Ankyrin-2

Overview
NameAnkyrin-2
Smed IDSMED30012522
Length (bp)5132
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ankyrin-2 (SMED30012522) t-SNE clustered cells

Violin plots show distribution of expression levels for Ankyrin-2 (SMED30012522) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ankyrin-2 (SMED30012522) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ankyrin-2 (SMED30012522) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012522

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 39

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30012522h1SMcG0002209 SmedASXL_016578SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012522 SmedASXL_009400SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012522 SmedASXL_001487SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012522 SmedASXL_002054SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012522 SmedASXL_004435SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012522 SmedASXL_002539SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30012522 dd_Smed_v4_10835_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012522 dd_Smed_v4_5031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012522 dd_Smed_v4_5031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012522 dd_Smed_v4_5031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30012522 dd_Smed_v4_5031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012522 Contig13421newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012522 Contig13421uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012522 Contig45595uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012522 Contig45595newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012522 Contig38789newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012522 Contig38789uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012522 Contig30779newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012522 Contig30779uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012522 Contig7155newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012522 Contig7155uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30012522 dd_Smed_v6_5031_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012522 OX_Smed_1.0.03920ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30012522 dd_Smed_v6_5031_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30012522 dd_Smed_v6_5031_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012522 dd_Smed_v6_10835_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30012522 dd_Smed_v6_10835_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30012522 dd_Smed_v6_10835_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin-2 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 402/775 (51.87%), Postives = 562/775 (72.52%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            ++LRAAR+G++EK  ++++  +  ++ N NGLNA+HLA+KEG+ EVV  L++   +VD AT+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VVK LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D+N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + A +++ TRDGL+P+HC ARSG E ++ +LL+  A I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    N NA+ALNGFTPLHIACKK + K++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L+ +GAS + T ++ E ALH+AAR+ Q E  +  L+   A   A+A+++QTPLHI+ R+G   IV+QLL  GA PN  T   YT LH++A+EG  +++  LL+H       TKKGFTPLH+A+KYG+++VA  LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G   +HL +  G+ +++ LLL  NA+VN   ++GLT LHLAA+++R ++ E L+   A +  +T+MGYT LH   H+G I+ V  LLQ +  VNA+T  G T LH AAQQGH  I+ +LL N    N     G TAL +A++  Y+++ +TL
Sbjct:   44 SYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR-YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVA-NLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 2 Score: 431.409 bits (1108), Expect = 1.734e-122
Identity = 208/501 (41.52%), Postives = 307/501 (61.28%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS-SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDE 4317
            W  + LD+V L+  P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E LA R++ +  +     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH     +  + + L  + E + + E   + RI RIIT   PQYF+++SR+KQ+   IG EGG ++S+    VQA FPEGAL K+I++ LQ   +   +++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y   T+ +LRLLCSI+G  +P  WEDITGT+PLT    CVSFTT +SAR WL DC++  E V +A+ LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +I+D S  PCG+++F+++P+                T+ LPQ  +C L+ITLP    +   +  DE
Sbjct:  965 WAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPAHKKETESDQDDE 1450          
BLAST of Ankyrin-2 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 803.127 bits (2073), Expect = 0.000e+0
Identity = 420/803 (52.30%), Postives = 570/803 (70.98%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            +FLRAAR+GN++KV E+L+  I  +  N NGLNA+HLAAKEG+  +VQ L+  G SVD AT+KGNT+LHIASLAG+ EVV +L++  ANIN +SQNGFTPLYMAAQENH+DVVK LLE GANQ+  T+DGFTPLAVALQQG+++ V ILL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D QS SGFTPLHIAAHY NVNVA LL+ + A V+F A+N ITPLHVA+K G   M+KLL+ +   +++ TRDGL+P+HCAARSG + ++ +LLE GA +  ++KNGL+ L MA QGD  E  K L+     VD VT+DYLTALHVAAHCG+    ++LL    N NARALNGFTPLHIACKK + K++ELL+KY A I + TE+GLTP+H+AAFMG   IV +LL+NGAS   T ++ E ALH+AAR  Q E  + LL +  A  +ARARE QTPLHIA R+G   IV+ LL   A P+  T + YT LHI+A+EG+ +++ +LLE        TKKGFTPLH+A+KYG + VA+ LLL  +   +S G +GLTPLHVA +Y++ ++  LLL+  A+ +   KNGYTPLH+ AKKN +++   L++ GA  N  +++G TPLHL S  G+ +++ LLLD  A+++   ++GLT+LHLAA++++ ++ + L K  AD    T++GYT L  A H+G ++ V  LL++  +VNA+T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  VT      + +  +K  L+ PE M +
Sbjct:   13 SFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRN-GALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAK-LLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTE 812          

HSP 2 Score: 455.292 bits (1170), Expect = 9.063e-132
Identity = 245/613 (39.97%), Postives = 365/613 (59.54%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAEN-------IQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIF--NPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  E LD+V L   P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTR+ C L ++    T+P + + E LA R+I +  S     GP+++EIPH AALR  ERE+VVL+S+NG SWKEH   +T+  + + L  + E        + + E   + RI RIIT   PQYF+++SR+KQD   IG EGG ++S+V  QVQAVFPEGAL K+I++ LQ   +   L++K  GN    SPIVTLEPRRRKFH+ IT+T+P+P  S       +     +LRLLCSI+G  TP  WEDITGT+PLT  + CVSFTT +SAR WLIDC +  E V  AS +Y E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    +++  GN++P+T S +        F+ENRL  + +++D +  PCG+++FM++P+                T+ L  + IC L+ITLP   T++  ++ ++E   D+    NP D++ER+       E  +  +A  +G  W +L   L   +E+I +I +++  + +D+++  L  W+   +D + +   N +E  L  I R DIV
Sbjct:  920 WGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEGGSFLVLVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKS---------------TRGLVHQAICNLNITLPIY-TKESESDQEQEEEIDMTSEKNPQDEQERI-------EERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWL--ERDGKHATDTNLVE-CLTKINRMDIV 1506          
BLAST of Ankyrin-2 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 408/801 (50.94%), Postives = 570/801 (71.16%), Query Frame = 2
Query:  107 MVEETKDSLTEKAH------------AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            M EE K+   + AH            ++LRAAR+G++EK  ++++  +  ++ N NGLNA+HLA+KEG+ EVV  L++   +VD AT+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VVK LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D+N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + A +++ TRDGL+P+HC ARSG E ++ +LL+  A I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    N NA+ALNGFTPLHIACKK + K++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L+ +GAS + T ++ E ALH+AAR+ Q E  +  L+   A   A+A+++QTPLHI+ R+G   IV+QLL  GA PN  T   YT LH++A+EG  +++  LL+H       TKKGFTPLH+A+KYG+++VA  LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G   +HL +  G+ +++ LLL  NA+VN   ++GLT LHLAA+++R ++ E L+   A +  +T+MGYT LH   H+G I+ V  LLQ +  VNA+T  G T LH AAQQGH  I+ +LL N    N     G TAL +A++  Y+++ +TL
Sbjct:    1 MSEEPKEKNAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR-YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVA-NLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 798          

HSP 2 Score: 434.876 bits (1117), Expect = 9.140e-125
Identity = 231/614 (37.62%), Postives = 353/614 (57.49%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS-SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNID--EEFSN-------DLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEE-DKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  + LD+V L+  P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E LA R++ +  +     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH     +  + + L  + E + + E   + RI RIIT   PQYF+++SR+KQ+   IG EGG ++S+    VQA FPEGAL K+I++ LQ   +   +++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y   T+ +LRLLCSI+G  +P  WEDITGT+PLT    CVSFTT +SAR WL DC++  E V +A+ LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +I+D S  PCG+++F+++P+                T+ LPQ  +C L+ITL   P  K +   D  + F++         +  P    +  C    ++++ +  VA  +G  W +L   L    +EI +I +++      ++++ L  W+T      K+   + L   L  I R DIV
Sbjct:  966 WAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITL---PAHKKIEKTDRRQSFASLALRKRYSYLTEPGMSPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDG---KNATTDALTSVLTKINRIDIV 1555          
BLAST of Ankyrin-2 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 420/803 (52.30%), Postives = 570/803 (70.98%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            +FLRAAR+GN++KV E+L+  I  +  N NGLNA+HLAAKEG+  +VQ L+  G SVD AT+KGNT+LHIASLAG+ EVV +L++  ANIN +SQNGFTPLYMAAQENH+DVVK LLE GANQ+  T+DGFTPLAVALQQG+++ V ILL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D QS SGFTPLHIAAHY NVNVA LL+ + A V+F A+N ITPLHVA+K G   M+KLL+ +   +++ TRDGL+P+HCAARSG + ++ +LLE GA +  ++KNGL+ L MA QGD  E  K L+     VD VT+DYLTALHVAAHCG+    ++LL    N NARALNGFTPLHIACKK + K++ELL+KY A I + TE+GLTP+H+AAFMG   IV +LL+NGAS   T ++ E ALH+AAR  Q E  + LL +  A  +ARARE QTPLHIA R+G   IV+ LL   A P+  T + YT LHI+A+EG+ +++ +LLE        TKKGFTPLH+A+KYG + VA+ LLL  +   +S G +GLTPLHVA +Y++ ++  LLL+  A+ +   KNGYTPLH+ AKKN +++   L++ GA  N  +++G TPLHL S  G+ +++ LLLD  A+++   ++GLT+LHLAA++++ ++ + L K  AD    T++GYT L  A H+G ++ V  LL++  +VNA+T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  VT      + +  +K  L+ PE M +
Sbjct:   13 SFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRN-GALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAK-LLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTE 812          

HSP 2 Score: 461.07 bits (1185), Expect = 7.986e-134
Identity = 245/606 (40.43%), Postives = 365/606 (60.23%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIF--NPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  E LD+V L   P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTR+ C L ++    T+P + + E LA R+I +  S     GP+++EIPH AALR  ERE+VVL+S+NG SWKEH   +T+  + + L  + E + + E   + RI RIIT   PQYF+++SR+KQD   IG EGG ++S+V  QVQAVFPEGAL K+I++ LQ   +   L++K  GN    SPIVTLEPRRRKFH+ IT+T+P+P  S       +     +LRLLCSI+G  TP  WEDITGT+PLT  + CVSFTT +SAR WLIDC +  E V  AS +Y E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    +++  GN++P+T S +        F+ENRL  + +++D +  PCG+++FM++P+                T+ L  + IC L+ITLP   T++  ++ ++E   D+    NP D++ER+       E  +  +A  +G  W +L   L   +E+I +I +++  + +D+++  L  W+   +D + +   N +E  L  I R DIV
Sbjct:  920 WGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKS---------------TRGLVHQAICNLNITLPIY-TKESESDQEQEEEIDMTSEKNPQDEQERI-------EERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWL--ERDGKHATDTNLVE-CLTKINRMDIV 1499          
BLAST of Ankyrin-2 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 420/803 (52.30%), Postives = 570/803 (70.98%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            +FLRAAR+GN++KV E+L+  I  +  N NGLNA+HLAAKEG+  +VQ L+  G SVD AT+KGNT+LHIASLAG+ EVV +L++  ANIN +SQNGFTPLYMAAQENH+DVVK LLE GANQ+  T+DGFTPLAVALQQG+++ V ILL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D QS SGFTPLHIAAHY NVNVA LL+ + A V+F A+N ITPLHVA+K G   M+KLL+ +   +++ TRDGL+P+HCAARSG + ++ +LLE GA +  ++KNGL+ L MA QGD  E  K L+     VD VT+DYLTALHVAAHCG+    ++LL    N NARALNGFTPLHIACKK + K++ELL+KY A I + TE+GLTP+H+AAFMG   IV +LL+NGAS   T ++ E ALH+AAR  Q E  + LL +  A  +ARARE QTPLHIA R+G   IV+ LL   A P+  T + YT LHI+A+EG+ +++ +LLE        TKKGFTPLH+A+KYG + VA+ LLL  +   +S G +GLTPLHVA +Y++ ++  LLL+  A+ +   KNGYTPLH+ AKKN +++   L++ GA  N  +++G TPLHL S  G+ +++ LLLD  A+++   ++GLT+LHLAA++++ ++ + L K  AD    T++GYT L  A H+G ++ V  LL++  +VNA+T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  VT      + +  +K  L+ PE M +
Sbjct:   13 SFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRN-GALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAK-LLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTE 812          

HSP 2 Score: 451.825 bits (1161), Expect = 1.107e-130
Identity = 245/618 (39.64%), Postives = 365/618 (59.06%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAG------------FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIF--NPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  E LD+V L   P+ +G            FL+SF+VDA+GG M+  RH  +RI +P      PTR+ C L ++    T+P + + E LA R+I +  S     GP+++EIPH AALR  ERE+VVL+S+NG SWKEH   +T+  + + L  + E + + E   + RI RIIT   PQYF+++SR+KQD   IG EGG ++S+V  QVQAVFPEGAL K+I++ LQ   +   L++K  GN    SPIVTLEPRRRKFH+ IT+T+P+P  S       +     +LRLLCSI+G  TP  WEDITGT+PLT  + CVSFTT +SAR WLIDC +  E V  AS +Y E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    +++  GN++P+T S +        F+ENRL  + +++D +  PCG+++FM++P+                T+ L  + IC L+ITLP   T++  ++ ++E   D+    NP D++ER+       E  +  +A  +G  W +L   L   +E+I +I +++  + +D+++  L  W+   +D + +   N +E  L  I R DIV
Sbjct:  920 WGTENLDNVALSSSPIHSGRASPCLERDNSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKS---------------TRGLVHQAICNLNITLPIY-TKESESDQEQEEEIDMTSEKNPQDEQERI-------EERLAYIADHLGFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWL--ERDGKHATDTNLVE-CLTKINRMDIV 1511          
BLAST of Ankyrin-2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 425/779 (54.56%), Postives = 568/779 (72.91%), Query Frame = 2
Query:  137 EKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            E + +FLRAAR+G++EKV E L+A    + SNANGLN++HLA+KEG+ EVV+ LI+    VD ATRKGNT+LHIASLAG+  +V++L+E+ AN+NV+S NGFTPLYMAAQENH +VVK LL++GANQA++T+DGFTPLAVALQQG+D+VV +LL+NDS+ KVRLPALHIAAKKDD  AA+LL+  ++ N D  S SGFTPLHIAAHY + NV +LL+EK A+VN+ A++NI+PLHVA KWG+  M  LL+S+ A ++S T+D L+P+HCAARSG + ++ +L+  GA I  K+KNGL  L MA QGD  +  +TL+     VD VT+DYLT LHVAAHCG++  A++LL  + + N+RALNGFTPLHIACKK + K+VELL+KY+A I +TTE+GLTPLH+AAFMG+  IV  LL+ GA+    T++ E  LHLAAR NQ +  ++L+ +  A  +A+ARE QTPLHIA R+GN  IV  LL AGA+ N  T+DNY+ LHIAAKEG+ E++ +LL+H       TKKGFTPLH+ASKYG ++V R LLL      +  G + +TPLHVA +YN+ ++  LLL+  A+     KNGYTPLH+ AKKN +E+   L+   A+ NA+S+ GFTPLHL++  G+KEI  LL++  +DV  +A NGLTA+HL A+++   + + L    A+I++KT  GYT LH A HFGQ+  VK L++   DV  +T    T LH AAQQGH   VR LL+N    N Q   G T L +AQ+  Y+++ ETL
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLL-QNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVR-LLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 434.491 bits (1116), Expect = 4.236e-125
Identity = 243/619 (39.26%), Postives = 358/619 (57.84%), Query Frame = 1
Query: 2836 DSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNL--AENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS----SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIK---DLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLP--------TKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIH 4641
            D+V +     +  FLISF+VDA+GG M+  RH  +RI VP      P R+ C   RK+     P L + E LA RI+ +  +     GP++LE+PH A+LR  ERE+V+L+SD+G  WKEH    T+ AVQ+ L     AE++   +     RI RI+T+  P YF++++R++Q++  +G EGG + SSV  +VQA+FP+G+L K IK+S+Q   + + ++ +  GN VA+SPIVT+EPRRRKFH+ ITL +PLP  ++      Y+ Q      +LRLLCSI+G + P  WEDITGT+ LT     VSFTTT+SAR WL+DC    +  ++A  +Y E+  +P++ +F VF RR    E Q+R  C+TDD  +KTLE QE+F+LI+    VEVL+    +LE SGN++PIT S +QLSL   PFQENRL+F  + +   D      G++ FM +P+I S +             L PQ+PICTL I+LP          P +K L   ++ + + L     D  E + + ++K           +G DW +L   L +   +I  I      +E K    L +WI   K  + +N  N L+ +LR IGR+DIV++  +
Sbjct:  989 DNVPIGHHVTQPSFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIRSDA-------------LPPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSAL---EKDLPEFVHQNVLKG----------IGADWPRLGRALEVPHRDIQHIRQNYPGQECKN--TLKIWIHLKK--EDANQDN-LDQALRQIGRDDIVRSIAY 1576          

HSP 3 Score: 311.227 bits (796), Expect = 2.199e-85
Identity = 202/604 (33.44%), Postives = 315/604 (52.15%), Query Frame = 2
Query:  782 LIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLT-----------------------------ALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMS 2506
            L+    D+N    N +  LH+A+K G  E+++ LI ++A V++ TR G + +H A+ +G   I+ IL+ENGA++  +S NG T L MA Q +  EV K L+  G +    T D  T                             ALH+AA   +  AA +LL+N  N +  + +GFTPLHIA       + +LL++  A++N      ++PLH+A   G   + N+LL  GA I   T      LH AAR+  ++   +L++   A  +A+ +    PLH+A +  +      LL   A  + VT D  T LH+AA  G   +++LLL+    P+++   GFTPLHIA K  R++V  +LLL  +    +    GLTPLHVA +     ++  LL   AN +     G TPLHL A+ N  +V ++LI  GA V+AQ+++  TPLH+ S  GN +I+ LLL A A+ N    +  + LH+AA++ + ++   LL   AD +  T+ G+T LH A  +G ++ V++LL++   V+ +     T LH+AA   +  +  LLL+N        K G T L +A K++ + IA TL +    P   S
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQ-GAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVV-ELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKS 653          

HSP 4 Score: 126.716 bits (317), Expect = 1.064e-28
Identity = 89/300 (29.67%), Postives = 150/300 (50.00%), Query Frame = 2
Query: 1574 QLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            Q + A A P     +   +   AA+ G  E    LL      +     G   LH+ASK G  +V R+ L+  +   ++    G T LH+A+      ++ +L++  ANVN    NG+TPL++ A++N  EV K L+  GAN    ++ GFTPL +    G+  ++ +LL+ ++    + +  L ALH+AA+K+ T     LL+ E +    ++ G+T LH A H+G     ++LL+K  +VN Q     + LH+A + G   +  LLL     ++ + K  LT L  A +  +  + + L
Sbjct:   18 QEVQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRE-LIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLL 312          
BLAST of Ankyrin-2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 425/779 (54.56%), Postives = 568/779 (72.91%), Query Frame = 2
Query:  137 EKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            E + +FLRAAR+G++EKV E L+A    + SNANGLN++HLA+KEG+ EVV+ LI+    VD ATRKGNT+LHIASLAG+  +V++L+E+ AN+NV+S NGFTPLYMAAQENH +VVK LL++GANQA++T+DGFTPLAVALQQG+D+VV +LL+NDS+ KVRLPALHIAAKKDD  AA+LL+  ++ N D  S SGFTPLHIAAHY + NV +LL+EK A+VN+ A++NI+PLHVA KWG+  M  LL+S+ A ++S T+D L+P+HCAARSG + ++ +L+  GA I  K+KNGL  L MA QGD  +  +TL+     VD VT+DYLT LHVAAHCG++  A++LL  + + N+RALNGFTPLHIACKK + K+VELL+KY+A I +TTE+GLTPLH+AAFMG+  IV  LL+ GA+    T++ E  LHLAAR NQ +  ++L+ +  A  +A+ARE QTPLHIA R+GN  IV  LL AGA+ N  T+DNY+ LHIAAKEG+ E++ +LL+H       TKKGFTPLH+ASKYG ++V R LLL      +  G + +TPLHVA +YN+ ++  LLL+  A+     KNGYTPLH+ AKKN +E+   L+   A+ NA+S+ GFTPLHL++  G+KEI  LL++  +DV  +A NGLTA+HL A+++   + + L    A+I++KT  GYT LH A HFGQ+  VK L++   DV  +T    T LH AAQQGH   VR LL+N    N Q   G T L +AQ+  Y+++ ETL
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLL-QNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVR-LLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 434.491 bits (1116), Expect = 4.236e-125
Identity = 243/619 (39.26%), Postives = 358/619 (57.84%), Query Frame = 1
Query: 2836 DSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNL--AENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS----SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIK---DLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLP--------TKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIH 4641
            D+V +     +  FLISF+VDA+GG M+  RH  +RI VP      P R+ C   RK+     P L + E LA RI+ +  +     GP++LE+PH A+LR  ERE+V+L+SD+G  WKEH    T+ AVQ+ L     AE++   +     RI RI+T+  P YF++++R++Q++  +G EGG + SSV  +VQA+FP+G+L K IK+S+Q   + + ++ +  GN VA+SPIVT+EPRRRKFH+ ITL +PLP  ++      Y+ Q      +LRLLCSI+G + P  WEDITGT+ LT     VSFTTT+SAR WL+DC    +  ++A  +Y E+  +P++ +F VF RR    E Q+R  C+TDD  +KTLE QE+F+LI+    VEVL+    +LE SGN++PIT S +QLSL   PFQENRL+F  + +   D      G++ FM +P+I S +             L PQ+PICTL I+LP          P +K L   ++ + + L     D  E + + ++K           +G DW +L   L +   +I  I      +E K    L +WI   K  + +N  N L+ +LR IGR+DIV++  +
Sbjct:  989 DNVPIGHHVTQPSFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIRSDA-------------LPPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSAL---EKDLPEFVHQNVLKG----------IGADWPRLGRALEVPHRDIQHIRQNYPGQECKN--TLKIWIHLKK--EDANQDN-LDQALRQIGRDDIVRSIAY 1576          

HSP 3 Score: 311.227 bits (796), Expect = 2.199e-85
Identity = 202/604 (33.44%), Postives = 315/604 (52.15%), Query Frame = 2
Query:  782 LIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLT-----------------------------ALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMS 2506
            L+    D+N    N +  LH+A+K G  E+++ LI ++A V++ TR G + +H A+ +G   I+ IL+ENGA++  +S NG T L MA Q +  EV K L+  G +    T D  T                             ALH+AA   +  AA +LL+N  N +  + +GFTPLHIA       + +LL++  A++N      ++PLH+A   G   + N+LL  GA I   T      LH AAR+  ++   +L++   A  +A+ +    PLH+A +  +      LL   A  + VT D  T LH+AA  G   +++LLL+    P+++   GFTPLHIA K  R++V  +LLL  +    +    GLTPLHVA +     ++  LL   AN +     G TPLHL A+ N  +V ++LI  GA V+AQ+++  TPLH+ S  GN +I+ LLL A A+ N    +  + LH+AA++ + ++   LL   AD +  T+ G+T LH A  +G ++ V++LL++   V+ +     T LH+AA   +  +  LLL+N        K G T L +A K++ + IA TL +    P   S
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQ-GAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVV-ELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKS 653          

HSP 4 Score: 126.716 bits (317), Expect = 1.064e-28
Identity = 89/300 (29.67%), Postives = 150/300 (50.00%), Query Frame = 2
Query: 1574 QLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            Q + A A P     +   +   AA+ G  E    LL      +     G   LH+ASK G  +V R+ L+  +   ++    G T LH+A+      ++ +L++  ANVN    NG+TPL++ A++N  EV K L+  GAN    ++ GFTPL +    G+  ++ +LL+ ++    + +  L ALH+AA+K+ T     LL+ E +    ++ G+T LH A H+G     ++LL+K  +VN Q     + LH+A + G   +  LLL     ++ + K  LT L  A +  +  + + L
Sbjct:   18 QEVQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRE-LIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLL 312          
BLAST of Ankyrin-2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 425/779 (54.56%), Postives = 568/779 (72.91%), Query Frame = 2
Query:  137 EKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            E + +FLRAAR+G++EKV E L+A    + SNANGLN++HLA+KEG+ EVV+ LI+    VD ATRKGNT+LHIASLAG+  +V++L+E+ AN+NV+S NGFTPLYMAAQENH +VVK LL++GANQA++T+DGFTPLAVALQQG+D+VV +LL+NDS+ KVRLPALHIAAKKDD  AA+LL+  ++ N D  S SGFTPLHIAAHY + NV +LL+EK A+VN+ A++NI+PLHVA KWG+  M  LL+S+ A ++S T+D L+P+HCAARSG + ++ +L+  GA I  K+KNGL  L MA QGD  +  +TL+     VD VT+DYLT LHVAAHCG++  A++LL  + + N+RALNGFTPLHIACKK + K+VELL+KY+A I +TTE+GLTPLH+AAFMG+  IV  LL+ GA+    T++ E  LHLAAR NQ +  ++L+ +  A  +A+ARE QTPLHIA R+GN  IV  LL AGA+ N  T+DNY+ LHIAAKEG+ E++ +LL+H       TKKGFTPLH+ASKYG ++V R LLL      +  G + +TPLHVA +YN+ ++  LLL+  A+     KNGYTPLH+ AKKN +E+   L+   A+ NA+S+ GFTPLHL++  G+KEI  LL++  +DV  +A NGLTA+HL A+++   + + L    A+I++KT  GYT LH A HFGQ+  VK L++   DV  +T    T LH AAQQGH   VR LL+N    N Q   G T L +AQ+  Y+++ ETL
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLL-QNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVR-LLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 434.491 bits (1116), Expect = 4.529e-125
Identity = 243/619 (39.26%), Postives = 358/619 (57.84%), Query Frame = 1
Query: 2836 DSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNL--AENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS----SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIK---DLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLP--------TKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIH 4641
            D+V +     +  FLISF+VDA+GG M+  RH  +RI VP      P R+ C   RK+     P L + E LA RI+ +  +     GP++LE+PH A+LR  ERE+V+L+SD+G  WKEH    T+ AVQ+ L     AE++   +     RI RI+T+  P YF++++R++Q++  +G EGG + SSV  +VQA+FP+G+L K IK+S+Q   + + ++ +  GN VA+SPIVT+EPRRRKFH+ ITL +PLP  ++      Y+ Q      +LRLLCSI+G + P  WEDITGT+ LT     VSFTTT+SAR WL+DC    +  ++A  +Y E+  +P++ +F VF RR    E Q+R  C+TDD  +KTLE QE+F+LI+    VEVL+    +LE SGN++PIT S +QLSL   PFQENRL+F  + +   D      G++ FM +P+I S +             L PQ+PICTL I+LP          P +K L   ++ + + L     D  E + + ++K           +G DW +L   L +   +I  I      +E K    L +WI   K  + +N  N L+ +LR IGR+DIV++  +
Sbjct:  989 DNVPIGHHVTQPSFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIRSDA-------------LPPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSAL---EKDLPEFVHQNVLKG----------IGADWPRLGRALEVPHRDIQHIRQNYPGQECKN--TLKIWIHLKK--EDANQDN-LDQALRQIGRDDIVRSIAY 1576          

HSP 3 Score: 310.842 bits (795), Expect = 2.789e-85
Identity = 202/604 (33.44%), Postives = 315/604 (52.15%), Query Frame = 2
Query:  782 LIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLT-----------------------------ALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMS 2506
            L+    D+N    N +  LH+A+K G  E+++ LI ++A V++ TR G + +H A+ +G   I+ IL+ENGA++  +S NG T L MA Q +  EV K L+  G +    T D  T                             ALH+AA   +  AA +LL+N  N +  + +GFTPLHIA       + +LL++  A++N      ++PLH+A   G   + N+LL  GA I   T      LH AAR+  ++   +L++   A  +A+ +    PLH+A +  +      LL   A  + VT D  T LH+AA  G   +++LLL+    P+++   GFTPLHIA K  R++V  +LLL  +    +    GLTPLHVA +     ++  LL   AN +     G TPLHL A+ N  +V ++LI  GA V+AQ+++  TPLH+ S  GN +I+ LLL A A+ N    +  + LH+AA++ + ++   LL   AD +  T+ G+T LH A  +G ++ V++LL++   V+ +     T LH+AA   +  +  LLL+N        K G T L +A K++ + IA TL +    P   S
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQ-GAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVV-ELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKS 653          

