLLEEQLFKAKQSDKLLTIEDNNSDDKFLTSESVQVEIEPSIDE
AHSHVPIKGNLLGSVMLTFALGSHSIIEGLGFAMIGEFNLTVNMLITVLI
HESVCALSLGVNLASKKTSVVTSISLLATFAALIPLGIGIGVAVNLGIEK
NLVGDVVTAVLQGIAAGTFIYVVFMEILPAEMHNRKQAPLKVLMMVIGFS
VIATMKIFHAHGDRQNMFLNCTSNFSTSLQKSPVHTH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR003689ZIP
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0030001metal ion transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0046873metal ion transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003689Zinc/iron permeasePFAMPF02535Zipcoord: 6..355
e-value: 6.4E-52
score: 176.8
NoneNo IPR availablePANTHERPTHR11040ZINC/IRON TRANSPORTERcoord: 6..358
NoneNo IPR availablePANTHERPTHR11040:SF137ZINC TRANSPORTER ZIP3coord: 6..358
NoneNo IPR availableTMHMMTMhelixcoord: 242..264
NoneNo IPR availableTMHMMTMhelixcoord: 10..29
NoneNo IPR availableTMHMMTMhelixcoord: 210..232
NoneNo IPR availableTMHMMTMhelixcoord: 303..325
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 271..293
NoneNo IPR availableTMHMMTMhelixcoord: 56..78
NoneNo IPR availableTMHMMTMhelixcoord: 338..360