HSP 4 Score: 126.331 bits (316), Expect = 1.215e-28
Identity = 89/300 (29.67%), Postives = 150/300 (50.00%), Query Frame = 2
Query: 1574 QLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            Q + A A P     +   +   AA+ G  E    LL      +     G   LH+ASK G  +V R+ L+  +   ++    G T LH+A+      ++ +L++  ANVN    NG+TPL++ A++N  EV K L+  GAN    ++ GFTPL +    G+  ++ +LL+ ++    + +  L ALH+AA+K+ T     LL+ E +    ++ G+T LH A H+G     ++LL+K  +VN Q     + LH+A + G   +  LLL     ++ + K  LT L  A +  +  + + L
Sbjct:   18 QEVQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRE-LIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLL 312          
BLAST of Ankyrin-2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 425/779 (54.56%), Postives = 568/779 (72.91%), Query Frame = 2
Query:  137 EKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            E + +FLRAAR+G++EKV E L+A    + SNANGLN++HLA+KEG+ EVV+ LI+    VD ATRKGNT+LHIASLAG+  +V++L+E+ AN+NV+S NGFTPLYMAAQENH +VVK LL++GANQA++T+DGFTPLAVALQQG+D+VV +LL+NDS+ KVRLPALHIAAKKDD  AA+LL+  ++ N D  S SGFTPLHIAAHY + NV +LL+EK A+VN+ A++NI+PLHVA KWG+  M  LL+S+ A ++S T+D L+P+HCAARSG + ++ +L+  GA I  K+KNGL  L MA QGD  +  +TL+     VD VT+DYLT LHVAAHCG++  A++LL  + + N+RALNGFTPLHIACKK + K+VELL+KY+A I +TTE+GLTPLH+AAFMG+  IV  LL+ GA+    T++ E  LHLAAR NQ +  ++L+ +  A  +A+ARE QTPLHIA R+GN  IV  LL AGA+ N  T+DNY+ LHIAAKEG+ E++ +LL+H       TKKGFTPLH+ASKYG ++V R LLL      +  G + +TPLHVA +YN+ ++  LLL+  A+     KNGYTPLH+ AKKN +E+   L+   A+ NA+S+ GFTPLHL++  G+KEI  LL++  +DV  +A NGLTA+HL A+++   + + L    A+I++KT  GYT LH A HFGQ+  VK L++   DV  +T    T LH AAQQGH   VR LL+N    N Q   G T L +AQ+  Y+++ ETL
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLL-QNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVR-LLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 434.491 bits (1116), Expect = 4.529e-125
Identity = 243/619 (39.26%), Postives = 358/619 (57.84%), Query Frame = 1
Query: 2836 DSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNL--AENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS----SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIK---DLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLP--------TKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIH 4641
            D+V +     +  FLISF+VDA+GG M+  RH  +RI VP      P R+ C   RK+     P L + E LA RI+ +  +     GP++LE+PH A+LR  ERE+V+L+SD+G  WKEH    T+ AVQ+ L     AE++   +     RI RI+T+  P YF++++R++Q++  +G EGG + SSV  +VQA+FP+G+L K IK+S+Q   + + ++ +  GN VA+SPIVT+EPRRRKFH+ ITL +PLP  ++      Y+ Q      +LRLLCSI+G + P  WEDITGT+ LT     VSFTTT+SAR WL+DC    +  ++A  +Y E+  +P++ +F VF RR    E Q+R  C+TDD  +KTLE QE+F+LI+    VEVL+    +LE SGN++PIT S +QLSL   PFQENRL+F  + +   D      G++ FM +P+I S +             L PQ+PICTL I+LP          P +K L   ++ + + L     D  E + + ++K           +G DW +L   L +   +I  I      +E K    L +WI   K  + +N  N L+ +LR IGR+DIV++  +
Sbjct:  989 DNVPIGHHVTQPSFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIRSDA-------------LPPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSAL---EKDLPEFVHQNVLKG----------IGADWPRLGRALEVPHRDIQHIRQNYPGQECKN--TLKIWIHLKK--EDANQDN-LDQALRQIGRDDIVRSIAY 1576          

HSP 3 Score: 310.842 bits (795), Expect = 2.789e-85
Identity = 202/604 (33.44%), Postives = 315/604 (52.15%), Query Frame = 2
Query:  782 LIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLT-----------------------------ALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMS 2506
            L+    D+N    N +  LH+A+K G  E+++ LI ++A V++ TR G + +H A+ +G   I+ IL+ENGA++  +S NG T L MA Q +  EV K L+  G +    T D  T                             ALH+AA   +  AA +LL+N  N +  + +GFTPLHIA       + +LL++  A++N      ++PLH+A   G   + N+LL  GA I   T      LH AAR+  ++   +L++   A  +A+ +    PLH+A +  +      LL   A  + VT D  T LH+AA  G   +++LLL+    P+++   GFTPLHIA K  R++V  +LLL  +    +    GLTPLHVA +     ++  LL   AN +     G TPLHL A+ N  +V ++LI  GA V+AQ+++  TPLH+ S  GN +I+ LLL A A+ N    +  + LH+AA++ + ++   LL   AD +  T+ G+T LH A  +G ++ V++LL++   V+ +     T LH+AA   +  +  LLL+N        K G T L +A K++ + IA TL +    P   S
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQ-GAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVV-ELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKS 653          

HSP 4 Score: 126.331 bits (316), Expect = 1.215e-28
Identity = 89/300 (29.67%), Postives = 150/300 (50.00%), Query Frame = 2
Query: 1574 QLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            Q + A A P     +   +   AA+ G  E    LL      +     G   LH+ASK G  +V R+ L+  +   ++    G T LH+A+      ++ +L++  ANVN    NG+TPL++ A++N  EV K L+  GAN    ++ GFTPL +    G+  ++ +LL+ ++    + +  L ALH+AA+K+ T     LL+ E +    ++ G+T LH A H+G     ++LL+K  +VN Q     + LH+A + G   +  LLL     ++ + K  LT L  A +  +  + + L
Sbjct:   18 QEVQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRE-LIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLL 312          
BLAST of Ankyrin-2 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 425/779 (54.56%), Postives = 568/779 (72.91%), Query Frame = 2
Query:  137 EKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            E + +FLRAAR+G++EKV E L+A    + SNANGLN++HLA+KEG+ EVV+ LI+    VD ATRKGNT+LHIASLAG+  +V++L+E+ AN+NV+S NGFTPLYMAAQENH +VVK LL++GANQA++T+DGFTPLAVALQQG+D+VV +LL+NDS+ KVRLPALHIAAKKDD  AA+LL+  ++ N D  S SGFTPLHIAAHY + NV +LL+EK A+VN+ A++NI+PLHVA KWG+  M  LL+S+ A ++S T+D L+P+HCAARSG + ++ +L+  GA I  K+KNGL  L MA QGD  +  +TL+     VD VT+DYLT LHVAAHCG++  A++LL  + + N+RALNGFTPLHIACKK + K+VELL+KY+A I +TTE+GLTPLH+AAFMG+  IV  LL+ GA+    T++ E  LHLAAR NQ +  ++L+ +  A  +A+ARE QTPLHIA R+GN  IV  LL AGA+ N  T+DNY+ LHIAAKEG+ E++ +LL+H       TKKGFTPLH+ASKYG ++V R LLL      +  G + +TPLHVA +YN+ ++  LLL+  A+     KNGYTPLH+ AKKN +E+   L+   A+ NA+S+ GFTPLHL++  G+KEI  LL++  +DV  +A NGLTA+HL A+++   + + L    A+I++KT  GYT LH A HFGQ+  VK L++   DV  +T    T LH AAQQGH   VR LL+N    N Q   G T L +AQ+  Y+++ ETL
Sbjct:   32 EGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLL-QNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN-GAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVR-LLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 433.335 bits (1113), Expect = 9.167e-125
Identity = 241/606 (39.77%), Postives = 353/606 (58.25%), Query Frame = 1
Query: 2875 FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNL--AENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS----SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIK---DLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLP--------TKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIH 4641
            FLISF+VDA+GG M+  RH  +RI VP      P R+ C   RK+     P L + E LA RI+ +  +     GP++LE+PH A+LR  ERE+V+L+SD+G  WKEH    T+ AVQ+ L     AE++   +     RI RI+T+  P YF++++R++Q++  +G EGG + SSV  +VQA+FP+G+L K IK+S+Q   + + ++ +  GN VA+SPIVT+EPRRRKFH+ ITL +PLP  ++      Y+ Q      +LRLLCSI+G + P  WEDITGT+ LT     VSFTTT+SAR WL+DC    +  ++A  +Y E+  +P++ +F VF RR    E Q+R  C+TDD  +KTLE QE+F+LI+    VEVL+    +LE SGN++PIT S +QLSL   PFQENRL+F  + +   D      G++ FM +P+I S +             L PQ+PICTL I+LP          P +K L   ++ + + L     D  E + + ++K           +G DW +L   L +   +I  I      +E K    L +WI   K  + +N  N L+ +LR IGR+DIV++  +
Sbjct: 1008 FLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIRSDA-------------LPPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSAL---EKDLPEFVHQNVLKG----------IGADWPRLGRALEVPHRDIQHIRQNYPGQECKN--TLKIWIHLKK--EDANQDN-LDQALRQIGRDDIVRSIAY 1582          

HSP 3 Score: 310.457 bits (794), Expect = 3.362e-85
Identity = 202/604 (33.44%), Postives = 315/604 (52.15%), Query Frame = 2
Query:  782 LIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLT-----------------------------ALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMS 2506
            L+    D+N    N +  LH+A+K G  E+++ LI ++A V++ TR G + +H A+ +G   I+ IL+ENGA++  +S NG T L MA Q +  EV K L+  G +    T D  T                             ALH+AA   +  AA +LL+N  N +  + +GFTPLHIA       + +LL++  A++N      ++PLH+A   G   + N+LL  GA I   T      LH AAR+  ++   +L++   A  +A+ +    PLH+A +  +      LL   A  + VT D  T LH+AA  G   +++LLL+    P+++   GFTPLHIA K  R++V  +LLL  +    +    GLTPLHVA +     ++  LL   AN +     G TPLHL A+ N  +V ++LI  GA V+AQ+++  TPLH+ S  GN +I+ LLL A A+ N    +  + LH+AA++ + ++   LL   AD +  T+ G+T LH A  +G ++ V++LL++   V+ +     T LH+AA   +  +  LLL+N        K G T L +A K++ + IA TL +    P   S
Sbjct:   52 LLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQ-GAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVV-ELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKS 653          

HSP 4 Score: 126.331 bits (316), Expect = 1.351e-28
Identity = 89/300 (29.67%), Postives = 150/300 (50.00%), Query Frame = 2
Query: 1574 QLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            Q + A A P     +   +   AA+ G  E    LL      +     G   LH+ASK G  +V R+ L+  +   ++    G T LH+A+      ++ +L++  ANVN    NG+TPL++ A++N  EV K L+  GAN    ++ GFTPL +    G+  ++ +LL+ ++    + +  L ALH+AA+K+ T     LL+ E +    ++ G+T LH A H+G     ++LL+K  +VN Q     + LH+A + G   +  LLL     ++ + K  LT L  A +  +  + + L
Sbjct:   18 QEVQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRE-LIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDS----KGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLL 312          
BLAST of Ankyrin-2 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334060)

HSP 1 Score: 856.284 bits (2211), Expect = 0.000e+0
Identity = 443/804 (55.10%), Postives = 587/804 (73.01%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMM---SGSEEKKLILDQPEKM 2551
            +FLRAAR+GN+E+V E L+ +I  + SNANGLNA+HLA+K+G+  VV  L+  G  VD AT+KGNT+LHIASLAG+ EVV LLLE  A++NV+SQNGFTPLYMAAQENH  VV++LL  GANQ++ T+DGFTPLAVA+QQG+DKVV +LL++D+R KVRLPALHIAAKKDDV AA+LL+  +D N D  S SGFTPLHIA+HY N N+A LLI+K ADVN+ AK+NI+PLHVAAKWGK  M+ LL+ +  N+ + TRDGL+P+HCAARSG E ++ +LLE GA I  K+KNGL  L MA QG+  +  + L+     VD VT+DYLTALHVAAHCG++  A++LL  N + NARALNGFTPLHIACKK + K+VELL+++ A I++TTE+GLTPLH+AAFMG   IV  LL++ AS    T++ E  LHLAAR NQ +  +ILL +  A  +ARARE QTPLHIA R+GN  IV  LL  GA  +  TKD YTALHIAAKEG+ E++ +L+E+    DA TKKGFTPLH+ +KYG ++VA QLLL  + + ++ G +G+TPLHVA +YN+ ++  LLL+  A+ +   KNG+TPLH+ A+KN +++   L++ GA  NA+S+ GFTPLHL+S  G+ EI  LL++  A VNH A+NGLT +HL A+++  ++ E L K  A+I   T+ GYT LH A HFGQ   V+ LLQ   +V+A T++G T LH  AQQGH  IV LLL+++ + N Q   G T L +A+K  Y+++ ++L  +T   E     S +EEK  ++  PE M
Sbjct:  164 SFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLL-DNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRN-GAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVA-QLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAEEKYRVV-APEAM 963          

HSP 2 Score: 436.032 bits (1120), Expect = 2.550e-124
Identity = 234/600 (39.00%), Postives = 347/600 (57.83%), Query Frame = 1
Query: 2875 FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNL--AENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKS-----------ELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTC 4635
            FL+SF+VDA+GG M+  RH  +R+ +P  S   PTR+ C   + +     P L + EALA R++ L   +    GP+++E+PH A+LR  ERE+++L+SDNG +W+EHT   ++  + D L      E I   E Q  N + R +T   PQYF+++SR++Q++  IG EGG V+S+V  QVQAVFP+GAL KKIK+ LQ   +  +L  K  G GVA+SPIVT+EPRRRKFH+AITL++P P          Y+  T +LRLLCSI+G  +   WED+TG++PLT  + CVSFTTT+SAR WL+DC   ++  ++A+ LY+E   VPFI +F+VF ++    E ++R  C+TDD  +KTLE  E +  ++    VEVLE    ++E +GN++P+T S +QL ++   F+ENRL F  R+KD      G+  FM++P++           G P     PQ+PIC L+I LP            E    D      D+     RT + S           ++ I +++  +G DW +L   +G+  EEI  I  Q+    D         I   KD    ++ + LE +L++IGR+DI+K C
Sbjct: 1078 FLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHADIVGRTLFMKEPKVAK---------GEP-----PQQPICILNIVLP------------EAVIPDSTTAFSDRVTSAYRTSMFSLSKHQNDHYIGDIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNT---DSIARQAQSMIRLYKDKPNYDILS-LETALKNIGRDDIMKKC 1647          

HSP 3 Score: 309.686 bits (792), Expect = 2.090e-84
Identity = 221/685 (32.26%), Postives = 336/685 (49.05%), Query Frame = 2
Query:  710 HQSA-SGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLT-----------------------------ALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHI---------------------------------ACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLH--P------------------------------EANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSK 2479
            HQSA  G T    AA   N+      ++ N D+N    N +  LH+A+K G   ++  L+ + A V+S T+ G + +H A+ +G E ++ +LLE+ A +  +S+NG T L MA Q +   V + L++ G +    T D  T                             ALH+AA   ++ AA +LL N+ N +  + +GFTPLHI                                 A K  ++ MV LL++   +I + T  GLTPLH AA  G +++V++LL+ GA IS  T      LH+AA+    +  +ILL H  P                               A+ NARA    TPLHIA +     +VE LL  GA  +  T+   T LH+AA  G   I   LL+H   PD  T +G TPLH+A++  +  + R +LL      ++      TPLH+A+   + +++ LLL   A V+   K+ YT LH+ AK+   EV  +LI+ GA ++A ++KGFTPLHL +  G+ ++ +LLL   ADV+ Q +NG+T LH+A   N   +   LL+  A      + G+T LH A    Q+     LL+     NA++  G T LHL++Q+GH  I  LL++++  VNH  K GLT + +  ++  +N+AE L K
Sbjct:  155 HQSAGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIR-ILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEK 838          
BLAST of Ankyrin-2 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303117)

HSP 1 Score: 856.284 bits (2211), Expect = 0.000e+0
Identity = 443/804 (55.10%), Postives = 587/804 (73.01%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMM---SGSEEKKLILDQPEKM 2551
            +FLRAAR+GN+E+V E L+ +I  + SNANGLNA+HLA+K+G+  VV  L+  G  VD AT+KGNT+LHIASLAG+ EVV LLLE  A++NV+SQNGFTPLYMAAQENH  VV++LL  GANQ++ T+DGFTPLAVA+QQG+DKVV +LL++D+R KVRLPALHIAAKKDDV AA+LL+  +D N D  S SGFTPLHIA+HY N N+A LLI+K ADVN+ AK+NI+PLHVAAKWGK  M+ LL+ +  N+ + TRDGL+P+HCAARSG E ++ +LLE GA I  K+KNGL  L MA QG+  +  + L+     VD VT+DYLTALHVAAHCG++  A++LL  N + NARALNGFTPLHIACKK + K+VELL+++ A I++TTE+GLTPLH+AAFMG   IV  LL++ AS    T++ E  LHLAAR NQ +  +ILL +  A  +ARARE QTPLHIA R+GN  IV  LL  GA  +  TKD YTALHIAAKEG+ E++ +L+E+    DA TKKGFTPLH+ +KYG ++VA QLLL  + + ++ G +G+TPLHVA +YN+ ++  LLL+  A+ +   KNG+TPLH+ A+KN +++   L++ GA  NA+S+ GFTPLHL+S  G+ EI  LL++  A VNH A+NGLT +HL A+++  ++ E L K  A+I   T+ GYT LH A HFGQ   V+ LLQ   +V+A T++G T LH  AQQGH  IV LLL+++ + N Q   G T L +A+K  Y+++ ++L  +T   E     S +EEK  ++  PE M
Sbjct:   14 SFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLL-DNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRN-GAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVA-QLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAEEKYRVV-APEAM 813          

HSP 2 Score: 436.417 bits (1121), Expect = 1.891e-124
Identity = 234/600 (39.00%), Postives = 347/600 (57.83%), Query Frame = 1
Query: 2875 FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNL--AENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKS-----------ELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTC 4635
            FL+SF+VDA+GG M+  RH  +R+ +P  S   PTR+ C   + +     P L + EALA R++ L   +    GP+++E+PH A+LR  ERE+++L+SDNG +W+EHT   ++  + D L      E I   E Q  N + R +T   PQYF+++SR++Q++  IG EGG V+S+V  QVQAVFP+GAL KKIK+ LQ   +  +L  K  G GVA+SPIVT+EPRRRKFH+AITL++P P          Y+  T +LRLLCSI+G  +   WED+TG++PLT  + CVSFTTT+SAR WL+DC   ++  ++A+ LY+E   VPFI +F+VF ++    E ++R  C+TDD  +KTLE  E +  ++    VEVLE    ++E +GN++P+T S +QL ++   F+ENRL F  R+KD      G+  FM++P++           G P     PQ+PIC L+I LP            E    D      D+     RT + S           ++ I +++  +G DW +L   +G+  EEI  I  Q+    D         I   KD    ++ + LE +L++IGR+DI+K C
Sbjct:  928 FLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHADIVGRTLFMKEPKVAK---------GEP-----PQQPICILNIVLP------------EAVIPDSTTAFSDRVTSAYRTSMFSLSKHQNDHYIGDIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNT---DSIARQAQSMIRLYKDKPNYDILS-LETALKNIGRDDIMKKC 1497          

HSP 3 Score: 305.834 bits (782), Expect = 3.143e-83
Identity = 217/679 (31.96%), Postives = 332/679 (48.90%), Query Frame = 2
Query:  725 GFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLT-----------------------------ALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHI---------------------------------ACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLH--P------------------------------EANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSK 2479
            G T    AA   N+      ++ N D+N    N +  LH+A+K G   ++  L+ + A V+S T+ G + +H A+ +G E ++ +LLE+ A +  +S+NG T L MA Q +   V + L++ G +    T D  T                             ALH+AA   ++ AA +LL N+ N +  + +GFTPLHI                                 A K  ++ MV LL++   +I + T  GLTPLH AA  G +++V++LL+ GA IS  T      LH+AA+    +  +ILL H  P                               A+ NARA    TPLHIA +     +VE LL  GA  +  T+   T LH+AA  G   I   LL+H   PD  T +G TPLH+A++  +  + R +LL      ++      TPLH+A+   + +++ LLL   A V+   K+ YT LH+ AK+   EV  +LI+ GA ++A ++KGFTPLHL +  G+ ++ +LLL   ADV+ Q +NG+T LH+A   N   +   LL+  A      + G+T LH A    Q+     LL+     NA++  G T LHL++Q+GH  I  LL++++  VNH  K GLT + +  ++  +N+AE L K
Sbjct:   11 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIR-ILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEK 688          

HSP 4 Score: 280.026 bits (715), Expect = 2.830e-75
Identity = 193/556 (34.71%), Postives = 291/556 (52.34%), Query Frame = 2
Query:  905 NSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCE-NALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLL-----LSAKVN----PNSLGHHG-----------------------LTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            N    DG +    AAR+G    +L  L+N  DI   + NGL AL +A++     V   L+ +G  VD+ T    TALH+A+  G     ++LL++N +VN ++ NGFTPL++A ++    +V LL+   A+ +  TE G TPL +A   G  ++V +LL+     S T  K    ALH+AA+ +  +    LLL  + N +  ++   TPLHIA   GN +I   L+  GAD N   K N + LH+AAK G+  +  LLLE     +AKT+ G TPLH A++ G  QV   LL     +SAK      P  +   G                       LT LHVA +  H  + +LLLD  A+ N    NG+TPLH+  KKN ++V +LL+  GA+++A ++ G TPLH+ +  G   I+  LL  +A  +     G T LHLAA  N+TDI+  LL+  A +  + +   T LH A   G +  V +LLQ    V+A T    T+LH+AA++G   +  +L++N   ++   K+G T L +  K  ++ +A+ L
Sbjct:    5 NGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLE-----SDTRGKVRLPALHIAAKKDDVKA-ATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLL 554          
BLAST of Ankyrin-2 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303115)

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 443/804 (55.10%), Postives = 587/804 (73.01%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMM---SGSEEKKLILDQPEKM 2551
            +FLRAAR+GN+E+V E L+ +I  + SNANGLNA+HLA+K+G+  VV  L+  G  VD AT+KGNT+LHIASLAG+ EVV LLLE  A++NV+SQNGFTPLYMAAQENH  VV++LL  GANQ++ T+DGFTPLAVA+QQG+DKVV +LL++D+R KVRLPALHIAAKKDDV AA+LL+  +D N D  S SGFTPLHIA+HY N N+A LLI+K ADVN+ AK+NI+PLHVAAKWGK  M+ LL+ +  N+ + TRDGL+P+HCAARSG E ++ +LLE GA I  K+KNGL  L MA QG+  +  + L+     VD VT+DYLTALHVAAHCG++  A++LL  N + NARALNGFTPLHIACKK + K+VELL+++ A I++TTE+GLTPLH+AAFMG   IV  LL++ AS    T++ E  LHLAAR NQ +  +ILL +  A  +ARARE QTPLHIA R+GN  IV  LL  GA  +  TKD YTALHIAAKEG+ E++ +L+E+    DA TKKGFTPLH+ +KYG ++VA QLLL  + + ++ G +G+TPLHVA +YN+ ++  LLL+  A+ +   KNG+TPLH+ A+KN +++   L++ GA  NA+S+ GFTPLHL+S  G+ EI  LL++  A VNH A+NGLT +HL A+++  ++ E L K  A+I   T+ GYT LH A HFGQ   V+ LLQ   +V+A T++G T LH  AQQGH  IV LLL+++ + N Q   G T L +A+K  Y+++ ++L  +T   E     S +EEK  ++  PE M
Sbjct:  164 SFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLL-DNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRN-GAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVA-QLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAEEKYRVV-APEAM 963          

HSP 2 Score: 435.647 bits (1119), Expect = 2.882e-124
Identity = 234/600 (39.00%), Postives = 347/600 (57.83%), Query Frame = 1
Query: 2875 FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNL--AENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKS-----------ELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTC 4635
            FL+SF+VDA+GG M+  RH  +R+ +P  S   PTR+ C   + +     P L + EALA R++ L   +    GP+++E+PH A+LR  ERE+++L+SDNG +W+EHT   ++  + D L      E I   E Q  N + R +T   PQYF+++SR++Q++  IG EGG V+S+V  QVQAVFP+GAL KKIK+ LQ   +  +L  K  G GVA+SPIVT+EPRRRKFH+AITL++P P          Y+  T +LRLLCSI+G  +   WED+TG++PLT  + CVSFTTT+SAR WL+DC   ++  ++A+ LY+E   VPFI +F+VF ++    E ++R  C+TDD  +KTLE  E +  ++    VEVLE    ++E +GN++P+T S +QL ++   F+ENRL F  R+KD      G+  FM++P++           G P     PQ+PIC L+I LP            E    D      D+     RT + S           ++ I +++  +G DW +L   +G+  EEI  I  Q+    D         I   KD    ++ + LE +L++IGR+DI+K C
Sbjct: 1109 FLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHADIVGRTLFMKEPKVAK---------GEP-----PQQPICILNIVLP------------EAVIPDSTTAFSDRVTSAYRTSMFSLSKHQNDHYIGDIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNT---DSIARQAQSMIRLYKDKPNYDILS-LETALKNIGRDDIMKKC 1678          

HSP 3 Score: 309.301 bits (791), Expect = 3.033e-84
Identity = 221/685 (32.26%), Postives = 336/685 (49.05%), Query Frame = 2
Query:  710 HQSA-SGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLT-----------------------------ALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHI---------------------------------ACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLH--P------------------------------EANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSK 2479
            HQSA  G T    AA   N+      ++ N D+N    N +  LH+A+K G   ++  L+ + A V+S T+ G + +H A+ +G E ++ +LLE+ A +  +S+NG T L MA Q +   V + L++ G +    T D  T                             ALH+AA   ++ AA +LL N+ N +  + +GFTPLHI                                 A K  ++ MV LL++   +I + T  GLTPLH AA  G +++V++LL+ GA IS  T      LH+AA+    +  +ILL H  P                               A+ NARA    TPLHIA +     +VE LL  GA  +  T+   T LH+AA  G   I   LL+H   PD  T +G TPLH+A++  +  + R +LL      ++      TPLH+A+   + +++ LLL   A V+   K+ YT LH+ AK+   EV  +LI+ GA ++A ++KGFTPLHL +  G+ ++ +LLL   ADV+ Q +NG+T LH+A   N   +   LL+  A      + G+T LH A    Q+     LL+     NA++  G T LHL++Q+GH  I  LL++++  VNH  K GLT + +  ++  +N+AE L K
Sbjct:  155 HQSAGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIR-ILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEK 838          
BLAST of Ankyrin-2 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344223)

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 443/804 (55.10%), Postives = 587/804 (73.01%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMM---SGSEEKKLILDQPEKM 2551
            +FLRAAR+GN+E+V E L+ +I  + SNANGLNA+HLA+K+G+  VV  L+  G  VD AT+KGNT+LHIASLAG+ EVV LLLE  A++NV+SQNGFTPLYMAAQENH  VV++LL  GANQ++ T+DGFTPLAVA+QQG+DKVV +LL++D+R KVRLPALHIAAKKDDV AA+LL+  +D N D  S SGFTPLHIA+HY N N+A LLI+K ADVN+ AK+NI+PLHVAAKWGK  M+ LL+ +  N+ + TRDGL+P+HCAARSG E ++ +LLE GA I  K+KNGL  L MA QG+  +  + L+     VD VT+DYLTALHVAAHCG++  A++LL  N + NARALNGFTPLHIACKK + K+VELL+++ A I++TTE+GLTPLH+AAFMG   IV  LL++ AS    T++ E  LHLAAR NQ +  +ILL +  A  +ARARE QTPLHIA R+GN  IV  LL  GA  +  TKD YTALHIAAKEG+ E++ +L+E+    DA TKKGFTPLH+ +KYG ++VA QLLL  + + ++ G +G+TPLHVA +YN+ ++  LLL+  A+ +   KNG+TPLH+ A+KN +++   L++ GA  NA+S+ GFTPLHL+S  G+ EI  LL++  A VNH A+NGLT +HL A+++  ++ E L K  A+I   T+ GYT LH A HFGQ   V+ LLQ   +V+A T++G T LH  AQQGH  IV LLL+++ + N Q   G T L +A+K  Y+++ ++L  +T   E     S +EEK  ++  PE M
Sbjct:  164 SFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLL-DNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRN-GAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVA-QLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAEEKYRVV-APEAM 963          

HSP 2 Score: 436.417 bits (1121), Expect = 1.814e-124
Identity = 234/600 (39.00%), Postives = 347/600 (57.83%), Query Frame = 1
Query: 2875 FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNL--AENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKS-----------ELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTC 4635
            FL+SF+VDA+GG M+  RH  +R+ +P  S   PTR+ C   + +     P L + EALA R++ L   +    GP+++E+PH A+LR  ERE+++L+SDNG +W+EHT   ++  + D L      E I   E Q  N + R +T   PQYF+++SR++Q++  IG EGG V+S+V  QVQAVFP+GAL KKIK+ LQ   +  +L  K  G GVA+SPIVT+EPRRRKFH+AITL++P P          Y+  T +LRLLCSI+G  +   WED+TG++PLT  + CVSFTTT+SAR WL+DC   ++  ++A+ LY+E   VPFI +F+VF ++    E ++R  C+TDD  +KTLE  E +  ++    VEVLE    ++E +GN++P+T S +QL ++   F+ENRL F  R+KD      G+  FM++P++           G P     PQ+PIC L+I LP            E    D      D+     RT + S           ++ I +++  +G DW +L   +G+  EEI  I  Q+    D         I   KD    ++ + LE +L++IGR+DI+K C
Sbjct: 1078 FLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHADIVGRTLFMKEPKVAK---------GEP-----PQQPICILNIVLP------------EAVIPDSTTAFSDRVTSAYRTSMFSLSKHQNDHYIGDIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNT---DSIARQAQSMIRLYKDKPNYDILS-LETALKNIGRDDIMKKC 1647          

HSP 3 Score: 309.301 bits (791), Expect = 3.108e-84
Identity = 221/685 (32.26%), Postives = 336/685 (49.05%), Query Frame = 2
Query:  710 HQSA-SGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLT-----------------------------ALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHI---------------------------------ACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLH--P------------------------------EANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSK 2479
            HQSA  G T    AA   N+      ++ N D+N    N +  LH+A+K G   ++  L+ + A V+S T+ G + +H A+ +G E ++ +LLE+ A +  +S+NG T L MA Q +   V + L++ G +    T D  T                             ALH+AA   ++ AA +LL N+ N +  + +GFTPLHI                                 A K  ++ MV LL++   +I + T  GLTPLH AA  G +++V++LL+ GA IS  T      LH+AA+    +  +ILL H  P                               A+ NARA    TPLHIA +     +VE LL  GA  +  T+   T LH+AA  G   I   LL+H   PD  T +G TPLH+A++  +  + R +LL      ++      TPLH+A+   + +++ LLL   A V+   K+ YT LH+ AK+   EV  +LI+ GA ++A ++KGFTPLHL +  G+ ++ +LLL   ADV+ Q +NG+T LH+A   N   +   LL+  A      + G+T LH A    Q+     LL+     NA++  G T LHL++Q+GH  I  LL++++  VNH  K GLT + +  ++  +N+AE L K
Sbjct:  155 HQSAGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIR-ILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEK 838          
BLAST of Ankyrin-2 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303121)

HSP 1 Score: 855.514 bits (2209), Expect = 0.000e+0
Identity = 443/804 (55.10%), Postives = 587/804 (73.01%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMM---SGSEEKKLILDQPEKM 2551
            +FLRAAR+GN+E+V E L+ +I  + SNANGLNA+HLA+K+G+  VV  L+  G  VD AT+KGNT+LHIASLAG+ EVV LLLE  A++NV+SQNGFTPLYMAAQENH  VV++LL  GANQ++ T+DGFTPLAVA+QQG+DKVV +LL++D+R KVRLPALHIAAKKDDV AA+LL+  +D N D  S SGFTPLHIA+HY N N+A LLI+K ADVN+ AK+NI+PLHVAAKWGK  M+ LL+ +  N+ + TRDGL+P+HCAARSG E ++ +LLE GA I  K+KNGL  L MA QG+  +  + L+     VD VT+DYLTALHVAAHCG++  A++LL  N + NARALNGFTPLHIACKK + K+VELL+++ A I++TTE+GLTPLH+AAFMG   IV  LL++ AS    T++ E  LHLAAR NQ +  +ILL +  A  +ARARE QTPLHIA R+GN  IV  LL  GA  +  TKD YTALHIAAKEG+ E++ +L+E+    DA TKKGFTPLH+ +KYG ++VA QLLL  + + ++ G +G+TPLHVA +YN+ ++  LLL+  A+ +   KNG+TPLH+ A+KN +++   L++ GA  NA+S+ GFTPLHL+S  G+ EI  LL++  A VNH A+NGLT +HL A+++  ++ E L K  A+I   T+ GYT LH A HFGQ   V+ LLQ   +V+A T++G T LH  AQQGH  IV LLL+++ + N Q   G T L +A+K  Y+++ ++L  +T   E     S +EEK  ++  PE M
Sbjct:   14 SFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLL-DNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRN-GAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVA-QLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAEEKYRVV-APEAM 813          

HSP 2 Score: 436.417 bits (1121), Expect = 1.916e-124
Identity = 234/600 (39.00%), Postives = 347/600 (57.83%), Query Frame = 1
Query: 2875 FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNL--AENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKS-----------ELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTC 4635
            FL+SF+VDA+GG M+  RH  +R+ +P  S   PTR+ C   + +     P L + EALA R++ L   +    GP+++E+PH A+LR  ERE+++L+SDNG +W+EHT   ++  + D L      E I   E Q  N + R +T   PQYF+++SR++Q++  IG EGG V+S+V  QVQAVFP+GAL KKIK+ LQ   +  +L  K  G GVA+SPIVT+EPRRRKFH+AITL++P P          Y+  T +LRLLCSI+G  +   WED+TG++PLT  + CVSFTTT+SAR WL+DC   ++  ++A+ LY+E   VPFI +F+VF ++    E ++R  C+TDD  +KTLE  E +  ++    VEVLE    ++E +GN++P+T S +QL ++   F+ENRL F  R+KD      G+  FM++P++           G P     PQ+PIC L+I LP            E    D      D+     RT + S           ++ I +++  +G DW +L   +G+  EEI  I  Q+    D         I   KD    ++ + LE +L++IGR+DI+K C
Sbjct:  959 FLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHADIVGRTLFMKEPKVAK---------GEP-----PQQPICILNIVLP------------EAVIPDSTTAFSDRVTSAYRTSMFSLSKHQNDHYIGDIRIVDLSNLLGKDWIQLAPEIGINGEEIDEIINQNT---DSIARQAQSMIRLYKDKPNYDILS-LETALKNIGRDDIMKKC 1528          

HSP 3 Score: 305.449 bits (781), Expect = 3.875e-83
Identity = 217/679 (31.96%), Postives = 332/679 (48.90%), Query Frame = 2
Query:  725 GFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLT-----------------------------ALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHI---------------------------------ACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLH--P------------------------------EANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSK 2479
            G T    AA   N+      ++ N D+N    N +  LH+A+K G   ++  L+ + A V+S T+ G + +H A+ +G E ++ +LLE+ A +  +S+NG T L MA Q +   V + L++ G +    T D  T                             ALH+AA   ++ AA +LL N+ N +  + +GFTPLHI                                 A K  ++ MV LL++   +I + T  GLTPLH AA  G +++V++LL+ GA IS  T      LH+AA+    +  +ILL H  P                               A+ NARA    TPLHIA +     +VE LL  GA  +  T+   T LH+AA  G   I   LL+H   PD  T +G TPLH+A++  +  + R +LL      ++      TPLH+A+   + +++ LLL   A V+   K+ YT LH+ AK+   EV  +LI+ GA ++A ++KGFTPLHL +  G+ ++ +LLL   ADV+ Q +NG+T LH+A   N   +   LL+  A      + G+T LH A    Q+     LL+     NA++  G T LHL++Q+GH  I  LL++++  VNH  K GLT + +  ++  +N+AE L K
Sbjct:   11 GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIR-ILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEK 688          

HSP 4 Score: 280.026 bits (715), Expect = 3.254e-75
Identity = 203/584 (34.76%), Postives = 295/584 (50.51%), Query Frame = 2
Query:  905 NSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCE-NALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLL-----LSAKVN----PNSLGHHG-----------------------LTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTK-----------TQMG----------------------YTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLN 2458
            N    DG +    AAR+G    +L  L+N  DI   + NGL AL +A++     V   L+ +G  VD+ T    TALH+A+  G     ++LL++N +VN ++ NGFTPL++A ++    +V LL+   A+ +  TE G TPL +A   G  ++V +LL+     S T  K    ALH+AA+ +  +    LLL  + N +  ++   TPLHIA   GN +I   L+  GAD N   K N + LH+AAK G+  +  LLLE     +AKT+ G TPLH A++ G  QV   LL     +SAK      P  +   G                       LT LHVA +  H  + +LLLD  A+ N    NG+TPLH+  KKN ++V +LL+  GA+++A ++ G TPLH+ +  G   I+  LL  +A  +     G T LHLAA  N+TDI+  LL+  A +  +           +++G                      YTALH A   GQ +   +L++    ++A T  G T LHL A+ GHI + +LLL  E DV+ Q K G+T L VA   HY N
Sbjct:    5 NGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLE-----SDTRGKVRLPALHIAAKKDDVKA-ATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVA--CHYNN 580          
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Match: ank2b (ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041010-165])

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 422/803 (52.55%), Postives = 565/803 (70.36%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            +FLRAAR+GN++KV E+L+  +    SN NGLNA+HLAAKEG+ ++VQ L+  G SVD AT+KGNT+LHIASLAG+ +VV +L +  ANIN +SQNGFTPLYMA+QENHLDVV+ LLE G NQ+I T+DGFTPLA+ALQQG+++VV ILL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D QS SGFTPLHIAAHY NVNVA LL+ + A V+F A+N ITPLHVA+K G   M+ LL+ + A +++ TRDGL+P+HCAARSG +  + +LLE GA +  ++KNGL+ L MA QGD  E  K L+     VD VT+DYLTALHVAAHCG+    ++LL    N NARALNGFTPLHIACKK + K++ELLIKY A I + TE+GLTP+H+AAFMG   IV +LL+NGAS   + ++ E ALH+AAR  Q E  + LL +  A  +ARARE+QTPLHIA R+G   IV+ LL   A P+  T + YT LHIAA+EG  +++ +LLE        TKKGFTPLH+ASKYG ++VA+ LLL  +  P+S G +GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +E+   L+  GA  N Q+++G  P+HL S  G+ E+  LLL   A VN   ++GLT+LHLAA++++  + E L+K  A++  +T++GYT L  A H+G  + V  LL+    VN +T  G T LH AAQQG+  I+ +LL      N     G TAL +A++  Y+++ +TL  VT      + +  +K  L+ PE M +
Sbjct:   23 SFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRN-GAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAK-LLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTLRVVTEEIVTTTTTVTEKHKLNVPETMTE 822          

HSP 2 Score: 446.432 bits (1147), Expect = 2.552e-129
Identity = 239/629 (38.00%), Postives = 358/629 (56.92%), Query Frame = 1
Query: 2815 NDWEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWS-DANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLG-NQLELSLRDIGREDIVKTCIHDI--SIVDESERKFAE 4683
            + WE E LD++ L   P  +GFL+SF+VDA+GG M+  RH  +R+ +P      PTR+ C L ++    T+P + + + LA R+I +  S     GP+++EIPH AALR  ERE+V+L+S+ G SWKEH   +T+  +   L  + E +   E   + RI RIIT   PQYF+++SR+KQD   IG EGG ++S+V  +VQAVFPEGAL K+I++ LQ   +  ++++   GN    SPIVTLEPRRRKFH+ IT+T+P+P  S D         +T +LRLLCSI+G  TP  WEDITGT+PLT  + CVSFTT +SAR WLIDC +  E V  A+ +Y E   VP++ +F++F +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    +++  GN++P+T S +        F+ENRL+ + +I+D +  PCG+++F ++PR                 + L    +C L+I+LP       L         D+  +P D+ +R        E  +  +A  +G  W +L   L     +I +I  ++  + +D+++  + LW    K+ +  N   N L  +L  I R DIV      I  S  D S   +AE
Sbjct:  917 DSWETENLDNIALSSSPAHSGFLVSFMVDARGGAMRGCRHNGLRLIIPPRKCSAPTRVTCRLVKRHRLATMPPMVEGDGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVILRSETGESWKEHHCEYTEEELNQVLNGMDERLDPPEELEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPEVQAVFPEGALTKRIRVGLQTQPMSVDVVRNMLGNKATFSPIVTLEPRRRKFHKPITMTIPVPKSSADPALGSFGGGETPTLRLLCSITGGTTPAQWEDITGTTPLTFTNDCVSFTTNVSARFWLIDCRQVQESVNFATLMYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKMDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHVFSFYAFKENRLALFIKIRDNTQEPCGRLSFTKEPRS---------------FRTLSHGAVCNLNISLPAYSKAAFL---------DIAVDPQDEADR-------KESRLAVIANHLGFSWSELARELEFSDVQINQIRNENPNSLQDQSHALIRLW----KEREGKNASENSLMKTLTKINRMDIVHLIETKIIQSSQDHSSHTYAE 1510          

HSP 3 Score: 275.404 bits (703), Expect = 5.003e-74
Identity = 190/616 (30.84%), Postives = 306/616 (49.68%), Query Frame = 2
Query:  812 PAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPL-----------------------------HIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGA----------DP-----------------------NMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            P  ++ T    AA+ G  + +   +    ++ +  ++GL+ +H AA+ G  +++  LL  G+ +   +K G TAL +A+   Q +V K L  +G +++A + +  T L++A+   +++    LL+N  N +    +GFTPL                             HIA +K  +K   LL++   + +  +++G TPLHIAA  G+  +  +LL  GA++  T       LH+A++         LLL   A  +A+ R+  TPLH A R G+ + VE LL  GA           P                       + VT D  TALH+AA  G + +++LLL+ +  P+A+   GFTPLHIA K  RV+V  +LL+       ++   GLTP+HVA +  H  ++ LLL   A+ +     G T LH+ A+   +EV + L+  GA V+A++++  TPLH+ S  G  EI++LLL   A  +    NG T LH+AA +   D+   LL+  A  S  T+ G+T LH A  +G ++  K+LLQ+    ++    G T LH+AA   +  +  LLLD     +   K G T L +A K++ + IA TL
Sbjct:   16 PKSDSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVH-LLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVM-ELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTL 629          

HSP 4 Score: 169.474 bits (428), Expect = 1.662e-41
Identity = 115/346 (33.24%), Postives = 175/346 (50.58%), Query Frame = 2
Query: 1487 PEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTP-----------------------------LHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVA 2437
            P A+      ++ T    A R GN   V + L  G D     ++   ALH+AAKEG  ++ + LL      D+ TKKG T LHIAS  G+  V + +L     N N+   +G TPL++A+  NH +++  LL+   N +   ++G+TP                             LH+ A+K+  +   LL+    N + QS+ GFTPLH+ +  GN  +  LLL+  A V+  A NG+T LH+A+++  T++V  LL   A I  KT+ G T LH A   G    V++LL++   + A+T  G + LH+AAQ  H+  V+ LL ++  V+      LTAL VA
Sbjct:    9 PTAHNQPPKSDSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVK-ILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVA 353          
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Match: ank2b (ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041010-165])

HSP 1 Score: 797.734 bits (2059), Expect = 0.000e+0
Identity = 422/804 (52.49%), Postives = 565/804 (70.27%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLG-HHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            +FLRAAR+GN++KV E+L+  +    SN NGLNA+HLAAKEG+ ++VQ L+  G SVD AT+KGNT+LHIASLAG+ +VV +L +  ANIN +SQNGFTPLYMA+QENHLDVV+ LLE G NQ+I T+DGFTPLA+ALQQG+++VV ILL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D QS SGFTPLHIAAHY NVNVA LL+ + A V+F A+N ITPLHVA+K G   M+ LL+ + A +++ TRDGL+P+HCAARSG +  + +LLE GA +  ++KNGL+ L MA QGD  E  K L+     VD VT+DYLTALHVAAHCG+    ++LL    N NARALNGFTPLHIACKK + K++ELLIKY A I + TE+GLTP+H+AAFMG   IV +LL+NGAS   + ++ E ALH+AAR  Q E  + LL +  A  +ARARE+QTPLHIA R+G   IV+ LL   A P+  T + YT LHIAA+EG  +++ +LLE        TKKGFTPLH+ASKYG ++VA+ LLL  +  P+S G  +GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +E+   L+  GA  N Q+++G  P+HL S  G+ E+  LLL   A VN   ++GLT+LHLAA++++  + E L+K  A++  +T++GYT L  A H+G  + V  LL+    VN +T  G T LH AAQQG+  I+ +LL      N     G TAL +A++  Y+++ +TL  VT      + +  +K  L+ PE M +
Sbjct:   35 SFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRN-GAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAK-LLLQRRAPPDSAGKQNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFLLKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAIT-NGNTALAIARRLGYISVVDTLRVVTEEIVTTTTTVTEKHKLNVPETMTE 834          

HSP 2 Score: 423.32 bits (1087), Expect = 3.289e-120
Identity = 218/562 (38.79%), Postives = 325/562 (57.83%), Query Frame = 1
Query: 2815 NDWEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRII-------------HLNASTQSLD--------------------GPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWS-DANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSEL 4395
            + WE E LD++ L   P  +GFL+SF+VDA+GG M+  RH  +R+ +P      PTR+ C L ++    T+P + + + LA R+I             HL  +   L+                    GP+++EIPH AALR  ERE+V+L+S+ G SWKEH   +T+  +   L  + E +   E   + RI RIIT   PQYF+++SR+KQD   IG EGG ++S+V  +VQAVFPEGAL K+I++ LQ   +  ++++   GN    SPIVTLEPRRRKFH+ IT+T+P+P  S D         +T +LRLLCSI+G  TP  WEDITGT+PLT  + CVSFTT +SAR WLIDC +  E V  A+ +Y E   VP++ +F++F +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    +++  GN++P+T S +        F+ENRL+ + +I+D +  PCG+++F ++PR  S  +  +G V             C L+I+LP    +   +   +E ++  +   DD  E    +I+K+ L
Sbjct:  923 DSWETENLDNIALSSSPAHSGFLVSFMVDARGGAMRGCRHNGLRLIIPPRKCSAPTRVTCRLVKRHRLATMPPMVEGDGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVILRSETGESWKEHHCEYTEEELNQVLNGMDERLDPPEELEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPEVQAVFPEGALTKRIRVGLQTQPMSVDVVRNMLGNKATFSPIVTLEPRRRKFHKPITMTIPVPKSSADPALGSFGGGETPTLRLLCSITGGTTPAQWEDITGTTPLTFTNDCVSFTTNVSARFWLIDCRQVQESVNFATLMYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKMDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHVFSFYAFKENRLALFIKIRDNTQEPCGRLSFTKEPR--SFRTLSHGAV-------------CNLNISLPAYSKESDSDQEPDEETSRTLGKYDDDTETTETSILKTHL 1469          

HSP 3 Score: 241.891 bits (616), Expect = 1.820e-63
Identity = 178/558 (31.90%), Postives = 279/558 (50.00%), Query Frame = 2
Query: 1010 KSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTT--------------------MKCEN---------ALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTP---------------------------------LHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPE 2497
            KS +  + L+ A  G+  +V + L   G+D+     + L ALH+AA  G+++  + LL    +V++    G T LHIA    Q  +V++L K  A+IN+ ++ G TPL++A+     ++V  LL+NG + S  T                    +  EN         ALH+AAR +  ++   LLL  + N + +++   TPLHIA   GN ++   LLN GA  +   ++  T LH+A+K G   +  LLL+   + DAKT+ G TPLH A++ G    A +LLL       +   +GL+P                                 LHVA +  HY + +LLLD  AN N    NG+TPLH+  KKN ++V +LLI  GA + A ++ G TP+H+ +  G+  I+ LLL   A  +     G TALH+AA   + ++V  LL+  A +  + +   T LH A   G+ + V++LLQ     +A T  G T LH+AA++GH+ +  +LL+     +   K+G T L VA K   L +A+ L +    P+
Sbjct:   29 KSDSNTSFLRAARAGNIDKVLEYL-KGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKS-AALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGH-DTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPD 583          
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 405/779 (51.99%), Postives = 554/779 (71.12%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVT 2485
            ++LRAAR+GN+EKV ++L+  +  ++ N NGLNA+HLA+KEG+ EVV  L++ G +VD AT+KGNT+LHIASLAG+ EVV  L+ + AN+N +SQNGFTPLYMAAQENHLDVV+ LLE  ++Q+I T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + + + + T+DGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L+     VD VT DYLTALHVAAHCG+   A+V++    N NA+ALNGFTPLHIACKK + K++ELL+K+ A + + TE+GLTP+H+AAFMG + IV  L  +GAS + T ++ E ALH+AAR  Q +  + LL +  A  + +A+++QT LHIA R+G   IV+QLL  GA PN  T   YT LH++A+EG  EI+ LLLE      A TKKGFTPLH+A+KYG+++VA  LLL  K  P++ G  GLTPLHVA +Y++  +  LLLD  A+ +   KNGYTPLH+ AKKN +E+   L++ GA  N  +++G +PLHL +  G+ +++ LLL   A+VN   +NGLT LHLAA+ ++  + E LL   A+I  +T+ GYT LH A H+G ++    LL+     NA+T  G T LH AAQQGH  I+ +LL      N     G TAL +A++  Y+++ +TL  VT
Sbjct:   45 SYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQN-GAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVA-NLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVT 820          

HSP 2 Score: 411.379 bits (1056), Expect = 1.905e-117
Identity = 225/637 (35.32%), Postives = 344/637 (54.00%), Query Frame = 1
Query: 2860 PVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWS-----DANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSND---------------LIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV---KTCIHDISIVDESERKFAETIING 4698
            PV +GFL+SF+VDA+GG M+  RH  +RI VP      PTRI C L ++      P + + E L  R++ +  +     GP+++EIPH  ++R  ERE++VL+SDNG +WKEH        +   L  + E + +     + RI RIIT   PQYF+++SR+KQ+   +G EGG + S     V+A FP+GAL KKI++ LQ   +  ++++   GN  + SPIVT+EPRRRKFH+ IT+T+P+P  S     +  +  P       LRLLCSI+G  +P  WEDITGT+PL+    CVSFTT +SAR WL DC + +E V +AS LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +E+LE      E  GNI P+  S +QL      F+ENRL F  +++D+   PCG+++F+ +P+                 + LPQ  IC L+ TLPT   ++  ++ D+E   D                + +P    +  C    +++L +  VA  +G  W +L   +    +EI  I  ++  +   ++++ L  W++      K+   + L   L  + R DIV   +  I D     E+    AE   +G
Sbjct:  972 PVHSGFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSDNGETWKEHHYDCKVTELTSILNGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEP----APCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQEPCGRISFLREPKT---------------AKGLPQSAICNLNFTLPTH-RKEMESDPDDENDKDRRHTFASLALRKRYSYLADPASSPQSPCE---RTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDG---KNATTDALTAVLTKVNRMDIVTLLEGPIFDYGWFSETSNANAEPAASG 1582          

HSP 3 Score: 296.975 bits (759), Expect = 1.006e-80
Identity = 193/551 (35.03%), Postives = 294/551 (53.36%), Query Frame = 2
Query:  944 AARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCE-NALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVAR--------------------------------QLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPE 2497
            AAR+G    +L  L+ G DI   ++NGL AL +A++    EV   L+  G +VDA T    TALH+A+  G       L+ N  NVNA++ NGFTPL++A ++    +V  L++  +  +  TE G TPL +A   G  ++V++LL+N      T  K    ALH+AAR +  ++   LLL  + N +  ++   TPLHIA   GN ++   LLN GA  + + +++ T LH+A+K G   + +LLL+   K +AKTK G TPLH  ++ G  QV                                  QLLL      + + +  LT LHVA +  HY++ ++++D +AN N    NG+TPLH+  KKN ++V +LL+  GA++ A ++ G TP+H+ +  G++ I++ L    A  N     G TALH+AA   + D+V  LL+  A +  K +   TALH A   G+++ V+ LLQK    NA T  G T LHL+A++GH  I  LLL+    ++   K+G T L VA K   L +A  L +    P+
Sbjct:   49 AARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN-----DTKGKVRLPALHIAARKDDTKS-AALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPD 593          
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 405/779 (51.99%), Postives = 554/779 (71.12%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVT 2485
            ++LRAAR+GN+EKV ++L+  +  ++ N NGLNA+HLA+KEG+ EVV  L++ G +VD AT+KGNT+LHIASLAG+ EVV  L+ + AN+N +SQNGFTPLYMAAQENHLDVV+ LLE  ++Q+I T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + + + + T+DGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L+     VD VT DYLTALHVAAHCG+   A+V++    N NA+ALNGFTPLHIACKK + K++ELL+K+ A + + TE+GLTP+H+AAFMG + IV  L  +GAS + T ++ E ALH+AAR  Q +  + LL +  A  + +A+++QT LHIA R+G   IV+QLL  GA PN  T   YT LH++A+EG  EI+ LLLE      A TKKGFTPLH+A+KYG+++VA  LLL  K  P++ G  GLTPLHVA +Y++  +  LLLD  A+ +   KNGYTPLH+ AKKN +E+   L++ GA  N  +++G +PLHL +  G+ +++ LLL   A+VN   +NGLT LHLAA+ ++  + E LL   A+I  +T+ GYT LH A H+G ++    LL+     NA+T  G T LH AAQQGH  I+ +LL      N     G TAL +A++  Y+++ +TL  VT
Sbjct:   45 SYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQN-GAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVA-NLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVT 820          

HSP 2 Score: 411.379 bits (1056), Expect = 1.905e-117
Identity = 225/637 (35.32%), Postives = 344/637 (54.00%), Query Frame = 1
Query: 2860 PVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWS-----DANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSND---------------LIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV---KTCIHDISIVDESERKFAETIING 4698
            PV +GFL+SF+VDA+GG M+  RH  +RI VP      PTRI C L ++      P + + E L  R++ +  +     GP+++EIPH  ++R  ERE++VL+SDNG +WKEH        +   L  + E + +     + RI RIIT   PQYF+++SR+KQ+   +G EGG + S     V+A FP+GAL KKI++ LQ   +  ++++   GN  + SPIVT+EPRRRKFH+ IT+T+P+P  S     +  +  P       LRLLCSI+G  +P  WEDITGT+PL+    CVSFTT +SAR WL DC + +E V +AS LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +E+LE      E  GNI P+  S +QL      F+ENRL F  +++D+   PCG+++F+ +P+                 + LPQ  IC L+ TLPT   ++  ++ D+E   D                + +P    +  C    +++L +  VA  +G  W +L   +    +EI  I  ++  +   ++++ L  W++      K+   + L   L  + R DIV   +  I D     E+    AE   +G
Sbjct:  972 PVHSGFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSDNGETWKEHHYDCKVTELTSILNGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEP----APCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQEPCGRISFLREPKT---------------AKGLPQSAICNLNFTLPTH-RKEMESDPDDENDKDRRHTFASLALRKRYSYLADPASSPQSPCE---RTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDG---KNATTDALTAVLTKVNRMDIVTLLEGPIFDYGWFSETSNANAEPAASG 1582          

HSP 3 Score: 296.975 bits (759), Expect = 1.006e-80
Identity = 193/551 (35.03%), Postives = 294/551 (53.36%), Query Frame = 2
Query:  944 AARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCE-NALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVAR--------------------------------QLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPE 2497
            AAR+G    +L  L+ G DI   ++NGL AL +A++    EV   L+  G +VDA T    TALH+A+  G       L+ N  NVNA++ NGFTPL++A ++    +V  L++  +  +  TE G TPL +A   G  ++V++LL+N      T  K    ALH+AAR +  ++   LLL  + N +  ++   TPLHIA   GN ++   LLN GA  + + +++ T LH+A+K G   + +LLL+   K +AKTK G TPLH  ++ G  QV                                  QLLL      + + +  LT LHVA +  HY++ ++++D +AN N    NG+TPLH+  KKN ++V +LL+  GA++ A ++ G TP+H+ +  G++ I++ L    A  N     G TALH+AA   + D+V  LL+  A +  K +   TALH A   G+++ V+ LLQK    NA T  G T LHL+A++GH  I  LLL+    ++   K+G T L VA K   L +A  L +    P+
Sbjct:   49 AARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN-----DTKGKVRLPALHIAARKDDTKS-AALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPD 593          
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 405/787 (51.46%), Postives = 554/787 (70.39%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSA--------SGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVT 2485
            ++LRAAR+GN+EKV ++L+  +  ++ N NGLNA+HLA+KEG+ EVV  L++ G +VD AT+KGNT+LHIASLAG+ EVV  L+ + AN+N +SQNGFTPLYMAAQENHLDVV+ LLE  ++Q+I T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D +S         SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + + + + T+DGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L+     VD VT DYLTALHVAAHCG+   A+V++    N NA+ALNGFTPLHIACKK + K++ELL+K+ A + + TE+GLTP+H+AAFMG + IV  L  +GAS + T ++ E ALH+AAR  Q +  + LL +  A  + +A+++QT LHIA R+G   IV+QLL  GA PN  T   YT LH++A+EG  EI+ LLLE      A TKKGFTPLH+A+KYG+++VA  LLL  K  P++ G  GLTPLHVA +Y++  +  LLLD  A+ +   KNGYTPLH+ AKKN +E+   L++ GA  N  +++G +PLHL +  G+ +++ LLL   A+VN   +NGLT LHLAA+ ++  + E LL   A+I  +T+ GYT LH A H+G ++    LL+     NA+T  G T LH AAQQGH  I+ +LL      N     G TAL +A++  Y+++ +TL  VT
Sbjct:   28 SYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQN-GAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVA-NLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVT 811          

HSP 2 Score: 400.208 bits (1027), Expect = 9.400e-113
Identity = 193/474 (40.72%), Postives = 280/474 (59.07%), Query Frame = 1
Query: 2875 FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWS-----DANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT 4281
            FL+SF+VDA+GG M+  RH  +RI VP      PTRI C L ++      P + + E L  R++ +  +     GP+++EIPH  ++R  ERE++VL+SDNG +WKEH        +   L  + E + +     + RI RIIT   PQYF+++SR+KQ+   +G EGG + S     V+A FP+GAL KKI++ LQ   +  ++++   GN  + SPIVT+EPRRRKFH+ IT+T+P+P  S     +  +  P       LRLLCSI+G  +P  WEDITGT+PL+    CVSFTT +SAR WL DC + +E V +AS LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +E+LE      E  GNI P+  S +QL      F+ENRL F  +++D+   PCG+++F+ +P+                 + LPQ  IC L+ TLPT
Sbjct:  967 FLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSDNGETWKEHHYDCKVTELTSILNGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEPAPC----LRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQEPCGRISFLREPKT---------------AKGLPQSAICNLNFTLPT 1421          

HSP 3 Score: 289.271 bits (739), Expect = 5.876e-78
Identity = 192/558 (34.41%), Postives = 292/558 (52.33%), Query Frame = 2
Query:  944 AARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCE-NALHLAARNNQEETFKILL-------LHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVAR--------------------------------QLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPE 2497
            AAR+G    +L  L+ G DI   ++NGL AL +A++    EV   L+  G +VDA T    TALH+A+  G       L+ N  NVNA++ NGFTPL++A ++    +V  L++  +  +  TE G TPL +A   G  ++V++LL+N      T  K    ALH+AAR +  ++  +LL       +  +   N       TPLHIA   GN ++   LLN GA  + + +++ T LH+A+K G   + +LLL+   K +AKTK G TPLH  ++ G  QV                                  QLLL      + + +  LT LHVA +  HY++ ++++D +AN N    NG+TPLH+  KKN ++V +LL+  GA++ A ++ G TP+H+ +  G++ I++ L    A  N     G TALH+AA   + D+V  LL+  A +  K +   TALH A   G+++ V+ LLQK    NA T  G T LHL+A++GH  I  LLL+    ++   K+G T L VA K   L +A  L +    P+
Sbjct:   32 AARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN-----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPD 584          
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 413/805 (51.30%), Postives = 570/805 (70.81%), Query Frame = 2
Query:  107 MVEETKDSLTEKAH------------AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVT 2485
            M EETK+   + AH            ++LRAARSGN+EK  ++L+  +  ++ N NGLNA+HLA+KEG+ E+V  LI+ G  VD +T+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VVK LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + + +++ TRDGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    N NA+ALNGFTPLHIACKK + K++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L  +GAS + T ++ E ALH+AAR  Q E  + LL +  A   A+A+++QTPLHI+ R+G   IV+QLL  GA P+  T   YT LH++++EG  +++ +LLEH       TKKGFTPLH+A+KYG+++V + LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G  P+HL +  G+ +++ LLL  +A+VN   ++GLT LHLAA+++R  + E L    A I   T+M YT LH A H+G I+ V  LLQ    VNA+T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  VT
Sbjct:    1 MSEETKEKAAKPAHRKRKGKKSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQN-GAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVK-LLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVT 802          

HSP 2 Score: 434.491 bits (1116), Expect = 1.878e-124
Identity = 234/631 (37.08%), Postives = 356/631 (56.42%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAG-----------FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS-SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSND---------------LIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  + LD+V L+  PV +G           FL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++    T P + + E LA R++ +  S     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH        + + L  + E + + E   + RI RI+T   PQYF+++SR+KQ+   IG EGG + S+   +VQA FPEGAL K+I++ LQ   +  +L++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y   T+ SLRLLCSI+G  +P  WEDITGT+PLT  + CVSFTT +SAR WL DC++  E V +A+ LY E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +++D S  PCG+++F+++P+                T+ LPQ  +C L+ITLPT+  +   +  DE    D                +  P    +  C    ++++ +  VA  +G  W +L   L    +EI +I +++  +   ++++ L  W+       K+   + L   L  I R DIV
Sbjct:  928 WAADTLDNVNLVSSPVHSGYVSPLPQYDASFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPTQKKETESDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDG---KNATTDALTNVLTKINRIDIV 1537          
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 410/798 (51.38%), Postives = 570/798 (71.43%), Query Frame = 2
Query:   95 RIFQMVEETKDSLTEKAHA-FLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVT 2485
            ++FQ +   ++S     +A +LRAARSGN+EK  ++L+  +  ++ N NGLNA+HLA+KEG+ E+V  LI+ G  VD +T+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VVK LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + + +++ TRDGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    N NA+ALNGFTPLHIACKK + K++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L  +GAS + T ++ E ALH+AAR  Q E  + LL +  A   A+A+++QTPLHI+ R+G   IV+QLL  GA P+  T   YT LH++++EG  +++ +LLEH       TKKGFTPLH+A+KYG+++V + LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G  P+HL +  G+ +++ LLL  +A+VN   ++GLT LHLAA+++R  + E L    A I   T+M YT LH A H+G I+ V  LLQ    VNA+T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  VT
Sbjct:   10 QVFQKISSPRNSPKSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQN-GAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVK-LLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVT 804          

HSP 2 Score: 434.106 bits (1115), Expect = 3.249e-124
Identity = 234/631 (37.08%), Postives = 356/631 (56.42%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAG-----------FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS-SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSND---------------LIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  + LD+V L+  PV +G           FL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++    T P + + E LA R++ +  S     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH        + + L  + E + + E   + RI RI+T   PQYF+++SR+KQ+   IG EGG + S+   +VQA FPEGAL K+I++ LQ   +  +L++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y   T+ SLRLLCSI+G  +P  WEDITGT+PLT  + CVSFTT +SAR WL DC++  E V +A+ LY E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +++D S  PCG+++F+++P+                T+ LPQ  +C L+ITLPT+  +   +  DE    D                +  P    +  C    ++++ +  VA  +G  W +L   L    +EI +I +++  +   ++++ L  W+       K+   + L   L  I R DIV
Sbjct:  930 WAADTLDNVNLVSSPVHSGYVSPLPQYDASFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPTQKKETESDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDG---KNATTDALTNVLTKINRIDIV 1539          
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 411/801 (51.31%), Postives = 568/801 (70.91%), Query Frame = 2
Query:  107 MVEETKDSLTEKAH------------AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            M EETK+   + AH            ++LRAARSGN+EK  ++L+  +  ++ N NGLNA+HLA+KEG+ E+V  LI+ G  VD +T+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VVK LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + + +++ TRDGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    N NA+ALNGFTPLHIACKK + K++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L  +GAS + T ++ E ALH+AAR  Q E  + LL +  A   A+A+++QTPLHI+ R+G   IV+QLL  GA P+  T   YT LH++++EG  +++ +LLEH       TKKGFTPLH+A+KYG+++V + LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G  P+HL +  G+ +++ LLL  +A+VN   ++GLT LHLAA+++R  + E L    A I   T+M YT LH A H+G I+ V  LLQ    VNA+T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL
Sbjct:    1 MSEETKEKAAKPAHRKRKGKKSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQN-GAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVK-LLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 798          

HSP 2 Score: 446.432 bits (1147), Expect = 1.249e-128
Identity = 234/605 (38.68%), Postives = 354/605 (58.51%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS-SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  + LD+V L+  PV +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++    T P + + E LA R++ +  S     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH        + + L  + E + + E   + RI RI+T   PQYF+++SR+KQ+   IG EGG + S+   +VQA FPEGAL K+I++ LQ   +  +L++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y   T+ SLRLLCSI+G  +P  WEDITGT+PLT  + CVSFTT +SAR WL DC++  E V +A+ LY E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +++D S  PCG+++F+++P+                T+ LPQ  +C L+ITLPT+   + ++      S  L   P    ER       +++ +  VA  +G  W +L   L    +EI +I +++  +   ++++ L  W+       K+   + L   L  I R DIV
Sbjct:  926 WAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPTQKKNEKVDRRQNFVS--LALRPQSPCER-------TDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDG---KNATTDALTNVLTKINRIDIV 1503          
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 802.357 bits (2071), Expect = 0.000e+0
Identity = 406/779 (52.12%), Postives = 561/779 (72.02%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVT 2485
            ++LRAARSGN+EK  ++L+  +  ++ N NGLNA+HLA+KEG+ E+V  LI+ G  VD +T+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VVK LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + + +++ TRDGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    N NA+ALNGFTPLHIACKK + K++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L  +GAS + T ++ E ALH+AAR  Q E  + LL +  A   A+A+++QTPLHI+ R+G   IV+QLL  GA P+  T   YT LH++++EG  +++ +LLEH       TKKGFTPLH+A+KYG+++V + LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G  P+HL +  G+ +++ LLL  +A+VN   ++GLT LHLAA+++R  + E L    A I   T+M YT LH A H+G I+ V  LLQ    VNA+T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  VT
Sbjct:   22 SYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQN-GAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVK-LLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVT 797          

HSP 2 Score: 440.269 bits (1131), Expect = 1.760e-125
Identity = 210/490 (42.86%), Postives = 308/490 (62.86%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS-SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTK 4284
            W  + LD+V L+  PV +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++    T P + + E LA R++ +  S     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH        + + L  + E + + E   + RI RI+T   PQYF+++SR+KQ+   IG EGG + S+   +VQA FPEGAL K+I++ LQ   +  +L++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y   T+ SLRLLCSI+G  +P  WEDITGT+PLT  + CVSFTT +SAR WL DC++  E V +A+ LY E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +++D S  PCG+++F+++P+                T+ LPQ  +C L+ITLPT+
Sbjct:  939 WAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPTQ 1413          
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 801.586 bits (2069), Expect = 0.000e+0
Identity = 410/796 (51.51%), Postives = 569/796 (71.48%), Query Frame = 2
Query:  107 MVEETKDSLTEKAH---AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVT 2485
            M  E  D L++++    ++LRAARSGN+EK  ++L+  +  ++ N NGLNA+HLA+KEG+ E+V  LI+ G  VD +T+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VVK LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + + +++ TRDGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    N NA+ALNGFTPLHIACKK + K++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L  +GAS + T ++ E ALH+AAR  Q E  + LL +  A   A+A+++QTPLHI+ R+G   IV+QLL  GA P+  T   YT LH++++EG  +++ +LLEH       TKKGFTPLH+A+KYG+++V + LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G  P+HL +  G+ +++ LLL  +A+VN   ++GLT LHLAA+++R  + E L    A I   T+M YT LH A H+G I+ V  LLQ    VNA+T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  VT
Sbjct:    1 MAVEDGDCLSDQSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQN-GAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVK-LLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVT 793          

HSP 2 Score: 442.58 bits (1137), Expect = 2.571e-127
Identity = 234/620 (37.74%), Postives = 356/620 (57.42%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS-SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSND---------------LIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  + LD+V L+  PV +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++    T P + + E LA R++ +  S     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH        + + L  + E + + E   + RI RI+T   PQYF+++SR+KQ+   IG EGG + S+   +VQA FPEGAL K+I++ LQ   +  +L++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y   T+ SLRLLCSI+G  +P  WEDITGT+PLT  + CVSFTT +SAR WL DC++  E V +A+ LY E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +++D S  PCG+++F+++P+                T+ LPQ  +C L+ITLPT+  +   +  DE    D                +  P    +  C    ++++ +  VA  +G  W +L   L    +EI +I +++  +   ++++ L  W+       K+   + L   L  I R DIV
Sbjct:  919 WAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPTQKKETESDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLTAQSFMLLKKWVVRDG---KNATTDALTNVLTKINRIDIV 1517          
BLAST of Ankyrin-2 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 801.971 bits (2070), Expect = 0.000e+0
Identity = 407/804 (50.62%), Postives = 571/804 (71.02%), Query Frame = 2
Query:  107 MVEETKDSLTEKAH------------AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKV 2482
            M EE K+   + AH            ++LRAAR+G++EK  ++++  +  ++ N NGLNA+HLA+KEG+ EVV  L++   +VD AT+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VV+ LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + A +++ TRDGL+P+HC ARSG E ++ +LL+  A I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    + NA+ALNGFTPLHIACKK + +++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L+ +GAS + T ++ E ALH+AAR+ Q E  +  L+   A   A+A+++QTPLHI+ R+G   IV+QLL  GA PN  T   YT LH+AA+EG  +++  LL+H       TKKGFTPLH+A+KYG+++VA  LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G   +HL +  G+ +++ LLL  NA+VN   ++GLT LHLAA+++R ++ E L+   A +  +T+MGYT LH   H+G I+ V  LLQ +  VNA+T  G T+LH AAQQGH  I+ +LL N    N     G TAL +A++  Y+++ +TL  V
Sbjct:    1 MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR-YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVA-SLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 801          

HSP 2 Score: 433.721 bits (1114), Expect = 2.487e-124
Identity = 233/613 (38.01%), Postives = 351/613 (57.26%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQ-TSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT-KPTQKGLNNIDEEFSN-------DLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEE-DKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  + LD+V L+  PV +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E LA R++ +  +     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH     +  + + L  + E + + E     RI RIIT   PQYF+++SR+KQ+   IG EGG ++S+    VQA FPEGAL K+I++ LQ   +    ++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y    T +LRLLCSI+G  +P  WEDITGT+PLT    CVSFTT +SAR WL DC++  E V +AS LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +I+D S  PCG+++F+++P+                T+ LPQ  +C L+ITLP  K  +K   +  + F++         +  P    +  C    ++++ +  VA  +G  W +L   L    +EI +I +++      ++++ L  W+T      K+   + L   L  I R DIV
Sbjct:  948 WAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPAHKKAEKA--DRRQSFASLALRKRYSYLTEPSMSPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDG---KNATTDALTSVLTKINRIDIV 1537          
BLAST of Ankyrin-2 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 407/804 (50.62%), Postives = 571/804 (71.02%), Query Frame = 2
Query:  107 MVEETKDSLTEKAH------------AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKV 2482
            M EE K+   + AH            ++LRAAR+G++EK  ++++  +  ++ N NGLNA+HLA+KEG+ EVV  L++   +VD AT+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VV+ LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + A +++ TRDGL+P+HC ARSG E ++ +LL+  A I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    + NA+ALNGFTPLHIACKK + +++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L+ +GAS + T ++ E ALH+AAR+ Q E  +  L+   A   A+A+++QTPLHI+ R+G   IV+QLL  GA PN  T   YT LH+AA+EG  +++  LL+H       TKKGFTPLH+A+KYG+++VA  LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G   +HL +  G+ +++ LLL  NA+VN   ++GLT LHLAA+++R ++ E L+   A +  +T+MGYT LH   H+G I+ V  LLQ +  VNA+T  G T+LH AAQQGH  I+ +LL N    N     G TAL +A++  Y+++ +TL  V
Sbjct:    1 MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR-YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVA-SLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 801          

HSP 2 Score: 433.335 bits (1113), Expect = 3.602e-124
Identity = 233/613 (38.01%), Postives = 351/613 (57.26%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQ-TSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT-KPTQKGLNNIDEEFSN-------DLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEE-DKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  + LD+V L+  PV +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E LA R++ +  +     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH     +  + + L  + E + + E     RI RIIT   PQYF+++SR+KQ+   IG EGG ++S+    VQA FPEGAL K+I++ LQ   +    ++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y    T +LRLLCSI+G  +P  WEDITGT+PLT    CVSFTT +SAR WL DC++  E V +AS LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +I+D S  PCG+++F+++P+                T+ LPQ  +C L+ITLP  K  +K   +  + F++         +  P    +  C    ++++ +  VA  +G  W +L   L    +EI +I +++      ++++ L  W+T      K+   + L   L  I R DIV
Sbjct:  945 WAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPAHKKAEKA--DRRQSFASLALRKRYSYLTEPSMSPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDG---KNATTDALTSVLTKINRIDIV 1534          
BLAST of Ankyrin-2 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 407/804 (50.62%), Postives = 571/804 (71.02%), Query Frame = 2
Query:  107 MVEETKDSLTEKAH------------AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKV 2482
            M EE K+   + AH            ++LRAAR+G++EK  ++++  +  ++ N NGLNA+HLA+KEG+ EVV  L++   +VD AT+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VV+ LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + A +++ TRDGL+P+HC ARSG E ++ +LL+  A I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    + NA+ALNGFTPLHIACKK + +++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L+ +GAS + T ++ E ALH+AAR+ Q E  +  L+   A   A+A+++QTPLHI+ R+G   IV+QLL  GA PN  T   YT LH+AA+EG  +++  LL+H       TKKGFTPLH+A+KYG+++VA  LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G   +HL +  G+ +++ LLL  NA+VN   ++GLT LHLAA+++R ++ E L+   A +  +T+MGYT LH   H+G I+ V  LLQ +  VNA+T  G T+LH AAQQGH  I+ +LL N    N     G TAL +A++  Y+++ +TL  V
Sbjct:    1 MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR-YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVA-SLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 801          

HSP 2 Score: 433.335 bits (1113), Expect = 3.979e-124
Identity = 233/613 (38.01%), Postives = 351/613 (57.26%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQ-TSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT-KPTQKGLNNIDEEFSN-------DLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEE-DKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  + LD+V L+  PV +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E LA R++ +  +     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH     +  + + L  + E + + E     RI RIIT   PQYF+++SR+KQ+   IG EGG ++S+    VQA FPEGAL K+I++ LQ   +    ++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y    T +LRLLCSI+G  +P  WEDITGT+PLT    CVSFTT +SAR WL DC++  E V +AS LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +I+D S  PCG+++F+++P+                T+ LPQ  +C L+ITLP  K  +K   +  + F++         +  P    +  C    ++++ +  VA  +G  W +L   L    +EI +I +++      ++++ L  W+T      K+   + L   L  I R DIV
Sbjct:  966 WAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPAHKKAEKA--DRRQSFASLALRKRYSYLTEPSMSPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDG---KNATTDALTSVLTKINRIDIV 1555          
BLAST of Ankyrin-2 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 414/827 (50.06%), Postives = 583/827 (70.50%), Query Frame = 2
Query:  107 MVEETKDSLTEKAH------------AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKM 2551
            M EE K+   + AH            ++LRAAR+G++EK  ++++  +  ++ N NGLNA+HLA+KEG+ EVV  L++   +VD AT+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VV+ LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + A +++ TRDGL+P+HC ARSG E ++ +LL+  A I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    + NA+ALNGFTPLHIACKK + +++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L+ +GAS + T ++ E ALH+AAR+ Q E  +  L+   A   A+A+++QTPLHI+ R+G   IV+QLL  GA PN  T   YT LH+AA+EG  +++  LL+H       TKKGFTPLH+A+KYG+++VA  LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G   +HL +  G+ +++ LLL  NA+VN   ++GLT LHLAA+++R ++ E L+   A +  +T+MGYT LH   H+G I+ V  LLQ +  VNA+T  G T+LH AAQQGH  I+ +LL N    N     G TAL +A++  Y+++ +TL KV T   M + +  +K  ++ PE M
Sbjct:    1 MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR-YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVA-SLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL-KVVTEEIMTTTTITEKHKMNVPETM 823          

HSP 2 Score: 433.721 bits (1114), Expect = 5.009e-125
Identity = 233/613 (38.01%), Postives = 351/613 (57.26%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQ-TSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT-KPTQKGLNNIDEEFSN-------DLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEE-DKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  + LD+V L+  PV +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E LA R++ +  +     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH     +  + + L  + E + + E     RI RIIT   PQYF+++SR+KQ+   IG EGG ++S+    VQA FPEGAL K+I++ LQ   +    ++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y    T +LRLLCSI+G  +P  WEDITGT+PLT    CVSFTT +SAR WL DC++  E V +AS LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +I+D S  PCG+++F+++P+                T+ LPQ  +C L+ITLP  K  +K   +  + F++         +  P    +  C    ++++ +  VA  +G  W +L   L    +EI +I +++      ++++ L  W+T      K+   + L   L  I R DIV
Sbjct:  927 WAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPAHKKAEKA--DRRQSFASLALRKRYSYLTEPSMSPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDG---KNATTDALTSVLTKINRIDIV 1516          
BLAST of Ankyrin-2 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 407/804 (50.62%), Postives = 571/804 (71.02%), Query Frame = 2
Query:  107 MVEETKDSLTEKAH------------AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKV 2482
            M EE K+   + AH            ++LRAAR+G++EK  ++++  +  ++ N NGLNA+HLA+KEG+ EVV  L++   +VD AT+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VV+ LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + A +++ TRDGL+P+HC ARSG E ++ +LL+  A I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    + NA+ALNGFTPLHIACKK + +++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L+ +GAS + T ++ E ALH+AAR+ Q E  +  L+   A   A+A+++QTPLHI+ R+G   IV+QLL  GA PN  T   YT LH+AA+EG  +++  LL+H       TKKGFTPLH+A+KYG+++VA  LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G   +HL +  G+ +++ LLL  NA+VN   ++GLT LHLAA+++R ++ E L+   A +  +T+MGYT LH   H+G I+ V  LLQ +  VNA+T  G T+LH AAQQGH  I+ +LL N    N     G TAL +A++  Y+++ +TL  V
Sbjct:    1 MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR-YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVA-SLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 801          

HSP 2 Score: 433.335 bits (1113), Expect = 3.979e-124
Identity = 233/613 (38.01%), Postives = 351/613 (57.26%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQ-TSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT-KPTQKGLNNIDEEFSN-------DLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEE-DKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  + LD+V L+  PV +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E LA R++ +  +     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH     +  + + L  + E + + E     RI RIIT   PQYF+++SR+KQ+   IG EGG ++S+    VQA FPEGAL K+I++ LQ   +    ++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y    T +LRLLCSI+G  +P  WEDITGT+PLT    CVSFTT +SAR WL DC++  E V +AS LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +I+D S  PCG+++F+++P+                T+ LPQ  +C L+ITLP  K  +K   +  + F++         +  P    +  C    ++++ +  VA  +G  W +L   L    +EI +I +++      ++++ L  W+T      K+   + L   L  I R DIV
Sbjct:  966 WAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPAHKKAEKA--DRRQSFASLALRKRYSYLTEPSMSPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDG---KNATTDALTSVLTKINRIDIV 1555          
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 402/775 (51.87%), Postives = 562/775 (72.52%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            ++LRAAR+G++EK  ++++  +  ++ N NGLNA+HLA+KEG+ EVV  L++   +VD AT+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VVK LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D+N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + A +++ TRDGL+P+HC ARSG E ++ +LL+  A I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    N NA+ALNGFTPLHIACKK + K++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L+ +GAS + T ++ E ALH+AAR+ Q E  +  L+   A   A+A+++QTPLHI+ R+G   IV+QLL  GA PN  T   YT LH++A+EG  +++  LL+H       TKKGFTPLH+A+KYG+++VA  LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G   +HL +  G+ +++ LLL  NA+VN   ++GLT LHLAA+++R ++ E L+   A +  +T+MGYT LH   H+G I+ V  LLQ +  VNA+T  G T LH AAQQGH  I+ +LL N    N     G TAL +A++  Y+++ +TL
Sbjct:   44 SYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR-YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVA-NLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 2 Score: 431.409 bits (1108), Expect = 8.325e-122
Identity = 208/501 (41.52%), Postives = 307/501 (61.28%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS-SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDE 4317
            W  + LD+V L+  P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E LA R++ +  +     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH     +  + + L  + E + + E   + RI RIIT   PQYF+++SR+KQ+   IG EGG ++S+    VQA FPEGAL K+I++ LQ   +   +++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y   T+ +LRLLCSI+G  +P  WEDITGT+PLT    CVSFTT +SAR WL DC++  E V +A+ LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +I+D S  PCG+++F+++P+                T+ LPQ  +C L+ITLP    +   +  DE
Sbjct:  965 WAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPAHKKETESDQDDE 1450          
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 407/804 (50.62%), Postives = 571/804 (71.02%), Query Frame = 2
Query:  107 MVEETKDSLTEKAH------------AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKV 2482
            M EE K+   + AH            ++LRAAR+G++EK  ++++  +  ++ N NGLNA+HLA+KEG+ EVV  L++   +VD AT+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VV+ LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + A +++ TRDGL+P+HC ARSG E ++ +LL+  A I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    + NA+ALNGFTPLHIACKK + +++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L+ +GAS + T ++ E ALH+AAR+ Q E  +  L+   A   A+A+++QTPLHI+ R+G   IV+QLL  GA PN  T   YT LH+AA+EG  +++  LL+H       TKKGFTPLH+A+KYG+++VA  LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G   +HL +  G+ +++ LLL  NA+VN   ++GLT LHLAA+++R ++ E L+   A +  +T+MGYT LH   H+G I+ V  LLQ +  VNA+T  G T+LH AAQQGH  I+ +LL N    N     G TAL +A++  Y+++ +TL  V
Sbjct:    1 MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR-YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVA-SLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 801          

HSP 2 Score: 433.335 bits (1113), Expect = 2.783e-123
Identity = 233/613 (38.01%), Postives = 351/613 (57.26%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQ-TSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT-KPTQKGLNNIDEEFSN-------DLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEE-DKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            W  + LD+V L+  PV +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E LA R++ +  +     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH     +  + + L  + E + + E     RI RIIT   PQYF+++SR+KQ+   IG EGG ++S+    VQA FPEGAL K+I++ LQ   +    ++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y    T +LRLLCSI+G  +P  WEDITGT+PLT    CVSFTT +SAR WL DC++  E V +AS LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +I+D S  PCG+++F+++P+                T+ LPQ  +C L+ITLP  K  +K   +  + F++         +  P    +  C    ++++ +  VA  +G  W +L   L    +EI +I +++      ++++ L  W+T      K+   + L   L  I R DIV
Sbjct:  966 WAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLPAHKKAEKA--DRRQSFASLALRKRYSYLTEPSMSPQSPCE---RTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDG---KNATTDALTSVLTKINRIDIV 1555          
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 401/786 (51.02%), Postives = 562/786 (71.50%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSA--------SGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKV 2482
            ++LRAAR+G++EK  ++++  +  ++ N NGLNA+HLA+KEG+ EVV  L++   +VD AT+KGNT+LHIASLAG+ EVV +L+ + AN+N +SQNGFTPLYMAAQENHL+VV+ LL+ GA+Q++ T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S         SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + A +++ TRDGL+P+HC ARSG E ++ +LL+  A I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+VLL    N NA+ALNGFTPLHIACKK + +++ELL+K+ A I + TE+GLTP+H+AAFMG   IV+ L+ +GAS + T ++ E ALH+AAR+ Q E  +  L+   A   A+A+++QTPLHI+ R+G   IV+QLL  GA PN  T   YT LH++A+EG  +++  LL+H       TKKGFTPLH+A+KYG+++VA  LLL    +P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++   L++ GA+ NA +++G   +HL +  G+ +++ LLL  NA+VN   ++GLT LHLAA+++R ++ E L+   A +  +T+MGYT LH   H+G I+ V  LLQ +  VNA+T  G T LH AAQQGH  I+ +LL N    N     G TAL +A++  Y+++ +TL  V
Sbjct:   44 SYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVR-YLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVA-SLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 826          

HSP 2 Score: 431.024 bits (1107), Expect = 7.301e-122
Identity = 208/488 (42.62%), Postives = 301/488 (61.68%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTS-SLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLP 4278
            W  + LD+V L+  PV +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E LA R++ +  +     GP+++EIPH  ++R  ERE++VL+S+NG +WKEH     +  + + L  + E + + E     RI RIIT   PQYF+++SR+KQ+   IG EGG ++S+    VQA FPEGAL K+I++ LQ   +    ++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    S  Y   T+ SLRLLCSI+G  +P  WEDITGT+PLT    CVSFTT +SAR WL DC++  E V +AS LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T   +QL      F+ENRL F  +++D S  PCG+++F+++P+                T+ LPQ  +C L+ITLP
Sbjct:  973 WAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLSELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKVRDTSQEPCGRLSFLKEPKT---------------TKGLPQTAVCNLNITLP 1445          
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 783.867 bits (2023), Expect = 0.000e+0
Identity = 420/811 (51.79%), Postives = 570/811 (70.28%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSA--------SGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            +FLRAAR+GN++KV E+L+  I  +  N NGLNA+HLAAKEG+  +VQ L+  G SVD AT+KGNT+LHIASLAG+ EVV +L++  ANIN +SQNGFTPLYMAAQENH+DVVK LLE GANQ+  T+DGFTPLAVALQQG+++ V ILL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D QS         SGFTPLHIAAHY NVNVA LL+ + A V+F A+N ITPLHVA+K G   M+KLL+ +   +++ TRDGL+P+HCAARSG + ++ +LLE GA +  ++KNGL+ L MA QGD  E  K L+     VD VT+DYLTALHVAAHCG+    ++LL    N NARALNGFTPLHIACKK + K++ELL+KY A I + TE+GLTP+H+AAFMG   IV +LL+NGAS   T ++ E ALH+AAR  Q E  + LL +  A  +ARARE QTPLHIA R+G   IV+ LL   A P+  T + YT LHI+A+EG+ +++ +LLE        TKKGFTPLH+A+KYG + VA+ LLL  +   +S G +GLTPLHVA +Y++ ++  LLL+  A+ +   KNGYTPLH+ AKKN +++   L++ GA  N  +++G TPLHL S  G+ +++ LLLD  A+++   ++GLT+LHLAA++++ ++ + L K  AD    T++GYT L  A H+G ++ V  LL++  +VNA+T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  VT      + +  +K  L+ PE M +
Sbjct:   34 SFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRN-GALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAK-LLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTE 841          

HSP 2 Score: 432.18 bits (1110), Expect = 3.634e-122
Identity = 229/571 (40.11%), Postives = 334/571 (58.49%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRII-------------HLNASTQSLD--------------------GPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGD 4431
            W  E LD+V L   P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTR+ C L ++    T+P + + E LA R+I             HL  +   L+                    GP+++EIPH AALR  ERE+VVL+S+NG SWKEH   +T+  + + L  + E + + E   + RI RIIT   PQYF+++SR+KQD   IG EGG ++S+V  QVQAVFPEGAL K+I++ LQ   +   L++K  GN    SPIVTLEPRRRKFH+ IT+T+P+P  S       +     +LRLLCSI+G  TP  WEDITGT+PLT  + CVSFTT +SAR WLIDC +  E V  AS +Y E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    +++  GN++P+T S +        F+ENRL  + +++D +  PCG+++FM++P+                T+ L  + IC L+ITLP   T++  ++ ++E   D+    +D+ E    +++KS L + EV +    D
Sbjct:  949 WGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKS---------------TRGLVHQAICNLNITLPIY-TKESESDQEQEEEIDMTSEKNDETESTETSVLKSHL-VNEVPVLASPD 1502          
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 419/811 (51.66%), Postives = 569/811 (70.16%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSA--------SGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            +FLRAAR+GN++KV E+L+  I  +  N NGLNA+HLAAKEG+  +VQ L+  G SVD AT+KGNT+LHIASLAG+ EVV +L++  ANIN +SQNGFTPLYMAAQENH+DVVK LLE GANQ+  T+DGFTPLAVALQQG+++ V ILL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D QS         SGFTPLHIAAHY NVNVA LL+ + A V+F A+N ITPLHVA+K G   M+KLL+ +   +++ TRDGL+P+HCAARSG + ++ +LLE  A +  ++KNGL+ L MA QGD  E  K L+     VD VT+DYLTALHVAAHCG+    ++LL    N NARALNGFTPLHIACKK + K++ELL+KY A I + TE+GLTP+H+AAFMG   IV +LL+NGAS   T ++ E ALH+AAR  Q E  + LL +  A  +ARARE QTPLHIA R+G   IV+ LL   A P+  T + YT LHI+A+EG+ +++ +LLE        TKKGFTPLH+A+KYG + VA+ LLL  +   +S G +GLTPLHVA +Y++ ++  LLL+  A+ +   KNGYTPLH+ AKKN +++   L++ GA  N  +++G TPLHL S  G+ +++ LLLD  A+++   ++GLT+LHLAA++++ ++ + L K  AD    T++GYT L  A H+G ++ V  LL++  +VNA+T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  VT      + +  +K  L+ PE M +
Sbjct:   34 SFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRN-GALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAK-LLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTE 841          

HSP 2 Score: 448.358 bits (1152), Expect = 2.612e-127
Identity = 216/487 (44.35%), Postives = 307/487 (63.04%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLP 4278
            W  E LD+V L   P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTR+ C L ++    T+P + + E LA R+I +  S     GP+++EIPH AALR  ERE+VVL+S+NG SWKEH   +T+  + + L  + E + + E   + RI RIIT   PQYF+++SR+KQD   IG EGG ++S+V +QVQAVFPEGAL K+I++ LQ   +   L++K  GN    SPIVTLEPRRRKFH+ IT+T+P+P  S       +     +LRLLCSI+G  TP  WEDITGT+PLT  + CVSFTT +SAR WLIDC +  E V  AS +Y E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    +++  GN++P+T S +        F+ENRL  + +++D +  PCG+++FM++P+                T+ L  + IC L+ITLP
Sbjct:  949 WGTENLDNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVAFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKS---------------TRGLVHQAICNLNITLP 1420          
BLAST of Ankyrin-2 vs. TrEMBL
Match: G7Y8Z7 (Ankyrin-2 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_103060 PE=4 SV=1)

HSP 1 Score: 889.026 bits (2296), Expect = 0.000e+0
Identity = 444/829 (53.56%), Postives = 605/829 (72.98%), Query Frame = 2
Query:  113 EETKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLI----DRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNF--DVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKK-----LILDQPEKMIDHSM 2566
            ++T+ +LTE    FLRAAR+G++ KV E L A +  ++SN  GL A+HLA+KEG  ++V+ LI  G   D  T+KGNT+LHIASLAG L+VV +LL++ AN+N +S  GFTPLYMAAQENHL VV +LL+ GANQA+TT+DGFTPLAVALQQG+++VV +LL+ DSRS+  +PALHIAA+KDDVN+ +LL+ + + NV+HQ+  GFTPLHIAAHY NVNVA+ L+++ ADVN+ AKNNITPLH+A+KWG+ EM++LLI+  A V+  TRDGL+P+HCAARSG   +  +L++ GA+   K++NGLT L M  QG+  EV   LI +G  V+  T D LT LHVA+HCGN   A +LL+N C+ NARALNGFTPLHIACKK + ++VELL++Y A I+  TE+GL+PLH+AAF+GS EIV +LL+NG  + Q TM+ E ALHLAARN Q E  + L+ H  A  +A+A+++QTPLH+AV  G+  +V  LL+AGA+PN+ T+D YTA+HIAAKEG  E+ RLLL+    P A+TKKGF PLH+A+K GRV+ ARQLL     + N+ G + LTPLH+A +YNH  ++ELLLD+ A  +C   NGYTPLH+ AK+N +++  LL+    ++  + NA+S+ GFTPLHL +  G+ +++ LLL   AD NHQ++NGLT LHLAA++N   I   LL T AD+S  T+ GY++LHTA HFGQ++ V+ LL+     D+N  T +G T LHLA QQGH  IV LLL+   D N +N+QGLT   +A++QH++ I + L  VTT   ++S  EE++     L+L QP+ M +H +
Sbjct:   11 DKTQPNLTEMDQNFLRAARAGSLAKVVELLNAGVNINLSNPIGLTALHLASKEGYVDIVEELIRRGADFDAPTKKGNTALHIASLAGHLQVVQILLDAGANVNRQSVIGFTPLYMAAQENHLAVVDLLLKRGANQALTTEDGFTPLAVALQQGHERVVALLLERDSRSRGGMPALHIAARKDDVNSVALLLNNPEVNVNHQAQHGFTPLHIAAHYGNVNVARPLLDRGADVNYQAKNNITPLHIASKWGRIEMVRLLIAAGALVDCRTRDGLTPLHCAARSGHAELASLLIDAGANPSAKTRNGLTPLHMGAQGNNEEVAHVLILRGASVEDKTGDLLTPLHVASHCGNREVARILLENRCDANARALNGFTPLHIACKKQKIRVVELLLRYGAQIDMITESGLSPLHVAAFIGSPEIVQLLLQNGTYVDQATMRSETALHLAARNRQVEVARALIFH-GATVDAKAKDDQTPLHMAVLTGHVEMVVLLLSAGANPNLTTRDAYTAMHIAAKEGHQEVIRLLLDAHADPVARTKKGFIPLHLAAKRGRVKAARQLLQIQPKSVNTAGQNNLTPLHLAAHYNHLRLVELLLDSGAEADCRAGNGYTPLHIAAKQNHLDIATLLLAHEAEQSQSGNAESRGGFTPLHLAAQEGHTDMVSLLLQHGADPNHQSKNGLTPLHLAAQENHVPIARVLLSTGADVSLVTRAGYSSLHTACHFGQLEMVRFLLEVTHATDINLPTQMGFTPLHLATQQGHSQIVSLLLEMGADGNLRNQQGLTPAHIARRQHFVTIFDILKTVTTT--VVSWEEEQEELDGTLLLQQPDFMREHPL 836          

HSP 2 Score: 559.296 bits (1440), Expect = 1.092e-163
Identity = 278/662 (41.99%), Postives = 410/662 (61.93%), Query Frame = 1
Query: 2782 ANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANR----SIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQK------GLNNIDEEFSNDLIFNPD---------DKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDIS-IVDESERKFAETIINGGDP 4707
            + ++  T     DWE+E+D+V ++++P+  GFL+SFIVDA+GG++QA R  D+R ++P N+V GP RI+C L   E   + P + D +  ACR++ +         PI+LEIPH A L +  REV+VL+SDNG +WKEH     D AVQD +    + + + +   +  + RI+T  LPQYF+LI+R++Q++  IG EGGT+ S+V ++VQ VFP GAL+KKI++ LQ+H I + L+ +  G  V +SPIVT+EPRRRKFH+ ITL +PLP  S A      +   +V + SLRLLCSISG  +PTVWEDITG+SPL+     VSFTTT+SAR+WL+DC  T E+V++AS +Y ES  VP+IG+F+V+ RR + EE Q+RCLC+TDD   KTLE QE F L+++GP VEVL++H +W+E++GN++P+  S+EQL L +  F ENRL+   R+KDL+ P  GK+AF   PR  ++   L           +PQK I  L+  +P   +           +IDE     +  +PD          +K      I + EL++  VA  VG DW +L   LG+  EE   I     T+ ++AY AL++W    +   +S  GN+L   L  IGR D+V+ C+ ++S +    ER+ A  +++  +P
Sbjct:  932 SRMFGETIQSGGDWELEVDNVNIVRKPISTGFLVSFIVDARGGMLQAQRCSDLRFFIPPNAVSGPIRIVCRLLHPERVGSPPPINDGDGFACRVLEMGPVGVRFSAPIVLEIPHYAFLTEKNREVIVLRSDNGETWKEHPLDANDQAVQDTVNGYFDYVDSADELRKRNVHRILTYDLPQYFALITRVRQELILIGPEGGTLTSNVVSEVQVVFPPGALQKKIRVGLQVHCIDQELVSRLLGARVLVSPIVTIEPRRRKFHKPITLKMPLPKSSTATGAGGLAAHSSVDSPSLRLLCSISGGTSPTVWEDITGSSPLSASKNTVSFTTTVSARLWLVDCPNTTEVVELASRVYHESLSVPYIGRFIVYGRRHHPEEAQLRCLCLTDDPIAKTLEQQEGFHLLATGPQVEVLDDHPHWIETAGNLVPVAKSEEQLQLNVRAFHENRLNMLVRVKDLTQPAVGKLAFTLHPR--AVLQSLG----------IPQKRITVLEAHVPDGLSGSISGAVLKTTDIDEVTELSMSQHPDGLVNGFGVPSQKRDFSEVIGRLELDLSNVANSVGSDWPRLATALGITAEEQKMISSSYRTDSERAYAALIIW--QDRAGIESTSGNKLAQVLHQIGRADVVQACMSNVSPVTSPDERRIALRVLDSTEP 1579          
BLAST of Ankyrin-2 vs. TrEMBL
Match: A0A4S2MA63 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002880 PE=4 SV=1)

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 444/829 (53.56%), Postives = 605/829 (72.98%), Query Frame = 2
Query:  113 EETKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLI----DRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNF--DVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKK-----LILDQPEKMIDHSM 2566
            ++T+ +LTE    FLRAAR+G++ KV E L A +  ++SN  GL A+HLA+KEG  ++V+ LI  G   D  T+KGNT+LHIASLAG L+VV +LL++ AN+N +S  GFTPLYMAAQENHL VV +LL+ GANQA+TT+DGFTPLAVALQQG+++VV +LL+ DSRS+  +PALHIAA+KDDVN+ +LL+ + + NV+HQ+  GFTPLHIAAHY NVNVA+ L+++ ADVN+ AKNNITPLH+A+KWG+ EM++LLI+  A V+  TRDGL+P+HCAARSG   +  +L++ GA+   K++NGLT L M  QG+  EV   LI +G  V+  T D LT LHVA+HCGN   A +LL+N C+ NARALNGFTPLHIACKK + ++VELL++Y A I+  TE+GL+PLH+AAF+GS EIV +LL+NG  + Q TM+ E ALHLAARN Q E  + L+ H  A  +A+A+++QTPLH+AV  G+  +V  LL+AGA+PN+ T+D YTA+HIAAKEG  E+ RLLL+    P A+TKKGF PLH+A+K GRV+ ARQLL     + N+ G + LTPLH+A +YNH  ++ELLLD+ A  +C   NGYTPLH+ AK+N +++  LL+    ++  + NA+S+ GFTPLHL +  G+ +++ LLL   AD NHQ++NGLT LHLAA++N   I   LL T AD+S  T+ GY++LHTA HFGQ++ V+ LL+     D+N  T +G T LHLA QQGH  IV LLL+   D N +N+QGLT   +A++QH++ I + L  VTT   ++S  EE++     L+L QP+ M +H +
Sbjct:   11 DKTQPNLTEMDQNFLRAARAGSLAKVVELLNAGVNINLSNPIGLTALHLASKEGYVDIVEELIRRGADFDAPTKKGNTALHIASLAGHLQVVQILLDAGANVNRQSVIGFTPLYMAAQENHLAVVDLLLKRGANQALTTEDGFTPLAVALQQGHERVVALLLERDSRSRGGMPALHIAARKDDVNSVALLLNNPEVNVNHQAQHGFTPLHIAAHYGNVNVARPLLDRGADVNYQAKNNITPLHIASKWGRIEMVRLLIAAGALVDCRTRDGLTPLHCAARSGHAELASLLIDAGANPSAKTRNGLTPLHMGAQGNNEEVAHVLILRGASVEDKTGDLLTPLHVASHCGNREVARILLENRCDANARALNGFTPLHIACKKQKIRVVELLLRYGAQIDMITESGLSPLHVAAFIGSPEIVQLLLQNGTYVDQATMRSETALHLAARNRQVEVARALIFH-GATVDAKAKDDQTPLHMAVLTGHVEMVVLLLSAGANPNLTTRDAYTAMHIAAKEGHQEVIRLLLDAHADPVARTKKGFIPLHLAAKRGRVKAARQLLQIQPKSVNTAGQNNLTPLHLAAHYNHLRLVELLLDSGAEADCRAGNGYTPLHIAAKQNHLDIATLLLAHEAEQSQSGNAESRGGFTPLHLAAQEGHTDMVSLLLQHGADPNHQSKNGLTPLHLAAQENHVPIARVLLSTGADVSLVTRAGYSSLHTACHFGQLEMVRFLLEITHATDINLPTQMGFTPLHLATQQGHSQIVSLLLEMGADGNLRNQQGLTPAHIARRQHFVTIFDILKTVTTT--VVSWEEEQEELDGTLLLQQPDFMREHPL 836          

HSP 2 Score: 558.14 bits (1437), Expect = 2.407e-163
Identity = 280/667 (41.98%), Postives = 412/667 (61.77%), Query Frame = 1
Query: 2782 ANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANR----SIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLN-----------NIDEEFSNDLIFNPD---------DKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDIS-IVDESERKFAETIINGGDP 4707
            + ++  T     DWE+E+D+V ++++P+  GFL+SFIVDA+GG++QA R  D+R ++P N+V GP RI+C L   E   + P + D +  ACR++ +         PI+LEIPH A L +  REV+VL+SDNG +WKEH     D AVQD +    + + + +   +  + RI+T  LPQYF+LI+R+KQ++  IG EGGT+ S+V ++VQ VFP GAL+KKI++ LQ+H I + L+ +  G  V +SPIVT+EPRRRKFH+ ITL +PLP  + A      +   +V + SLRLLCSISG  +PTVWEDITG+SPL+     VSFTTT+SAR+WL+DC  T E+V++AS +Y ES  VP+IG+F+V+ RR + EE Q+RCLC+TDD   KTLE QE F L+++GP VEVL++H +W+E++GN++P+  S+EQL L +  F ENRL+   R+KDL+ P  GK+AF   PR  ++   L           +PQK I  L+  +P      GL+           +IDE     +  +PD          +K      I + EL++  VA  VG DW +L   LG+  EE   I     T+ ++AY AL++W    +   +S  GN+L   L  IGR D+V+ C+ ++S +    ER+ A  +++  +P
Sbjct:  946 SRMFGETIQSGGDWELEVDNVNIVRKPISTGFLVSFIVDARGGMLQAQRCSDLRFFIPPNAVSGPIRIVCRLLHPERVGSPPPINDGDGFACRVLEMGPVGVRFSAPIVLEIPHYAFLTEKNREVIVLRSDNGETWKEHPLDANDQAVQDTVNGYFDYVDSADELRKRSVHRILTYDLPQYFALITRVKQELILIGPEGGTLTSNVVSEVQVVFPPGALQKKIRVGLQVHCIDQELVSRLLGARVLVSPIVTIEPRRRKFHKPITLKMPLPKSNTATGAGGLAAHSSVDSPSLRLLCSISGGTSPTVWEDITGSSPLSASKNMVSFTTTVSARLWLVDCPNTTEVVELASRVYHESLSVPYIGRFIVYGRRHHPEEAQLRCLCLTDDPIAKTLEQQEGFHLLATGPQVEVLDDHPHWIETAGNLVPVAKSEEQLQLNVRAFHENRLNMLVRVKDLTQPAVGKLAFTLHPR--AVLQSLG----------IPQKRITVLEAHVP-----DGLSGSISGAVLRTTDIDEVTELSMSQHPDGLVNGFGVPSQKGDFSEVIGRLELDLSNVANSVGSDWPRLATVLGLSAEEQKMISSSYRTDSERAYAALIIW--QDRAGIESTTGNKLAQVLHQIGRADVVQACMSNVSPVTSPDERRIALRVLDSTEP 1593          
BLAST of Ankyrin-2 vs. TrEMBL
Match: A0A4S2M3X3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002880 PE=4 SV=1)

HSP 1 Score: 888.256 bits (2294), Expect = 0.000e+0
Identity = 444/829 (53.56%), Postives = 605/829 (72.98%), Query Frame = 2
Query:  113 EETKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLI----DRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNF--DVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKK-----LILDQPEKMIDHSM 2566
            ++T+ +LTE    FLRAAR+G++ KV E L A +  ++SN  GL A+HLA+KEG  ++V+ LI  G   D  T+KGNT+LHIASLAG L+VV +LL++ AN+N +S  GFTPLYMAAQENHL VV +LL+ GANQA+TT+DGFTPLAVALQQG+++VV +LL+ DSRS+  +PALHIAA+KDDVN+ +LL+ + + NV+HQ+  GFTPLHIAAHY NVNVA+ L+++ ADVN+ AKNNITPLH+A+KWG+ EM++LLI+  A V+  TRDGL+P+HCAARSG   +  +L++ GA+   K++NGLT L M  QG+  EV   LI +G  V+  T D LT LHVA+HCGN   A +LL+N C+ NARALNGFTPLHIACKK + ++VELL++Y A I+  TE+GL+PLH+AAF+GS EIV +LL+NG  + Q TM+ E ALHLAARN Q E  + L+ H  A  +A+A+++QTPLH+AV  G+  +V  LL+AGA+PN+ T+D YTA+HIAAKEG  E+ RLLL+    P A+TKKGF PLH+A+K GRV+ ARQLL     + N+ G + LTPLH+A +YNH  ++ELLLD+ A  +C   NGYTPLH+ AK+N +++  LL+    ++  + NA+S+ GFTPLHL +  G+ +++ LLL   AD NHQ++NGLT LHLAA++N   I   LL T AD+S  T+ GY++LHTA HFGQ++ V+ LL+     D+N  T +G T LHLA QQGH  IV LLL+   D N +N+QGLT   +A++QH++ I + L  VTT   ++S  EE++     L+L QP+ M +H +
Sbjct:   11 DKTQPNLTEMDQNFLRAARAGSLAKVVELLNAGVNINLSNPIGLTALHLASKEGYVDIVEELIRRGADFDAPTKKGNTALHIASLAGHLQVVQILLDAGANVNRQSVIGFTPLYMAAQENHLAVVDLLLKRGANQALTTEDGFTPLAVALQQGHERVVALLLERDSRSRGGMPALHIAARKDDVNSVALLLNNPEVNVNHQAQHGFTPLHIAAHYGNVNVARPLLDRGADVNYQAKNNITPLHIASKWGRIEMVRLLIAAGALVDCRTRDGLTPLHCAARSGHAELASLLIDAGANPSAKTRNGLTPLHMGAQGNNEEVAHVLILRGASVEDKTGDLLTPLHVASHCGNREVARILLENRCDANARALNGFTPLHIACKKQKIRVVELLLRYGAQIDMITESGLSPLHVAAFIGSPEIVQLLLQNGTYVDQATMRSETALHLAARNRQVEVARALIFH-GATVDAKAKDDQTPLHMAVLTGHVEMVVLLLSAGANPNLTTRDAYTAMHIAAKEGHQEVIRLLLDAHADPVARTKKGFIPLHLAAKRGRVKAARQLLQIQPKSVNTAGQNNLTPLHLAAHYNHLRLVELLLDSGAEADCRAGNGYTPLHIAAKQNHLDIATLLLAHEAEQSQSGNAESRGGFTPLHLAAQEGHTDMVSLLLQHGADPNHQSKNGLTPLHLAAQENHVPIARVLLSTGADVSLVTRAGYSSLHTACHFGQLEMVRFLLEITHATDINLPTQMGFTPLHLATQQGHSQIVSLLLEMGADGNLRNQQGLTPAHIARRQHFVTIFDILKTVTTT--VVSWEEEQEELDGTLLLQQPDFMREHPL 836          

HSP 2 Score: 559.296 bits (1440), Expect = 5.090e-163
Identity = 280/667 (41.98%), Postives = 412/667 (61.77%), Query Frame = 1
Query: 2782 ANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANR----SIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLN-----------NIDEEFSNDLIFNPD---------DKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDIS-IVDESERKFAETIINGGDP 4707
            + ++  T     DWE+E+D+V ++++P+  GFL+SFIVDA+GG++QA R  D+R ++P N+V GP RI+C L   E   + P + D +  ACR++ +         PI+LEIPH A L +  REV+VL+SDNG +WKEH     D AVQD +    + + + +   +  + RI+T  LPQYF+LI+R+KQ++  IG EGGT+ S+V ++VQ VFP GAL+KKI++ LQ+H I + L+ +  G  V +SPIVT+EPRRRKFH+ ITL +PLP  + A      +   +V + SLRLLCSISG  +PTVWEDITG+SPL+     VSFTTT+SAR+WL+DC  T E+V++AS +Y ES  VP+IG+F+V+ RR + EE Q+RCLC+TDD   KTLE QE F L+++GP VEVL++H +W+E++GN++P+  S+EQL L +  F ENRL+   R+KDL+ P  GK+AF   PR  ++   L           +PQK I  L+  +P      GL+           +IDE     +  +PD          +K      I + EL++  VA  VG DW +L   LG+  EE   I     T+ ++AY AL++W    +   +S  GN+L   L  IGR D+V+ C+ ++S +    ER+ A  +++  +P
Sbjct:  932 SRMFGETIQSGGDWELEVDNVNIVRKPISTGFLVSFIVDARGGMLQAQRCSDLRFFIPPNAVSGPIRIVCRLLHPERVGSPPPINDGDGFACRVLEMGPVGVRFSAPIVLEIPHYAFLTEKNREVIVLRSDNGETWKEHPLDANDQAVQDTVNGYFDYVDSADELRKRSVHRILTYDLPQYFALITRVKQELILIGPEGGTLTSNVVSEVQVVFPPGALQKKIRVGLQVHCIDQELVSRLLGARVLVSPIVTIEPRRRKFHKPITLKMPLPKSNTATGAGGLAAHSSVDSPSLRLLCSISGGTSPTVWEDITGSSPLSASKNMVSFTTTVSARLWLVDCPNTTEVVELASRVYHESLSVPYIGRFIVYGRRHHPEEAQLRCLCLTDDPIAKTLEQQEGFHLLATGPQVEVLDDHPHWIETAGNLVPVAKSEEQLQLNVRAFHENRLNMLVRVKDLTQPAVGKLAFTLHPR--AVLQSLG----------IPQKRITVLEAHVP-----DGLSGSISGAVLRTTDIDEVTELSMSQHPDGLVNGFGVPSQKGDFSEVIGRLELDLSNVANSVGSDWPRLATVLGLSAEEQKMISSSYRTDSERAYAALIIW--QDRAGIESTTGNKLAQVLHQIGRADVVQACMSNVSPVTSPDERRIALRVLDSTEP 1579          
BLAST of Ankyrin-2 vs. TrEMBL
Match: A0A4S2M3V6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002880 PE=4 SV=1)

HSP 1 Score: 887.871 bits (2293), Expect = 0.000e+0
Identity = 444/829 (53.56%), Postives = 605/829 (72.98%), Query Frame = 2
Query:  113 EETKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLI----DRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNF--DVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKK-----LILDQPEKMIDHSM 2566
            ++T+ +LTE    FLRAAR+G++ KV E L A +  ++SN  GL A+HLA+KEG  ++V+ LI  G   D  T+KGNT+LHIASLAG L+VV +LL++ AN+N +S  GFTPLYMAAQENHL VV +LL+ GANQA+TT+DGFTPLAVALQQG+++VV +LL+ DSRS+  +PALHIAA+KDDVN+ +LL+ + + NV+HQ+  GFTPLHIAAHY NVNVA+ L+++ ADVN+ AKNNITPLH+A+KWG+ EM++LLI+  A V+  TRDGL+P+HCAARSG   +  +L++ GA+   K++NGLT L M  QG+  EV   LI +G  V+  T D LT LHVA+HCGN   A +LL+N C+ NARALNGFTPLHIACKK + ++VELL++Y A I+  TE+GL+PLH+AAF+GS EIV +LL+NG  + Q TM+ E ALHLAARN Q E  + L+ H  A  +A+A+++QTPLH+AV  G+  +V  LL+AGA+PN+ T+D YTA+HIAAKEG  E+ RLLL+    P A+TKKGF PLH+A+K GRV+ ARQLL     + N+ G + LTPLH+A +YNH  ++ELLLD+ A  +C   NGYTPLH+ AK+N +++  LL+    ++  + NA+S+ GFTPLHL +  G+ +++ LLL   AD NHQ++NGLT LHLAA++N   I   LL T AD+S  T+ GY++LHTA HFGQ++ V+ LL+     D+N  T +G T LHLA QQGH  IV LLL+   D N +N+QGLT   +A++QH++ I + L  VTT   ++S  EE++     L+L QP+ M +H +
Sbjct:   11 DKTQPNLTEMDQNFLRAARAGSLAKVVELLNAGVNINLSNPIGLTALHLASKEGYVDIVEELIRRGADFDAPTKKGNTALHIASLAGHLQVVQILLDAGANVNRQSVIGFTPLYMAAQENHLAVVDLLLKRGANQALTTEDGFTPLAVALQQGHERVVALLLERDSRSRGGMPALHIAARKDDVNSVALLLNNPEVNVNHQAQHGFTPLHIAAHYGNVNVARPLLDRGADVNYQAKNNITPLHIASKWGRIEMVRLLIAAGALVDCRTRDGLTPLHCAARSGHAELASLLIDAGANPSAKTRNGLTPLHMGAQGNNEEVAHVLILRGASVEDKTGDLLTPLHVASHCGNREVARILLENRCDANARALNGFTPLHIACKKQKIRVVELLLRYGAQIDMITESGLSPLHVAAFIGSPEIVQLLLQNGTYVDQATMRSETALHLAARNRQVEVARALIFH-GATVDAKAKDDQTPLHMAVLTGHVEMVVLLLSAGANPNLTTRDAYTAMHIAAKEGHQEVIRLLLDAHADPVARTKKGFIPLHLAAKRGRVKAARQLLQIQPKSVNTAGQNNLTPLHLAAHYNHLRLVELLLDSGAEADCRAGNGYTPLHIAAKQNHLDIATLLLAHEAEQSQSGNAESRGGFTPLHLAAQEGHTDMVSLLLQHGADPNHQSKNGLTPLHLAAQENHVPIARVLLSTGADVSLVTRAGYSSLHTACHFGQLEMVRFLLEITHATDINLPTQMGFTPLHLATQQGHSQIVSLLLEMGADGNLRNQQGLTPAHIARRQHFVTIFDILKTVTTT--VVSWEEEQEELDGTLLLQQPDFMREHPL 836          

HSP 2 Score: 558.14 bits (1437), Expect = 1.139e-163
Identity = 280/667 (41.98%), Postives = 412/667 (61.77%), Query Frame = 1
Query: 2782 ANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANR----SIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLN-----------NIDEEFSNDLIFNPD---------DKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDIS-IVDESERKFAETIINGGDP 4707
            + ++  T     DWE+E+D+V ++++P+  GFL+SFIVDA+GG++QA R  D+R ++P N+V GP RI+C L   E   + P + D +  ACR++ +         PI+LEIPH A L +  REV+VL+SDNG +WKEH     D AVQD +    + + + +   +  + RI+T  LPQYF+LI+R+KQ++  IG EGGT+ S+V ++VQ VFP GAL+KKI++ LQ+H I + L+ +  G  V +SPIVT+EPRRRKFH+ ITL +PLP  + A      +   +V + SLRLLCSISG  +PTVWEDITG+SPL+     VSFTTT+SAR+WL+DC  T E+V++AS +Y ES  VP+IG+F+V+ RR + EE Q+RCLC+TDD   KTLE QE F L+++GP VEVL++H +W+E++GN++P+  S+EQL L +  F ENRL+   R+KDL+ P  GK+AF   PR  ++   L           +PQK I  L+  +P      GL+           +IDE     +  +PD          +K      I + EL++  VA  VG DW +L   LG+  EE   I     T+ ++AY AL++W    +   +S  GN+L   L  IGR D+V+ C+ ++S +    ER+ A  +++  +P
Sbjct:  932 SRMFGETIQSGGDWELEVDNVNIVRKPISTGFLVSFIVDARGGMLQAQRCSDLRFFIPPNAVSGPIRIVCRLLHPERVGSPPPINDGDGFACRVLEMGPVGVRFSAPIVLEIPHYAFLTEKNREVIVLRSDNGETWKEHPLDANDQAVQDTVNGYFDYVDSADELRKRSVHRILTYDLPQYFALITRVKQELILIGPEGGTLTSNVVSEVQVVFPPGALQKKIRVGLQVHCIDQELVSRLLGARVLVSPIVTIEPRRRKFHKPITLKMPLPKSNTATGAGGLAAHSSVDSPSLRLLCSISGGTSPTVWEDITGSSPLSASKNMVSFTTTVSARLWLVDCPNTTEVVELASRVYHESLSVPYIGRFIVYGRRHHPEEAQLRCLCLTDDPIAKTLEQQEGFHLLATGPQVEVLDDHPHWIETAGNLVPVAKSEEQLQLNVRAFHENRLNMLVRVKDLTQPAVGKLAFTLHPR--AVLQSLG----------IPQKRITVLEAHVP-----DGLSGSISGAVLRTTDIDEVTELSMSQHPDGLVNGFGVPSQKGDFSEVIGRLELDLSNVANSVGSDWPRLATVLGLSAEEQKMISSSYRTDSERAYAALIIW--QDRAGIESTTGNKLAQVLHQIGRADVVQACMSNVSPVTSPDERRIALRVLDSTEP 1579          
BLAST of Ankyrin-2 vs. TrEMBL
Match: A0A4S2M4H4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002880 PE=4 SV=1)

HSP 1 Score: 887.871 bits (2293), Expect = 0.000e+0
Identity = 444/829 (53.56%), Postives = 605/829 (72.98%), Query Frame = 2
Query:  113 EETKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLI----DRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNF--DVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKK-----LILDQPEKMIDHSM 2566
            ++T+ +LTE    FLRAAR+G++ KV E L A +  ++SN  GL A+HLA+KEG  ++V+ LI  G   D  T+KGNT+LHIASLAG L+VV +LL++ AN+N +S  GFTPLYMAAQENHL VV +LL+ GANQA+TT+DGFTPLAVALQQG+++VV +LL+ DSRS+  +PALHIAA+KDDVN+ +LL+ + + NV+HQ+  GFTPLHIAAHY NVNVA+ L+++ ADVN+ AKNNITPLH+A+KWG+ EM++LLI+  A V+  TRDGL+P+HCAARSG   +  +L++ GA+   K++NGLT L M  QG+  EV   LI +G  V+  T D LT LHVA+HCGN   A +LL+N C+ NARALNGFTPLHIACKK + ++VELL++Y A I+  TE+GL+PLH+AAF+GS EIV +LL+NG  + Q TM+ E ALHLAARN Q E  + L+ H  A  +A+A+++QTPLH+AV  G+  +V  LL+AGA+PN+ T+D YTA+HIAAKEG  E+ RLLL+    P A+TKKGF PLH+A+K GRV+ ARQLL     + N+ G + LTPLH+A +YNH  ++ELLLD+ A  +C   NGYTPLH+ AK+N +++  LL+    ++  + NA+S+ GFTPLHL +  G+ +++ LLL   AD NHQ++NGLT LHLAA++N   I   LL T AD+S  T+ GY++LHTA HFGQ++ V+ LL+     D+N  T +G T LHLA QQGH  IV LLL+   D N +N+QGLT   +A++QH++ I + L  VTT   ++S  EE++     L+L QP+ M +H +
Sbjct:   11 DKTQPNLTEMDQNFLRAARAGSLAKVVELLNAGVNINLSNPIGLTALHLASKEGYVDIVEELIRRGADFDAPTKKGNTALHIASLAGHLQVVQILLDAGANVNRQSVIGFTPLYMAAQENHLAVVDLLLKRGANQALTTEDGFTPLAVALQQGHERVVALLLERDSRSRGGMPALHIAARKDDVNSVALLLNNPEVNVNHQAQHGFTPLHIAAHYGNVNVARPLLDRGADVNYQAKNNITPLHIASKWGRIEMVRLLIAAGALVDCRTRDGLTPLHCAARSGHAELASLLIDAGANPSAKTRNGLTPLHMGAQGNNEEVAHVLILRGASVEDKTGDLLTPLHVASHCGNREVARILLENRCDANARALNGFTPLHIACKKQKIRVVELLLRYGAQIDMITESGLSPLHVAAFIGSPEIVQLLLQNGTYVDQATMRSETALHLAARNRQVEVARALIFH-GATVDAKAKDDQTPLHMAVLTGHVEMVVLLLSAGANPNLTTRDAYTAMHIAAKEGHQEVIRLLLDAHADPVARTKKGFIPLHLAAKRGRVKAARQLLQIQPKSVNTAGQNNLTPLHLAAHYNHLRLVELLLDSGAEADCRAGNGYTPLHIAAKQNHLDIATLLLAHEAEQSQSGNAESRGGFTPLHLAAQEGHTDMVSLLLQHGADPNHQSKNGLTPLHLAAQENHVPIARVLLSTGADVSLVTRAGYSSLHTACHFGQLEMVRFLLEITHATDINLPTQMGFTPLHLATQQGHSQIVSLLLEMGADGNLRNQQGLTPAHIARRQHFVTIFDILKTVTTT--VVSWEEEQEELDGTLLLQQPDFMREHPL 836          

HSP 2 Score: 557.755 bits (1436), Expect = 1.488e-163
Identity = 280/667 (41.98%), Postives = 412/667 (61.77%), Query Frame = 1
Query: 2782 ANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANR----SIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLN-----------NIDEEFSNDLIFNPD---------DKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDIS-IVDESERKFAETIINGGDP 4707
            + ++  T     DWE+E+D+V ++++P+  GFL+SFIVDA+GG++QA R  D+R ++P N+V GP RI+C L   E   + P + D +  ACR++ +         PI+LEIPH A L +  REV+VL+SDNG +WKEH     D AVQD +    + + + +   +  + RI+T  LPQYF+LI+R+KQ++  IG EGGT+ S+V ++VQ VFP GAL+KKI++ LQ+H I + L+ +  G  V +SPIVT+EPRRRKFH+ ITL +PLP  + A      +   +V + SLRLLCSISG  +PTVWEDITG+SPL+     VSFTTT+SAR+WL+DC  T E+V++AS +Y ES  VP+IG+F+V+ RR + EE Q+RCLC+TDD   KTLE QE F L+++GP VEVL++H +W+E++GN++P+  S+EQL L +  F ENRL+   R+KDL+ P  GK+AF   PR  ++   L           +PQK I  L+  +P      GL+           +IDE     +  +PD          +K      I + EL++  VA  VG DW +L   LG+  EE   I     T+ ++AY AL++W    +   +S  GN+L   L  IGR D+V+ C+ ++S +    ER+ A  +++  +P
Sbjct:  932 SRMFGETIQSGGDWELEVDNVNIVRKPISTGFLVSFIVDARGGMLQAQRCSDLRFFIPPNAVSGPIRIVCRLLHPERVGSPPPINDGDGFACRVLEMGPVGVRFSAPIVLEIPHYAFLTEKNREVIVLRSDNGETWKEHPLDANDQAVQDTVNGYFDYVDSADELRKRSVHRILTYDLPQYFALITRVKQELILIGPEGGTLTSNVVSEVQVVFPPGALQKKIRVGLQVHCIDQELVSRLLGARVLVSPIVTIEPRRRKFHKPITLKMPLPKSNTATGAGGLAAHSSVDSPSLRLLCSISGGTSPTVWEDITGSSPLSASKNMVSFTTTVSARLWLVDCPNTTEVVELASRVYHESLSVPYIGRFIVYGRRHHPEEAQLRCLCLTDDPIAKTLEQQEGFHLLATGPQVEVLDDHPHWIETAGNLVPVAKSEEQLQLNVRAFHENRLNMLVRVKDLTQPAVGKLAFTLHPR--AVLQSLG----------IPQKRITVLEAHVP-----DGLSGSISGAVLRTTDIDEVTELSMSQHPDGLVNGFGVPSQKGDFSEVIGRLELDLSNVANSVGSDWPRLATVLGLSAEEQKMISSSYRTDSERAYAALIIW--QDRAGIESTTGNKLAQVLHQIGRADVVQACMSNVSPVTSPDERRIALRVLDSTEP 1579          
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 408/801 (50.94%), Postives = 567/801 (70.79%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKM 2551
            ++LRAAR+GN+EK  ++L+  +  ++ N NGLNA+HLA+KEG+ EVV  L++ G SVD AT+KGNT+LHIASLAG+ +VV  L+ + AN+N +SQNGFTPLYMAAQENHL+VV+ LLE+GA+Q+I T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVAAK G   M+KLL+ + A +++ T+DGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+V++    N NA+ALNGFTPLHIACKK + K++ELL+K+ A + + TE+GLTP+H+AAFMG + IV  L  +GAS + T ++ E ALH+AAR  Q +  + LL +  A  + +A+++QT LHIA R+G   IV+ LL  GA  +  T   YT LH+A +EG  E + LLLEH     A TKKGFTPLH+A+KYG+++ A+ LLL  +  P++ G  GLTPLHVA +Y++  +  LLLD  A+ +   KNGYTPLH+ AKKN +E+   L++ GA  NA +++G +PLHL +  G+ +++ LLL  NA+VN   +NGLT LHLAA+++R  + E LL   A++   T+ GYT LH A H+G ++ V  LL+    +N++T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  +T      +    +K  L+ PE M
Sbjct:   46 SYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQN-GAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAK-LLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDENLTATPPVSEKHKLNVPETM 843          

HSP 2 Score: 403.675 bits (1036), Expect = 4.592e-115
Identity = 212/616 (34.42%), Postives = 336/616 (54.55%), Query Frame = 1
Query: 2851 IQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALG---NLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLP-----NWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSND---------------LIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            +  P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E L  R++ +  +     GP+++EIPH  ++R  ERE++VL+SDNG +WKEH     D   +D L     + E + +     + RI RI+T   PQYF+++SR+KQ+   +G EGG + S     V+A FP GAL KKI++ LQ   +   +++   GN  + SPIVT+EPRRRKFH+ IT+T+P+P       ++  +  P       LRLLCSI+G  +P  WEDITGT+PL+    CVSFTT +SAR WL DC + +E V +A+ LY E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENFE ++    +E+LE    +++  GN+ P + S +QL      F+ENRL F  +++D+    CG+++F+ +P+                ++ LP   IC L+ TLPT   +   +  DE  + D                + +P    +  C    +++L +  VA  +G  W +L   +    +EI  I  ++  +   ++++ L  W++      K+   + L   L  + R DIV
Sbjct:  963 VSSPIHSGFLVSFMVDARGGSMRGSRHDGMRIIIPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIVLRSDNGDTWKEH---HYDCRGEDLLALLNGMDEELDSPIELEKKRICRIVTKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVRAAFPPGALTKKIRVGLQAQPVPEEVVRNVIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRAKEAAANGRKGDP----APCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQVSETVALATPLYRELICVPYLAKFVVFAKPTDPMEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIYVDCYGNLAPFSKSSQQLIFTFYAFKENRLPFNVKVRDVGQEACGRLSFLREPKS---------------SKGLPHSAICNLNFTLPTHRKEMESDPDDENDNKDRRHTFASFALRKRYSYLTDPSSSPQSPCE---RTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDG---KNATTDALTAGLTKVNRMDIV 1550          

HSP 3 Score: 260.766 bits (665), Expect = 1.317e-69
Identity = 182/557 (32.68%), Postives = 282/557 (50.63%), Query Frame = 2
Query: 1010 KSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTT--------------------MKCEN---------ALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVAR--------------------------------QLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPE 2497
            KS +  + L+ A  G+  E     +  G+D++    + L ALH+A+  G++     LLK   +V+A    G T LHIA    Q+ +V  L+   A++N+ ++ G TPL++AA     E+V  LL++GAS S  T                    +  EN         ALH+AAR +  ++   LLL  + N +  ++   TPLHIA   GN ++   LLN GA  + + +++ T LH+AAK G   + +LLL+   K DAKTK G TPLH  ++ G  QV                                  QLLL   V  + + +  LT LHVA +  HY++ ++++D +AN N    NG+TPLH+  KKN ++V +LL+  GA++ A ++ G TP+H+ +  G++ I++ L    A  N     G TALH+AA   + D+V  LL+  A +  K +   TALH A   G+ + V++LLQK    +A T  G T LHLA ++GH     LLL++   ++   K+G T L VA K   +  A+ L +    P+
Sbjct:   40 KSDSNASYLRAARAGN-LEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKS-AALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPD 594          
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 408/809 (50.43%), Postives = 567/809 (70.09%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSA--------SGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKM 2551
            ++LRAAR+GN+EK  ++L+  +  ++ N NGLNA+HLA+KEG+ EVV  L++ G SVD AT+KGNT+LHIASLAG+ +VV  L+ + AN+N +SQNGFTPLYMAAQENHL+VV+ LLE+GA+Q+I T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D +S         SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVAAK G   M+KLL+ + A +++ T+DGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+V++    N NA+ALNGFTPLHIACKK + K++ELL+K+ A + + TE+GLTP+H+AAFMG + IV  L  +GAS + T ++ E ALH+AAR  Q +  + LL +  A  + +A+++QT LHIA R+G   IV+ LL  GA  +  T   YT LH+A +EG  E + LLLEH     A TKKGFTPLH+A+KYG+++ A+ LLL  +  P++ G  GLTPLHVA +Y++  +  LLLD  A+ +   KNGYTPLH+ AKKN +E+   L++ GA  NA +++G +PLHL +  G+ +++ LLL  NA+VN   +NGLT LHLAA+++R  + E LL   A++   T+ GYT LH A H+G ++ V  LL+    +N++T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  +T      +    +K  L+ PE M
Sbjct:   10 SYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQN-GAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAK-LLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDENLTATPPVSEKHKLNVPETM 815          

HSP 2 Score: 403.675 bits (1036), Expect = 1.165e-114
Identity = 212/612 (34.64%), Postives = 335/612 (54.74%), Query Frame = 1
Query: 2851 IQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALG---NLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLP-NWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSND---------------LIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            +  P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E L  R++ +  +     GP+++EIPH  ++R  ERE++VL+SDNG +WKEH     D   +D L     + E + +     + RI RI+T   PQYF+++SR+KQ+   +G EGG + S     V+A FP GAL KKI++ LQ   +   +++   GN  + SPIVT+EPRRRKFH+ IT+T+P+P    +A  +         LRLLCSI+G  +P  WEDITGT+PL+    CVSFTT +SAR WL DC + +E V +A+ LY E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENFE ++    +E+LE    +++  GN+ P + S +QL      F+ENRL F  +++D+    CG+++F+ +P+                ++ LP   IC L+ TLPT   +   +  DE  + D                + +P    +  C    +++L +  VA  +G  W +L   +    +EI  I  ++  +   ++++ L  W++      K+   + L   L  + R DIV
Sbjct:  946 VSSPIHSGFLVSFMVDARGGSMRGSRHDGMRIIIPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIVLRSDNGDTWKEH---HYDCRGEDLLALLNGMDEELDSPIELEKKRICRIVTKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVRAAFPPGALTKKIRVGLQAQPVPEEVVRNVIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRAKEAAANGRKGDPAPCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQVSETVALATPLYRELICVPYLAKFVVFAKPTDPMEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIYVDCYGNLAPFSKSSQQLIFTFYAFKENRLPFNVKVRDVGQEACGRLSFLREPKS---------------SKGLPHSAICNLNFTLPTHRKEMESDPDDENDNKDRRHTFASFALRKRYSYLTDPSSSPQSPCE---RTDLRMAIVADHLGLSWTELAREMNFSVDEINHIRTENPNSLTAQSFMLLKKWVSRDG---KNATTDALTAGLTKVNRMDIV 1533          
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Match: ENSAMXT00000017800.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21012912:21225385:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000017800.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 422/806 (52.36%), Postives = 566/806 (70.22%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNN-ITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARAL--NGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            +FLRAAR+GN++KV E+L+  +    SN NGLNA+HLAAKEG+ ++VQ L+E G SVD AT+KGNT+LHIASLAG+ EVV +L++  A+IN +SQNGFTPLYMA+QENHLDVV+ LLE G NQ+  T+DGFTPLA+ALQQG+++VV ILL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D QS SGFTPLHIAAHY NVNVA LL+ + A V+F A+ N ITPLHVA+K G   M++LL+ + + +++ TRDGL+P+HCAARSG +  + +LLE GA I  ++KNGL+ L MA QGD  E  K L+     VD VT+DYLTALHVAAHCG+    ++LL    N NARAL  NGFTPLHIACKK + K++ELL+KY A I + TE+GLTP+H+AAFMG   IV +LL+NGAS   + ++ E ALH+AAR  Q E  + LL +  A  +ARARE+QTPLHIA R+G   IV+ LL   A P+  T + YT LHI+A+EG+ +++ +LLE        TKKGFTPLH+ASKYG + VA+ LLL  +  P+S G +GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +E+   L+   A  N  +++G TPLHL S  G+ ++  LLL   A VN   ++GLTALHLAA+++R  + E L+K  A +  +T++GYT L  A H+G  + V  LL+ N  VNA+T  G T LH AAQQG+  I+ +LL      N     G TAL +A++  Y+++ +TL  V       + +  +K  L+ PE M +
Sbjct:   35 SFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRN-GAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAK-LLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLGYTPLIVACHYGNAKMVNFLLKSNASVNAKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTLRVVAEEIITTTTTVTEKHKLNVPETMTE 837          

HSP 2 Score: 406.371 bits (1043), Expect = 7.814e-115
Identity = 215/519 (41.43%), Postives = 305/519 (58.77%), Query Frame = 1
Query: 2821 WEME-LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRII------------HLNASTQSLDG-------------------PILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT 4281
            W  E LD++ L   PV + FL+SF+VDA+GG M+  RH  +RI +P      PTR+ C L ++    T+P + + E LA R+I            HL  +   L+                    P+++EIPH AALR  ERE+V+L+S+ G SWKEH   +T+  +   L  + E +   E   R RI RIIT   PQYF+++SR+KQD   IG EGG ++S+V  QVQAVFPEGAL K+I++ LQ  ++  ++++K  GN    SPIVTLEPRRRKFH+ IT+T+P+P  S       +   T +LRLLCSI+G  TP  WEDITGT+PLT  + CVSFTT +SA  WLIDC +  E V  A+ +Y E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    + +  GN++P+T S +        F+ENRL+ + +I+D +  PCG+++FM++PR                 + L    IC L+ITLPT
Sbjct:  906 WGTENLDNIALSSSPVHS-FLVSFMVDARGGAMRGCRHNGLRIIIPPRKCGAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLPVIVEIPHFAALRGKERELVILRSETGESWKEHHCEYTEEELNQILNGMDE-LDPPEELERKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGILSSTVVPQVQAVFPEGALTKRIRVGLQAQSVNMDVVRKILGNKATFSPIVTLEPRRRKFHKPITMTIPIPKSSTDPVLNGFGGDTPTLRLLCSITG-TTPAQWEDITGTTPLTFINDCVSFTTNVSA-FWLIDCRQAQESVNFATQVYREIICVPYMAKFVVFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFFAFKENRLALFIKIRDNTQEPCGRLSFMKEPRS---------------YRSLAHNAICNLNITLPT 1405          

HSP 3 Score: 250.751 bits (639), Expect = 3.243e-66
Identity = 179/561 (31.91%), Postives = 287/561 (51.16%), Query Frame = 2
Query: 1010 KSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTT--------------------MKCEN---------ALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDN-YTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSA----------KVNPNSLGHHG-----------------------LTPLHVATYYNHYEMIELLLDTEANVN--CLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPE 2497
            KS +  + L+ A  G+  +V + L   G+D+     + L ALH+AA  G+++  + LL+   +V++    G T LHIA    Q+++V++L+K  A IN+ ++ G TPL++A+     ++V  LL+NG + S  T                    +  EN         ALH+AAR +  ++   LLL  + N + +++   TPLHIA   GN ++   LLN GA  +   + N  T LH+A+K G   + RLLL+   + DAKT+ G TPLH A++ G    A +LLL             ++P  +   G                       LT LHVA +  HY + +LLLD  AN N   L +NG+TPLH+  KKN ++V +LL+  GA++ A ++ G TP+H+ +  G+  I+ LLL   A  +     G TALH+AA   + ++V  LL+  A +  + +   T LH A   G+ + V++LLQ     +A T  G T LH++A++G + +  +LL+     +   K+G T L VA K   L++A+ L +    P+
Sbjct:   29 KSDSNTSFLRAARAGNIDKVLEYL-KGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKS-AALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGH-DTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPD 586          
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 390/765 (50.98%), Postives = 553/765 (72.29%), Query Frame = 2
Query:  179 VEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            +EK  ++L++ +  ++ N NGLNA+HLA+KEG+ EVV  LI+ G +VD AT+KGNT+LHIASLAG+ +VV  L+ + AN+N +SQNGFTPLYMAAQENHLDVV+ LL+ G++Q+I T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVA+K G   M+KLL+ + A +++ T+DGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L++  + VD VT DYLTALHVAAHCG+   A+V++    N NA+ALNGFTPLHIACKK + K++ELL+K+ A I + TE+GLTP+H+AAFMG + IV  L+ +GAS + T ++ E ALH+AAR  Q E  K L+ +  A  +A+++++QTPLHI+ R+G   I++QLL  GA P+  T   YT LH+AA+EG  +++ +LL+        TKKGFTPLH+A+KYG+++VA  LLL  +  P++ G  GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +E+   L++ GA+ NA +++G +PLHL S  GN +++ LL+  +A +N   ++GLT LHLAA++++ ++ E L+   A +  +T+MGYT LH A H+G ++ V  LL+    VNA+T +       AAQQGH  I+ LLL +    N     G TAL +A++  Y+++ +TL
Sbjct:    1 LEKALDYLKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQN-GAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVA-NLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKV------TAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          

HSP 2 Score: 423.32 bits (1087), Expect = 1.571e-121
Identity = 228/606 (37.62%), Postives = 349/606 (57.59%), Query Frame = 1
Query: 2833 LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTV-QTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT-KPTQK-----GLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            LD+V L+  P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++    + P + + E LA R++ +  +     GP+++EIPH  ++R  ERE+++L+S+NG +WKEH       A+ + L  + E +++ E   + RI RIIT   PQYF+++SR+KQ+   +G EGG ++S     VQA FPEGAL KKI++ LQ   +    ++K  GN    SPIVT+EPRRRKFH+ IT+T+P+P  S    +  Y    T  LRLLCSI+G  +P  WEDITGT+PLT  + CVSFTT +SAR WL DC++  + V +A+ LY E   VP++ +F+VF +  +  E  +RC C+TDD  +KTLE QENFE ++    +EVLE    +++  GN+ P+T + +QL L    F+ENRL F  +I+D S  PCG+++F+          EL  + G      +PQ  +C L+ITLP  K T+K        ++        +  P    +  C    +++L +  VA  +G  W +L   +    +EI  I +++  +   ++++ L  W+       K+   + L  +L  I R DIV
Sbjct:  890 LDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLASPPPMVEGEGLASRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIILRSENGETWKEHQYDCRTEALNELLNGMDEELESLEELEKKRICRIITKDFPQYFAVVSRIKQESNQMGPEGGVLSSMTVPHVQASFPEGALTKKIRVGLQAQPVPDETVKKILGNRATFSPIVTVEPRRRKFHKPITMTIPVPPLSGEGVTNGYKGDSTPCLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLADCHQIPDTVGLATQLYRELICVPYMAKFVVFAKMNDPVESNLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLTPLTKAGQQLLLNFYAFKENRLPFCVKIRDNSQEPCGRLSFLR---------ELKTSKG------IPQTAVCNLNITLPALKKTEKPERRHTFASLALRKRYSYLTEPGMSPQSPCE---RTDLRMAIVADHLGLSWTELAREMDFSVDEINHIRVENPNSLTTQSFMLLKKWVNRDG---KNATTDVLTAALTKINRMDIV 1474          

HSP 3 Score: 319.701 bits (818), Expect = 5.923e-88
Identity = 216/640 (33.75%), Postives = 329/640 (51.41%), Query Frame = 2
Query:  161 AARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLL-LSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELL 2077
            AAR  + +     LQ D   D+ + +G   +H+AA  GN  V  LL+  G +VD   R   T LH+AS  G   +V LLLE  A I+ K+++G TPL+  A+  H  VV++LL+ GA     T +G +PL +A Q  +   VQ+L             LH     DDV    L                 T LH+AAH  +  VAK++++K A+ N  A N  TPLH+A K  + ++++LL+   A++ +VT  GL+PIH AA  G ENI+  L+ +GA     +  G TAL MA +  Q EV K L+  G  VDA + D  T LH+++  G     + LL++    ++   +G+TPLH+A ++    +  +L+   A +  TT+ G TPLH+AA  G  E+ N+LL+  A    +       LH+AA  + ++   +LLL   A+ +A A+   TPLHIA +     I   LL  GAD N +T+   + LH+A++EG  ++  LL+      +   K G TPLH+A++  +V VA  L+   A V+P +    G TPLHVA +Y + +M+  LL  +A VN   K         A++    +  LL+  GA  N  +  G T L +    G   +++ L
Sbjct:  156 AARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL-------------LHHEVPVDDVTNDYL-----------------TALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKV-ALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPET--KMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKV------TAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 401/798 (50.25%), Postives = 555/798 (69.55%), Query Frame = 2
Query:  182 EKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSA--------SGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKM 2551
            EK  ++L+  +  ++ N NGLNA+HLA+KEG+ EVV  L++ G SVD AT+KGNT+LHIASLAG+ +VV  L+ + AN+N +SQNGFTPLYMAAQENHL+VV+ LLE+GA+Q+I T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D +S         SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVAAK G   M+KLL+ + A +++ T+DGL+P+HC ARSG E ++ +LL+ GA I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A+V++    N NA+ALNGFTPLHIACKK + K++ELL+K+ A + + TE+GLTP+H+AAFMG + IV  L  +GAS + T ++ E ALH+AAR  Q +  +  LL   A  + +A+++QT LHIA R+G   IV+ LL  GA  +  T   YT LH+A +EG  E + LLLEH     A TKKGFTPLH+A+KYG+++ A+ LLL  +  P++ G  GLTPLHVA +Y++  +  LLLD  A+ +   KNGYTPLH+ AKKN +E+   L++ GA  NA +++G +PLHL +  G+ +++ LLL  NA+VN   +NGLT LHLAA+++R  + E LL   A++   T+ GYT LH A H+G ++ V  LL+    +N++T  G T LH AAQQGH  I+ +LL +    N     G TAL +A++  Y+++ +TL  +T      +    +K  L+ PE M
Sbjct:    1 EKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVR-YLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAK-LLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDENLTATPPVSEKHKLNVPETM 795          

HSP 2 Score: 390.963 bits (1003), Expect = 7.990e-110
Identity = 187/477 (39.20%), Postives = 282/477 (59.12%), Query Frame = 1
Query: 2875 FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALG---NLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLP-----NWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT 4281
            FL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++      P + + E L  R++ +  +     GP+++EIPH  ++R  ERE++VL+SDNG +WKEH     D   +D L     + E + +     + RI RI+T   PQYF+++SR+KQ+   +G EGG + S     V+A FP GAL KKI++ LQ   +   +++   GN  + SPIVT+EPRRRKFH+ IT+T+P+P       ++  +  P       LRLLCSI+G  +P  WEDITGT+PL+    CVSFTT +SAR WL DC + +E V +A+ LY E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENFE ++    +E+LE    +++  GN+ P + S +QL      F+ENRL F  +++D+    CG+++F+ +P+                ++ LP   IC L+ TLPT
Sbjct:  929 FLVSFMVDARGGSMRGSRHDGMRIIIPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIVLRSDNGDTWKEH---HYDCRGEDLLALLNGMDEELDSPIELEKKRICRIVTKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVRAAFPPGALTKKIRVGLQAQPVPEEVVRNVIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRAKEAAANGRKGDPAPC----LRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQVSETVALATPLYRELICVPYLAKFVVFAKPTDPMEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIYVDCYGNLAPFSKSSQQLIFTFYAFKENRLPFNVKVRDVGQEACGRLSFLREPKS---------------SKGLPHSAICNLNFTLPT 1383          

HSP 3 Score: 340.502 bits (872), Expect = 6.597e-94
Identity = 226/659 (34.29%), Postives = 345/659 (52.35%), Query Frame = 2
Query:  161 AARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHL 2137
            AA  GN+      L      D    N +  +H+AAK GN  +V+LL++ G  +D  T+ G T LH  + +G  +VV +LL+  A I  K++NG +PL+MA Q +HL+ V++LL++       T+D  T L VA   G+ KV ++++D                KK + NA +L              +GFTPLHIA   N V V +LL++  A +    ++ +TP+HVAA  G E ++K L    A+ N+    G + +H AAR+G  +++  LL+NGA +  K+K+  TAL +A++  +AE+ + L+ KG    A T    T LH+A   G+   A +LL++  +++A    GFTPLH+A K  Q +  +LL++ +A  ++  +TGLTPLH+AA   ++ +  +LL +GAS           LH+AA+ NQ E     LL   A  NA  R+  +PLH+A + G+  +V  LL   A+ NM  K+  T LH+AA+E R  ++ +LL H  + DA TK G+TPLH+A  YG +++    LL  +   NS    G TPLH A    H  +I +LL   A+ N L  NG T L +  +   I V   L  RG  +  ++     P+         E M   LD + D    A  G T  +L
Sbjct:  196 AAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVD----------------KKANPNAKAL--------------NGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLE-IGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMV-SFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL--RG--LTDENLTATPPVSEKHKLNVPETMNEFLDMSDDEGEDAMTGETEKYL 818          

HSP 4 Score: 274.248 bits (700), Expect = 1.857e-73
Identity = 182/525 (34.67%), Postives = 291/525 (55.43%), Query Frame = 2
Query:  116 ETKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNA-NGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSR---SKVR-LPALHIAAK--KDDV------NAASLLIGSSDDNV------------------------DHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQL 1579
            +TKD LT   H     ARSG+ E+V E L     P +S   NGL+ +H+A +  +   VQLL+++ + VD  T    T+LH+A+  G  +V  ++++ KAN N K+ NGFTPL++A ++N + V+++LL++GA+    T+ G TP+ VA   G++ +V+ L  + +    + VR   ALH+AA+  + DV      N A + I + DD                             + SG+TPLH+A    +   A LL+E  A ++   K   TPLHVAAK+G+ E  KLL+ ++A  ++  + GL+P+H AA    + + L+LL++GA     +KNG T L +A + +Q E+  TL+  G + +AVT   ++ LH+AA  G+++   +LL  N NVN    NG TPLH+A ++ +  + E+L+ + A +++ T+TG TPLH+A   G+ ++V+ LL+N A I+  T      LH AA+        +LL H  A+ N       T L IA R+G  S+V+ L
Sbjct:  251 KTKDGLT-PLHC---GARSGH-EQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQH-RASANELTLNGNTALSIARRLGYISVVDTL 769          
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 799.66 bits (2064), Expect = 0.000e+0
Identity = 417/809 (51.55%), Postives = 572/809 (70.70%), Query Frame = 2
Query:  134 TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLS-AKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            ++ A +FLRAAR+GN+E++ + L+  +  +  N NGLNA+HLA+KEG+ +VV  L++    +D AT+ GNT+LHIA+LAG+ ++V +L+E  ANIN +SQNGFTPLYMAAQENHL++VK LL+ GANQ++ T+DGFTPLAVALQQG+++VV +LL++D++ KVRLPALHIAA+KDD NAA+LL+   + N D  S SGFTPLHIAAHY N+NVA LL+   A V+F A+N ITPLHVAAK G   M+KLL+ + A +++ TRDGL+P+HCAARSG E +I +LLE  A I  K+KNGL+ L MATQG+     + L+ +   VD VT+DYLT LHVAAHCG+   A++LL      NARALNGFTPLHIACKK + K++ELL+K+ A I++TTE+GLTP+H+A+FMG   +V +LL+NGAS + T ++ E  LH+A+R  Q E  K  LL   A    +ARE+QTPLHIA R+G   IV+ LL  G+DPN  T    T L+ A++EG  +++ LLLE+       TKKGFTPLHIASKYGR++VA  LL   A  +P   G +GLTPLHVAT+Y+H ++  LLLD  A+ +   KNGYTPLH+ AKKN +EV K+L++ GA  N  +Q+G  PLHL +  G+ +++ LLL  +A ++   + GLTA+HLAA++++ ++ E L K +AD++T T++ YT LH A H+G I+ V  LL+    VNA+T  G T LH AAQQGH  +V  LL +E   N     G TAL +A++  Y+++ +TLS +T  P     +  +K  L+ PE M D
Sbjct:    9 SDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLL-QHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKT-LLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLSILTEEPVTGVNTVIEKHKLNVPETMND 815          
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 791.571 bits (2043), Expect = 0.000e+0
Identity = 414/815 (50.80%), Postives = 573/815 (70.31%), Query Frame = 2
Query:  134 TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIG-------SSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            ++ A +FLRAAR+GN+E++ + L+  +  +  N NGLNA+HLA+KEG+ +VV  L++    +D AT+ GNT+LHIA+LAG+ ++V +L+E  ANIN +SQNGFTPLYMAAQENHL++VK LL+ GANQ++ T+DGFTPLAVALQQG+++VV +LL++D++ KVRLPALHIAA+KDD NAA+LL+        +S   ++  + SGFTPLHIAAHY N+NVA LL+   A V+F A+N ITPLHVAAK G   M+KLL+ + A +++ TRDGL+P+HCAARSG E +I +LLE  A I  K+KNGL+ L MATQG+     + L+ +   VD VT+DYLT LHVAAHCG+   A++LL      NARALNGFTPLHIACKK + K++ELL+K+ A I++TTE+GLTP+H+A+FMG   +V +LL+NGAS + T ++ E  LH+A+R  Q E  K  LL   A    +ARE+QTPLHIA R+G   IV+ LL  G+DPN  T    T L+ A++EG  +++ LLLE+       TKKGFTPLHIASKYGR++VA  LLL    + +  G +GLTPLHVAT+Y+H ++  LLLD  A+ +   KNGYTPLH+ AKKN +EV K+L++ GA  N  +Q+G  PLHL +  G+ +++ LLL  +A ++   + GLTA+HLAA++++ ++ E L K +AD++T T++ YT LH A H+G I+ V  LL+    VNA+T  G T LH AAQQGH  +V  LL +E   N     G TAL +A++  Y+++ +TLS +T  P     +  +K  L+ PE M D
Sbjct:    8 SDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKT-LLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVA-TLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLSILTEEPVTGVNTVIEKHKLNVPETMND 820          
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 504.982 bits (1299), Expect = 1.322e-153
Identity = 261/523 (49.90%), Postives = 358/523 (68.45%), Query Frame = 2
Query:  917 RDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVT 2485
            +DGL+P+HCAARSG E ++ ILLE GA I  K+KNGL+ L MATQGD  E  + L+     VD +T+DYLTALHVAAHCG+   A+VLL    N N RALNGFTPLHIACKK + +++ELL+KY A I + TE+GLTP+H++AFMG+  IV ILL+ GAS + T ++ E ALH+AAR  Q E  + LL +  A  +A+ARE QTPLHIA R+G   IV+ LL   A P+  T + YT LH+AA+EG  +++ +LLEH       TKKGFTPLH+ASKYG+++VA  LLL    +P++ G +GLTPLHVA++Y++ ++  LLLD  A+ +   KNGYTPLH+ AKK+ +E+   L++ GA  NA +++G  PLHL +  G+ ++  LLL   ADVNH  ++GL+ LHLAA++++ ++ E L+K  A ++  T++GYT L  A H+G I+ V  LLQ   DVN++T  G T LH AAQQGH  IV LLL      N     G TAL +A++  Y+++ +TL  VT
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRN-GAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVA-SLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVT 524          

HSP 2 Score: 305.449 bits (781), Expect = 4.832e-85
Identity = 185/517 (35.78%), Postives = 289/517 (55.90%), Query Frame = 2
Query:  725 GFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKML 2275
            G TPLH AA   +  V ++L+E+ A +    KN ++PLH+A +    E +++L+  +A V+ +T D L+ +H AA  G      +LL+ GA+   ++ NG T L +A + ++  V + L+  G  ++AVT   LT +HV+A  GN+N   +LL+   + NA  + G T LH+A +  Q+++V  L++  A +++      TPLHIAA +G  EIV +LL++ AS    T      LH+AAR   E+   ILL H  A+     ++  TPLH+A + G   +   LL   A P+   K+  T LH+A+     +++ LLL+    P A  K G+TPLHIA+K  ++++A   LL      N++   G+ PLH+     H ++  LLL   A+VN   K+G +PLHL A+++ + V ++L+  GA+VNA ++ G+TPL +    GN +++  LL   ADVN + +NG T LH AA++  T IV  LLK  A  +  T  G TAL  A   G I  V  L
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEH-GASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIA-TTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 3 Score: 296.975 bits (759), Expect = 3.011e-82
Identity = 194/540 (35.93%), Postives = 295/540 (54.63%), Query Frame = 2
Query:  161 AARSGNVEKVKEFLQADIKPDMSNA-NGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQL 1777
            AARSG+ E+V E L     P ++   NGL+ +H+A +  + E VQ+L++    VD  T    T+LH+A+  G      +LL+  AN NV++ NGFTPL++A ++N + V+++LL+YGA+    T+ G TP+ V+   GN  +V ILL                             G+S +  +     G T LH+AA      V + L+   A V+  A+   TPLH+AA+ GK E+++LL+   A+ ++ T +G +P+H AAR G E++  ILLE+GA +   +K G T L +A++  + EV   L+ +    DA   + LT LHVA+H  N   A +LL    + +A A NG+TPLHIA KK Q ++   L++Y A  N+ T  G+ PLH+ A  G  ++ ++LL   A ++  T    + LHLAA+ ++    +IL+ H  A+ NA  +   TPL +A   GN  +V  LL  GAD N  TK+ YT LH AA++G   I  LLL+   +P+  T  G T L IA + G + V   L
Sbjct:   13 AARSGH-EQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQG---------------------------GASPNATN---VRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKH-GAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 4 Score: 296.975 bits (759), Expect = 3.261e-82
Identity = 188/549 (34.24%), Postives = 298/549 (54.28%), Query Frame = 2
Query:  431 QNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELL 2077
            Q+G TPL+ AA+  H  VV++LLE GA     T +G +PL +A Q  + + VQ+L+      + R P        DD+             +D+      T LH+AAH  +   AK+L++K A+ N  A N  TPLH+A K  +  +++LL+   A++ +VT  GL+P+H +A  G  NI+LILL+ GA     +  G TAL MA +  Q EV ++L+  G  VDA   +  T LH+AA  G +   ++LL++  + +A   NG+TPLH+A ++    +  +L+++ A +  TT+ G TPLH+A+  G  E+ ++LL+  AS           LH+A+  + ++   +LLL   A+ +A A+   TPLHIA +     I   LL  GA+ N +T+     LH+ A+EG  +++ LLL      +  TK G +PLH+A++  +V VA ++L+    + N+    G TPL VA +Y + +M+  LL   A+VN   KNGYTPLH  A++    +  LL+  GA  N  +  G T L +    G   +++ L
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLM------QYRAPV-------DDI------------TLDY-----LTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKV-ALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVA-EILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 5 Score: 277.33 bits (708), Expect = 5.492e-76
Identity = 186/560 (33.21%), Postives = 301/560 (53.75%), Query Frame = 2
Query:  533 DGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQL-LKTEADISTKT 2209
            DG TPL  A + G+++VV+ILL+  +          I AK                     + +G +PLH+A   ++V   ++L++  A V+    + +T LHVAA  G     K+L+ + AN N    +G +P+H A +     ++ +LL+ GA I+  +++GLT + ++       +   L+  G   +A  +   TALH+AA  G       LL+N   V+A+A    TPLHIA +  + ++V+LL+++ A  ++ T  G TPLH+AA  G +++  ILL++GAS++ TT K    LH+A++  + E    LLL   A+ +A  +   TPLH+A    N  +   LL+ GA P+   K+ YT LHIAAK+ + EI+  LLE+  + +A T++G  PLH+ ++ G   VA  LLL+   + N     GL+PLH+A   +   + E+L+   A+VN   K GYTPL +      I++   L+  GA+VN++++ G+TPLH  +  G+  I+ LLL   A  N    NG TAL +A       +V+ L + TE  I++ T
Sbjct:    5 DGLTPLHCAARSGHEQVVEILLEQGAP---------ILAK---------------------TKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVAS-LLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVA-SLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTT 532          

HSP 6 Score: 187.578 bits (475), Expect = 5.719e-48
Identity = 107/295 (36.27%), Postives = 166/295 (56.27%), Query Frame = 2
Query: 1613 KDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPE 2497
            +D  T LH AA+ G  ++  +LLE      AKTK G +PLH+A++   V+   Q+L+  +   + +    LT LHVA +  HY   ++LLD  AN N    NG+TPLH+  KKN I V +LL+  GA++ A ++ G TP+H+++  GN  I+ +LL   A  N     G TALH+AA   +T++V  LL+  A +  K +   T LH A   G+++ V++LLQ     +A T+ G T LH+AA++GH  +  +LL++   +    K+G T L VA K   + +A  L +    P+
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECV-QVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPD 297          

HSP 7 Score: 187.193 bits (474), Expect = 6.783e-48
Identity = 102/298 (34.23%), Postives = 165/298 (55.37%), Query Frame = 1
Query: 3655 LCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERM-CRTIVKSELN-----IREVALKV------GGDWKKLTINLGMGQEEITRIDLQSGTEED 4512
            L +++G   P  WEDITGT+PLT    CVSFTT +SAR WLIDC +T+E V   + +Y E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    ++E  GN++P+T + +Q +L    F+ENRL F  +I+D +   CG++ FM+D +                 + LPQ  +C L+I LP  P +K  ++           +P+ ++E + C +I+K+ L      I +++L+V        D   L + +   +E++ ++    GT+ D
Sbjct:  959 LMTLTGGTAPAQWEDITGTTPLTFTKQCVSFTTNVSARFWLIDCRQTHEAVNFTTQMYRELVCVPYMAKFVVFAKTHDPVEARLRCFCMTDDKVDKTLEQQENFSEMARSRDVEVLEGKPIYVECFGNLVPLTKAGQQHALSFYAFRENRLPFMVKIRDSNQEACGRLCFMKDAKT---------------ARGLPQAAVCNLNIMLP--PYKKETDS-----------DPEPEEEAVSCTSIIKNILKSPQCQIVKISLRVKLPLLSSEDRHALLLEVAEMKEDLLKVTALLGTDSD 1228          

HSP 8 Score: 108.997 bits (271), Expect = 5.942e-24
Identity = 58/155 (37.42%), Postives = 82/155 (52.90%), Query Frame = 1
Query: 2833 LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKE----LYPTL-----------------------------PLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEH 3198
            LD+V L   P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTR+ C L ++     L P L                             P L D E+L  RI+ L     +  GP+++EIPH A+LR  ERE+VVL+S+NG +W+EH
Sbjct:  668 LDNVALSSSPIHSGFLVSFMVDARGGSMRGCRHHGLRIVIPPRKCMAPTRVTCRLVKRHRLAALPPVLEGEGLASRVVEVGPSGGQFLGKLHLPNTPPPLNDGESLVSRILQLGPPGTTFLGPVIVEIPHFASLRGKERELVVLRSENGETWREH 822          

HSP 9 Score: 92.0485 bits (227), Expect = 1.000e-18
Identity = 51/153 (33.33%), Postives = 85/153 (55.56%), Query Frame = 2
Query: 2003 AQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNI 2461
            A  Q G TPLH  + +G+++++E+LL+  A +  + +NGL+ LH+A + +  + V+ L++  A +   T    TALH A H G  +T K+LL K  + N +   G T LH+A ++  I ++ LLL     +    + GLT + V+     LNI
Sbjct:    1 AHRQDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNI 153          
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 399.438 bits (1025), Expect = 1.787e-118
Identity = 210/436 (48.17%), Postives = 294/436 (67.43%), Query Frame = 2
Query: 1178 LLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVT 2485
            LL    N N RALNGFTPLHIACKK + +++ELL+KY A I + TE+GLTP+H++AFMG+  IV ILL+ GAS + T ++ E ALH+AAR  Q E  + LL +  A  +A+ARE QTPLHIA R+G   IV+ LL   A P+  T + YT LH+AA+EG  +++ +LLEH       TKKGFTPLH+ASKYG+++VA  LLL    +P++ G +GLTPLHVA++Y++ ++  LLLD  A+ +   KNGYTPLH+ AKK+ +E+   L++ GA  NA +++G  PLHL +  G+ ++  LLL   ADVNH  ++GL+ LHLAA++++ ++ E L+K  A ++  T++GYT L  A H+G I+ V  LLQ   DVN++T  G T LH AAQQGH  IV LLL      N     G TAL +A++  Y+++ +TL  VT
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRN-GAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVA-SLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVT 434          

HSP 2 Score: 265.774 bits (678), Expect = 2.502e-73
Identity = 162/439 (36.90%), Postives = 243/439 (55.35%), Query Frame = 2
Query:  161 AARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKIL 1477
            +A  GN+  V   LQ    P+ +N  G  A+H+AA+ G  EVV+ L+ NG  VD   R+  T LHIA+  GKLE+V LLL+  A+ +  + NG+TPL++AA+E H DV  +LLE+GA+ A+TT  GFTPL VA + G  +V  +LL        R  +   A K                       +G TPLH+A+HY+N  VA LL+++ A  +  AKN  TPLH+AAK  + E+   L+   A  N++TR G++P+H  A+ G  ++  +LL   AD+ H +K+GL+ L +A Q D+  V + L+  G  V+A T    T L VA H GNI     LL++  +VN++  NG+TPLH A ++  + +V LL+K  A  N  T  G T L IA  +G   +V+ L      +++ T+      + ++RN  E   ++L
Sbjct:   55 SAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQ-------RFASPDAAGK-----------------------NGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL----KVVTEETITSTTVSNPSSRNVPETMTEVL 459          

HSP 3 Score: 242.276 bits (617), Expect = 1.198e-65
Identity = 150/457 (32.82%), Postives = 253/457 (55.36%), Query Frame = 2
Query:  296 LIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDN----DSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEG 1654
            L++ G + ++    G T LHIA    ++ V+ LLL+  A+I   +++G TP++++A   +L++V +LL+ GA+   T   G T L +A + G  +VV+ LL N    D++++     LHIAA+   +    LL+     + D  +++G+TPLH+AA   + +V  +L+E  A +    K   TPLHVA+K+GK E+  LL+ + A+ ++  ++GL+P+H A+    + + L+LL+ GA     +KNG T L +A + DQ E+  TL+  G + +A+T   +  LH+ A  G+ + A +LL    +VN    +G +PLH+A ++ +  + E+L+K+ AH+N+TT+ G TPL +A   G+ ++VN LL++GA +                                  N++ +   TPLH A + G+  IV  LL  GA PN VT +  TAL IA + G
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLL-QHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADV----------------------------------NSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLG 422          

HSP 4 Score: 184.496 bits (467), Expect = 2.145e-47
Identity = 85/208 (40.87%), Postives = 125/208 (60.10%), Query Frame = 1
Query: 3655 LCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLP 4278
            L +++G   P  WEDITGT+PLT    CVSFTT +SAR WLIDC +T+E V   + +Y E   VP++ +F+VF +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    ++E  GN++P+T + +Q +L    F+ENRL F  +I+D +   CG++ FM+D +                 + LPQ  +C L+I LP
Sbjct:  835 LMTLTGGTAPAQWEDITGTTPLTFTKQCVSFTTNVSARFWLIDCRQTHEAVNFTTQMYRELVCVPYMAKFVVFAKTHDPVEARLRCFCMTDDKVDKTLEQQENFSEMARSRDVEVLEGKPIYVECFGNLVPLTKAGQQHALSFYAFRENRLPFMVKIRDSNQEACGRLCFMKDAKT---------------ARGLPQAAVCNLNIMLP 1027          

HSP 5 Score: 123.25 bits (308), Expect = 2.507e-28
Identity = 54/122 (44.26%), Postives = 80/122 (65.57%), Query Frame = 1
Query: 2833 LDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEH 3198
            LD+V L   P+ +GFL+SF+VDA+GG M+  RH  +RI +P      PTR+ C L ++     LP + + E LA R++ +  S     GP+++EIPH A+LR  ERE+VVL+S+NG +W+EH
Sbjct:  577 LDNVALSSSPIHSGFLVSFMVDARGGSMRGCRHHGLRIVIPPRKCMAPTRVTCRLVKRHRLAALPPVLEGEGLASRVVEVGPSGGQFLGPVIVEIPHFASLRGKERELVVLRSENGETWREH 698          
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006531.1 (pep scaffold:Pmarinus_7.0:GL477280:1359:33855:1 gene:ENSPMAG00000005898.1 transcript:ENSPMAT00000006531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 359.762 bits (922), Expect = 1.113e-100
Identity = 186/436 (42.66%), Postives = 273/436 (62.61%), Query Frame = 1
Query: 3010 LYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDA-------------NRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLP 4278
            L  T P L + E+L  R++ L     S  GP+L+EIPH A+LR  ERE+VVL+S +G +WKEH N   +  + D L  + E + + E   R RI RI+T   PQYF+++SR++Q+   +G EGG ++ +V   V+A FP+GAL K+IK+ LQ H +  ++++K  GN  A SPIVT+EPRRRKFH+ IT+T+P+P  + A             + ++P T     LRLLCSI+G  +P  WEDITGT+PLTI    VSFTT +SAR WL+ C +  E V +A+ LY+E+  VP++  F+VF +     E ++RC C+TDD  +KTLE QENF  ++    VEV+E    ++E  GN++P+T S +Q S     F+ENRL FY +++D++  PCG++ FM+DP+                T+ LPQ+ IC+L+IT+P
Sbjct:    4 LPSTPPPLNEGESLVSRLLQLGPEGTSFIGPVLVEIPHFASLRGRERELVVLRSGDGKTWKEHQNDCKNDDLNDVLNGMDEELDSLEELERKRICRIVTRDFPQYFAVVSRVRQESEVVGPEGGVLSCTVVPDVRASFPQGALTKRIKVGLQAHPVPEDMVRKVLGNKAAFSPIVTVEPRRRKFHKPITMTIPVPQSTSAITAASADTRVNGFSETVPDT--PPPLRLLCSITGGISPAHWEDITGTTPLTITTSTVSFTTNVSARFWLLYCRQPPEAVNLANRLYQEATCVPYLATFVVFSKAVEAVESRLRCFCMTDDRVDKTLEQQENFTEVARSRDVEVMEGKPIYVECFGNLVPLTKSGQQHSFNFYAFKENRLPFYVKVRDVTQEPCGRLCFMKDPKT---------------TRGLPQQAICSLNITIP 422          
BLAST of Ankyrin-2 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 80.1073 bits (196), Expect = 5.028e-17
Identity = 55/155 (35.48%), Postives = 81/155 (52.26%), Query Frame = 2
Query:  152 FLRAARSGNVEKVKEFLQADIKPDMSNA--NGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLE-SKANINVKSQNGFTPLYMAAQENHLDVVKVLLE-YGANQAITTDDGFTPLAVALQQGNDKVVQILLDN 604
            F  A   GN+E VK      +KPD++     G+  +HLA  +   EV Q LIENG SV I  +     LH A+  G L+++ LL    K+ +N + + G+TPL+ A  E H D   +L+E YGA   +  + G     VAL   N++V +  L+N
Sbjct:   76 FHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVAL---NEQVKKFFLNN 227          

HSP 2 Score: 74.3294 bits (181), Expect = 5.022e-15
Identity = 67/224 (29.91%), Postives = 104/224 (46.43%), Query Frame = 2
Query: 1829 PLHVATYYNHYEMIELLLDTEANVNCLYKN--GYTPLHLVAKKNMIEVTKLLIDRGANVNAQS---QKGFTPLHLNSMAGNKEIMELLLDA--NADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKML--LQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDN---EIDV--NHQNKQGLTALEVAQKQHYLN 2458
            PLH A   N +  ++ LL ++ ++  L K+  G  PLH        E+T  L+ +  NVN        G+TP H+    GN E+++ L D     D+N     G+T LHLA  K   ++ + L++  A +  K +     LH A   G ++ +++L  L K+  VN Q   G T L  A  +GH     LL++    E D+  N   K    AL    K+ +LN
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSL-LLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKS-AVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLN 226          

HSP 3 Score: 70.8626 bits (172), Expect = 7.915e-14
Identity = 53/176 (30.11%), Postives = 88/176 (50.00%), Query Frame = 2
Query: 1529 PLHIAVRMGNYSIVEQLLNAGADPNMV---TKDNYTALHIAAKEGRHEISRLLL---EHQCKPDAKTKKGFTPLHIASKYGRVQVARQLL-LSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGAN-VNAQSQKGFTPL 2032
            PLH A     +  V++LL++   P+++    +D    LH +     HEI+  LL   E+    D     G+TP HIA   G ++V + L     K + N + + G+T LH+A     +E+ + L++  A+V    K    PLH  A    +++ +LL   G + VN Q ++G+TPL
Sbjct:    5 PLHQACMENEFFKVQELLHS--KPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPL 178          

HSP 4 Score: 63.1586 bits (152), Expect = 3.306e-11
Identity = 49/182 (26.92%), Postives = 87/182 (47.80%), Query Frame = 2
Query:   86 EFFRIFQMVEETKDSLTEK---AHAFLRAARSGNVEKVKEFLQADIK----PDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDI--ATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTD-DGFTPLAVALQQGNDKVVQILLD 601
            EFF++ +++      L +K       L  + S    ++  FL + ++     D  + +G    H+A   GN EVV+ L +  L  D+   T +G T LH+A      EV   L+E+ A++ +K +    PL+ AA    L ++++L   G +     D  G+TPL  AL +G+     +L++
Sbjct:   14 EFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          

HSP 5 Score: 62.3882 bits (150), Expect = 7.123e-11
Identity = 47/158 (29.75%), Postives = 76/158 (48.10%), Query Frame = 2
Query: 1706 KTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGH---HGLTPLHVATYYNHYEMIELLLDT--EANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLD-ANADVNHQAENGLTALHLAAEKNRTD 2161
            K + G  PLH +  +   ++    LLS   N N   +    G TP H+A    + E+++ L D   + ++N +   G T LHL   K   EV++ LI+ GA+V  + +    PLH  +  G+ +++ELL     + VN Q + G T L  A  +   D
Sbjct:   32 KDQDGRIPLHWSVSFQAHEIT-SFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGD 188          

HSP 6 Score: 60.4622 bits (145), Expect = 2.563e-10
Identity = 61/221 (27.60%), Postives = 92/221 (41.63%), Query Frame = 2
Query:  341 NTSLHIASLAGKLEVVSLLLESKANINV-KSQNGFTPLYMAAQENHLDVVKVLLEYGAN---QAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLIS-QKANVNSVTRDGLSPIHCAARSGFENIILILLE 988
            N  LH A +  +   V  LL SK ++ + K Q+G  PL+ +      ++   LL    N        D G+TP  +A   GN +VV+ L D                 K D+N  +                G T LH+A       V++ LIE  A V    K N  PLH AA  G  ++++LL    K+ VN   + G +P+  A   G  +  ++L+E
Sbjct:    3 NYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDR--------------PLKPDLNKIT--------------NQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          

HSP 7 Score: 59.3066 bits (142), Expect = 6.397e-10
Identity = 60/222 (27.03%), Postives = 92/222 (41.44%), Query Frame = 2
Query: 1229 PLHIACKKIQS-KMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADP--NMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLD 1885
            PLH AC + +  K+ ELL    + +    + G  PLH +    + EI + LL           K EN        N ++       +P+ +         TP HIA  +GN  +V+ L +    P  N +T    T LH+A  +   E+S+ L+E+      K K    PLH A+  G +++   L    K   N     G TPL  A    H +   LL++
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLS----------KMENV-------NLDD-------YPDDS-------GWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          

HSP 8 Score: 53.1434 bits (126), Expect = 8.938e-8
Identity = 43/159 (27.04%), Postives = 65/159 (40.88%), Query Frame = 2
Query: 1217 NGFTPLHIACKKIQSKMVELLI--KYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADP-NMVTKDNYTALHIAAKEGRHEISRLLLE 1684
            +G+TP HIAC     ++V+ L     K  +N  T  G+T LH+A      E+   L++NGAS+                                    + + NQ PLH A  +G+  ++E L   G    N   K  +T L  A  EG  + + LL+E
Sbjct:   71 SGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASV----------------------------------RIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          
BLAST of Ankyrin-2 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 75.0998 bits (183), Expect = 7.107e-14
Identity = 94/349 (26.93%), Postives = 152/349 (43.55%), Query Frame = 2
Query:  230 NANGLNAMHLAAKEGNREVVQLLIENG-LSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGF--TPLYMAAQENHLDVVKVLLEYGANQAITTDDG---FTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLT-ALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKI 1255
            ++ G   + +A  +G  +VV+ +IE G   ++     GNT+LH A+L G +E+V LL+E+ A++N+KS   F  TPL  A+   HLDVVK LL+ GA+  I    G   F  +    +  +++  +IL +   R       L IAAKK   N A +         + +S +G    H        N  K   EK AD    A N      +  K  +EE     ++ +A        G   +  A++ G    +   +ENG  I       L +   + +    ++    +  G  V+  + D  T AL VA   G++   ++LL+   +   R   G T L+ A   I
Sbjct:  327 DSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFESVDDESEFDDEEDQKILREIKKR-------LSIAAKK-WTNRAGIH--------NDKSKNGNN-AHTIDQPPFDNTTKAKNEKAADSPSMASN------IDEKAPEEEFYWTDVTSRA--------GKEKLFKASKEGHLPYVGTYVENGGKID------LRSFFESVKCGHEDITSIFLAFGFPVNQTSRDNKTSALMVAVGRGHLGTVKLLLEAGADPTKRDKKGRTALYYAKNSI 638          

HSP 2 Score: 64.6994 bits (156), Expect = 1.044e-10
Identity = 39/113 (34.51%), Postives = 65/113 (57.52%), Query Frame = 2
Query: 2102 HQAENGLTALHLAAEKNRTDIVEQLLKTEA-DISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQT--NLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALE 2431
            ++   G T L +A +K + D+V+++++    DI+ +   G TALH A   G I+ V++L++   DVN ++    G T L  A+  GH+ +V+ LL N  D   +N +GLTA E
Sbjct:  325 YRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFE 437          

HSP 3 Score: 53.1434 bits (126), Expect = 3.929e-7
Identity = 39/115 (33.91%), Postives = 62/115 (53.91%), Query Frame = 2
Query: 1907 LYKN--GYTPLHLVAKKNMIEVTKLLIDRGA-NVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAEN--GLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHT 2236
            +Y++  G T L +   K   +V K +I+ G  ++N Q   G T LH  ++ G+ EI+ELL++  ADVN ++    G T L  A+     D+V+ LLK  AD + +   G TA  +
Sbjct:  324 IYRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAFES 438          

HSP 4 Score: 49.6766 bits (117), Expect = 4.013e-6
Identity = 33/105 (31.43%), Postives = 53/105 (50.48%), Query Frame = 2
Query: 1718 GFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVN--CLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFT 2026
            G T L IA   G+  V ++++     + N   + G T LH A    H E++ELL++  A+VN   +   G TPL   +    ++V K L+  GA+   ++ KG T
Sbjct:  330 GRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLT 434          
BLAST of Ankyrin-2 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 74.3294 bits (181), Expect = 1.067e-13
Identity = 73/234 (31.20%), Postives = 111/234 (47.44%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGL---SVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQN-GFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGN---------DKVVQILLDNDSRS-KVRLPALHIAAKKDDVNAASLL-IGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADV 805
            A L+A RSGN E+     Q +   +      L   H A + G+   V+ +I   L   + D  + +  T LH AS+  +L VV  L+   A++N ++     TPL+ AA+  ++ +V  LL++GA+  +T D GF  L +++   N         + V + LLD D R  K R   L  A + D +  A LL  G+S    D +   GFTPLH        +V K LI+  AD 
Sbjct:   44 ASLKAIRSGNEEESGN-EQVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTE---GFTPLHWGTVKGQPHVLKYLIQDGADF 273          

HSP 2 Score: 70.0922 bits (170), Expect = 2.576e-12
Identity = 60/195 (30.77%), Postives = 94/195 (48.21%), Query Frame = 2
Query:  782 LIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGL---SPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQA----EVCKTLINKGI-DVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIA 1342
            L+E N D +  +  +IT LH A+   +  ++  L+SQ A+VN+  R G    +P+H AAR G+  I+  LL++GAD       G   L ++           V   +++KG+ D+D       T+L  AA+ G+      LLK   ++      GFTPLH    K Q  +++ LI+  A     T+TG     IA
Sbjct:   97 LLEVNNDGD--STEHITGLHWASINNRLSVVDFLVSQGADVNA--RAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIA 287          

HSP 3 Score: 68.5514 bits (166), Expect = 6.456e-12
Identity = 59/227 (25.99%), Postives = 103/227 (45.37%), Query Frame = 2
Query: 1724 TPLHIASKYGRVQVARQL----LLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGY---TPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGN-KEIMELLLDANA----DVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVR 2368
            T  H A + G +   +++    LL    + +S  H  +T LH A+  N   +++ L+   A+VN   + G    TPLH  A+   + +   L+  GA+      +GF  LHL+  + N   ++ +L +  +    D++ +   G T+L  AA +  +  V +LLK  A I      G+T LH     GQ   +K L+Q   D   +T+ G     +A +   +  +R
Sbjct:   75 TRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEH--ITGLHWASINNRLSVVDFLVSQGADVNA--RAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLR 297          

HSP 4 Score: 65.0846 bits (157), Expect = 7.801e-11
Identity = 47/138 (34.06%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  161 AARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLS---VDIATR--KGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVA 559
            AAR G V  V   L+    P M++  G N +HL+    N  +V  ++ N +S   +DI  R  KG TSL  A+  G    V+ LL+  A+I +    GFTPL+    +    V+K L++ GA+    TD G    A+A
Sbjct:  150 AARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIA 287          

HSP 5 Score: 63.929 bits (154), Expect = 1.540e-10
Identity = 57/236 (24.15%), Postives = 100/236 (42.37%), Query Frame = 2
Query: 1490 EANFNARARENQ--TPLHIAVRMGNYSIVEQ-----LLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGF---TPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNH-----YEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKN 2152
            + N N  A E+   T  H A + G+ + V++     LL    D +  + ++ T LH A+   R  +   L+      D   + G    TPLH A++YG V +    LL    +P      G   LH++   ++     Y +  ++     +++C    G T L   A +        L+  GA++     +GFTPLH  ++ G   +++ L+   AD   + + G     +A E N
Sbjct:   61 QVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGD--STEHITGLHWASINNRLSVVDFLVSQGA--DVNARAGALHATPLHWAARYGYVYIV-DFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMN 291          

HSP 6 Score: 59.6918 bits (143), Expect = 3.957e-9
Identity = 66/259 (25.48%), Postives = 107/259 (41.31%), Query Frame = 2
Query: 1025 LTALQMATQ-GDQAEVCKTLINKGIDV--DAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEA----NFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLL 1780
            LT    A Q GD A V + +  K ++V  D  + +++T LH A+    ++  + L+    +VNARA      LH                             TPLH AA  G   IV+ LLK+GA  + T  +  N LHL+  ++       +L +  +    + + R  + +T L  A   G+   V +LL  GA   +   + +T LH    +G+  + + L++       KT  G     IA +   V   R+ L
Sbjct:   74 LTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARA----GALHA----------------------------TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREAL 300          

HSP 7 Score: 51.6026 bits (122), Expect = 1.039e-6
Identity = 48/175 (27.43%), Postives = 69/175 (39.43%), Query Frame = 2
Query:  596 LDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLL----ISQKANVNSVTRD--GLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDV 1102
            ++ND  S   +  LH A+  + ++    L+    D      A   TPLH AA Y  V +   L++  AD           LH++       ML L     +  K  ++   RD  G + +  AA  G    +  LL+ GA I+     G T L   T   Q  V K LI  G D 
Sbjct:  100 VNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVN-SSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADF 273          
BLAST of Ankyrin-2 vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 70.8626 bits (172), Expect = 1.520e-12
Identity = 55/195 (28.21%), Postives = 91/195 (46.67%), Query Frame = 2
Query: 1226 TPLHIACKKIQSKMVELLIKYKAHINSTTET------------GLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARE-NQTPLHIAVRMGNYSIVEQLLNAGADPNMVTK-DNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVA 1768
            TPLH +C+   S++ +L+IK     N   E              LTPLH+       +   +LL++        +K  + LHLA   N      +LL     + N +  E ++TPL++A R+  +     LL  GAD  +  K   +TA+ +AA EG  +I +LL+ +    D + + G+TP+  A   G + +A
Sbjct:  430 TPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQSLDP--NVKLKSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIA 622          

HSP 2 Score: 55.8398 bits (133), Expect = 5.891e-8
Identity = 62/244 (25.41%), Postives = 106/244 (43.44%), Query Frame = 2
Query: 1598 PNMVTKDNY--TALHIAAKEGRHEISRLLLE--------HQCKPDAKTKKG----FTPLHIASKYGRVQVARQLLLSAKVNPN-SLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGY---TPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKML 2275
            P +   DNY  T LH + + G  E+++L+++        ++   D  +  G     TPLH+       +    LL S  ++PN  L    L  LH+AT +N+Y ++ +LL ++   +  Y++     TPL+L  + N  E    L+  GA++                    EI E L             G TA+ +AA +  TDIV+ L+   A+   + + G+T +  AV  G +    M+
Sbjct:  419 PCLFQHDNYKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQS--LDPNVKLKSSSL--LHLATEWNNYPLLHVLLSSK-RFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADL--------------------EIREKLF------------GWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMV 625          

HSP 3 Score: 51.9878 bits (123), Expect = 8.066e-7
Identity = 56/213 (26.29%), Postives = 96/213 (45.07%), Query Frame = 2
Query: 1826 TPLHVATYYNHYEMIELLLDTEANVNCLYK------------NGYTPLHLVAKKNMIEVTKLLIDR-GANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANA-DVNHQAENGL--TALHLAAEKNRTDIVEQLLKTEADISTKTQM-GYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQ 2413
            TPLH +  Y   E+ +L++      N   +               TPLHL       + T++L+     NV  +S    + LHL +   N  ++ +LL +   D+N+Q +N L  T L+LA   N  +    LL   AD+  + ++ G+TA+  A   G    VK+L+  N + + +   G T +  A  +GH+ I  ++   +  V H + Q
Sbjct:  430 TPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQSLDPNVKLKSS---SLLHLATEWNNYPLLHVLLSSKRFDINYQ-DNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMVQIRDELVTHPHSQ 638          

HSP 4 Score: 50.8322 bits (120), Expect = 2.041e-6
Identity = 46/199 (23.12%), Postives = 92/199 (46.23%), Query Frame = 2
Query: 1523 QTPLHIAVRMGNYSIVEQLLNAGADPNMVTK------------DNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHH-GLTPLHVATYYNHYEMIELLLDTEANVNCLYK-NGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELL 2077
            +TPLH + + G   + + ++    + N+  +            ++ T LH+    G H  +  +L     P+ K K   + LH+A+++    +   LL S + + N   +    TPL++A   N +E    LL   A++    K  G+T + + A +   ++ KLLI   AN + + + G+TP+    + G+  I +++
Sbjct:  429 RTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVL-GAHPKTTEVLLQSLDPNVKLKSS-SLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMV 625          

HSP 5 Score: 48.9062 bits (115), Expect = 7.300e-6
Identity = 50/199 (25.13%), Postives = 95/199 (47.74%), Query Frame = 2
Query:  830 TPLHVAAKWGKEEMLKLLIS--QKANV-NSVTRD---------GLSPIHCAARSGFENIILILLEN-GADIQHKSKNGLTALQMATQGDQAEVCKTLIN-KGIDVDAVTMD-YLTALHVAAHCGNINAAEVLLKNNCNVNAR-ALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNIL 1378
            TPLH + ++G  E+ KL+I   ++ N+ N +  D          L+P+H            +LL++   +++ KS    + L +AT+ +   +   L++ K  D++    + + T L++A       AA  LL N  ++  R  L G+T + +A  +  + +V+LLI   A+ +   E G TP+  A   G   I +++
Sbjct:  430 TPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQSLDPNVKLKSS---SLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMV 625          
BLAST of Ankyrin-2 vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 68.1662 bits (165), Expect = 5.244e-12
Identity = 50/163 (30.67%), Postives = 83/163 (50.92%), Query Frame = 2
Query: 1514 RENQTPLHIAVRMGNYSIVEQLLNAGAD--PNMVTKDNYTALHIAAKEGRHEISRLLLE--HQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRG 1990
            +E    L  A+  GN  IV++LL    D   N+ +++ +++LH A+  GR+ I   L++  H      KT KG T +H+A   G  Q    LL       N  G +G  P+H+A   ++Y+ + LL+   A++  +  NG TPLH+  +   I   K+L++ G
Sbjct:    3 KEPSVRLREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEG 165          

HSP 2 Score: 67.0106 bits (162), Expect = 1.039e-11
Identity = 47/162 (29.01%), Postives = 85/162 (52.47%), Query Frame = 2
Query:  131 LTEKAHAFLRAARSGNVEKVKEFLQ--ADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVD--IATRKGNTSLHIASLAGKLEVVSLLLESKAN-INVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLD 601
            L E +     A   GN+  VK  L+   D+  ++ + NG +++H A+  G   +   LI+ G      I T KGNT +H+A + G  + + LLL+     IN + +NG  P+++A   ++   + +L+  GA+  +   +G TPL V L+ G+   +++LL+
Sbjct:    2 LKEPSVRLREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLN 163          

HSP 3 Score: 57.3806 bits (137), Expect = 1.288e-8
Identity = 37/127 (29.13%), Postives = 63/127 (49.61%), Query Frame = 2
Query: 1913 KNGYTPLHLVAKKNMIEVTKLLIDRGANVNA--QSQKGFTPLHLNSMAGNKEIMELLLDANAD-VNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQK 2284
            +NG++ LH  +      +   LI  G + +   ++ KG T +HL  M G+++ + LLL      +NH+ ENG   +H+A   +    +  L+   AD+      G T LH  + +G I  +KMLL +
Sbjct:   38 ENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNE 164          

HSP 4 Score: 52.7582 bits (125), Expect = 2.866e-7
Identity = 44/176 (25.00%), Postives = 74/176 (42.05%), Query Frame = 2
Query: 1301 NSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQ--TTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLL---EHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLG 1813
            N  +E G + LH A++ G   I   L++ G    +   T K    +HLA     E+T  +LL       N R    + P+HIA     Y  +  L+  GAD  ++  +  T LH+  + G     ++LL   E     + + K  + P+ +A  +    +  ++L   K     LG
Sbjct:   34 NIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVAQTFEVGNIYSKVLKEVKKKGPPLG 209          

HSP 5 Score: 52.7582 bits (125), Expect = 3.179e-7
Identity = 45/185 (24.32%), Postives = 82/185 (44.32%), Query Frame = 2
Query:  350 LHIASLAGKLEVVSLLLESKANI--NVKSQNGFTPLYMAAQENHLDVVKVLLEYG--ANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQ 892
            L  A + G L +V  LL    ++  N+ S+NG++ L+ A+      +   L++ G   ++ I T  G T + +AL +G+++ + +LL    R                              ++H+  +G  P+HIA   +      LLI   AD+     N  TPLHV  ++G    +K+L+++
Sbjct:    9 LREAIIEGNLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRF-----------------------------INHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNE 164          

HSP 6 Score: 51.9878 bits (123), Expect = 6.134e-7
Identity = 40/129 (31.01%), Postives = 60/129 (46.51%), Query Frame = 2
Query: 1013 SKNGLTALQMATQGDQAEVCKTLINKGIDVDAV--TMDYLTALHVAAHCGNINAAEVLLKNNCN-VNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNG 1390
            S+NG ++L  A+   +  +C  LI  G D   +  T    T +H+A   G+     +LL+     +N R  NG  P+HIAC     + + LLI   A +      G TPLH+    GS   + +LL  G
Sbjct:   37 SENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEG 165          

HSP 7 Score: 48.521 bits (114), Expect = 6.945e-6
Identity = 43/169 (25.44%), Postives = 79/169 (46.75%), Query Frame = 2
Query:  761 NVNVAKLLIEKNADV--NFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSV--TRDGLSPIHCAARSGFENIILILLENGAD-IQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKN---NCNVNARALNGFTPLHIA 1243
            N+ + K L+ +N D+  N  ++N  + LH A+  G+  +   LI    + + +  T  G + +H A   G E  + +LL+     I H+ +NG   + +A   D  +    LI  G D+  +  +  T LHV    G+I+  ++LL     + + N R    + P+ +A
Sbjct:   17 NLLIVKRLLRRNPDLLTNIDSENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSLDDNVRDKGNWKPIDVA 185          
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Match: EDO45487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW5])

HSP 1 Score: 256.914 bits (655), Expect = 4.731e-75
Identity = 161/455 (35.38%), Postives = 242/455 (53.19%), Query Frame = 1
Query: 2827 MELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGA-SWKEHTNLFTDIAVQDALG-------------NLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWS-DANRSIPYTVQTSSLRLLCSI-------SGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCR-RKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYAR 4122
            M++D+V L + PV  GFL+SF+VDA+ G M++ +   I+I +P  S   PTRI C L R      LP L + EALACR++ +  S      P+ LE+P+ AALR GERE+VV+K+D+G  +W E       ++V+D  G                E+     + +R R  +I T +LP+ F+++SR+K+++  +G+ G ++ S+V   VQ   PEGA+    K+SLQ+  +  N         V +SP+VTLEP    F + +T+T+P P +S  +N  I       SLRLLC         S Q     W+DITG +PLT+     SFT    AR WLI+    + +   A  +Y +   VP++ +F+VF +   +  E ++R  CITDD  +KTLE Q  F  I+    VEV +     +   GN+ P+    + L L    F+ENRLS   R
Sbjct:    1 MQVDNVPLYEPPVTGGFLVSFLVDARSGKMESTQT-GIKIVLPPRSCQMPTRITCRLLRINRPTLLPPLREGEALACRVLDIGPSGTRFLQPVYLEVPYFAALRDGERELVVMKTDDGGWNWDE-------VSVEDMKGKCHAICLKIERVKGYKEDSPDAIFPSR-RYAKISTQALPERFAVVSRVKKEIFSVGSRGESIRSAVLPSVQVNVPEGAVASGTKMSLQVQPVDENF--NNLEEWVTVSPVVTLEPADIIFKKPVTVTIPCPVYSGQSNPDI-----QPSLRLLCCFPKEAKAGSAQTPAYQWQDITGNTPLTVIGANASFTIDRPARYWLIETRNPDNVTADARLIYRKLAAVPYLAKFVVFAKLSADGTEARLRVFCITDDKMDKTLEGQTGFVEIARSRDVEVHDGRPIHIRCLGNLAPVQR--DPLHLNFFSFRENRLSVTVR 437          
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Match: EDO45486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW2])

HSP 1 Score: 163.31 bits (412), Expect = 1.523e-44
Identity = 100/288 (34.72%), Postives = 151/288 (52.43%), Query Frame = 1
Query: 3286 RIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWS-DANRSIPYTVQTSSLRLLCSI-------SGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCR-RKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYAR 4122
            R  +I T +LP+ F+++SR+K+++  +G+ G ++ S+V   VQ   PEGA+    K+SLQ+  +  N         V +SP+VTLEP    F + +T+T+P P +S  +N  I       SLRLLC         S Q     W+DITG +PLT+     SFT    AR WLI+    + +   A  +Y +   VP++ +F+VF +   +  E ++R  CITDD  +KTLE Q  F  I+    VEV +     +   GN+ P+    + L L    F+ENRLS   R
Sbjct:   11 RYAKISTQALPERFAVVSRVKKEIFSVGSRGESIRSAVLPSVQVNVPEGAVASGTKMSLQVQPVDENF--NNLEEWVTVSPVVTLEPADIIFKKPVTVTIPCPVYSGQSNPDI-----QPSLRLLCCFPKEAKAGSAQTPAYQWQDITGNTPLTVIGANASFTIDRPARYWLIETRNPDNVTADARLIYRKLAAVPYLAKFVVFAKLSADGTEARLRVFCITDDKMDKTLEGQTGFVEIARSRDVEVHDGRPIHIRCLGNLAPVQR--DPLHLNFFSFRENRLSVTVR 289          
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 124.405 bits (311), Expect = 1.168e-29
Identity = 125/488 (25.61%), Postives = 209/488 (42.83%), Query Frame = 2
Query:  728 FTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALH----VAAHC--GNINAAEVLLKNNCN---VNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDI 2164
             TPLH+A  +  + VAK L+E  AD+    +  +TPLH A   G   + KLL                 +    R G+  +  ++ +   + Q       TAL +A +G   ++ K  + KG +V+AV        H    VA  C    I  +++   + C    +    L  F  + I        ++  +I+++A I    +   TPL IAA     + V  LL++GA I+   +   N++  AA     ET +  L            E+Q P+        ++I + +   G    +V   N   L +         S+LLL++    D+K  +  TP+H A+K+GRV+    LL       N       TPLH+A  + H  +++ LL     ++      +TPL   A + M+EV  +L+D  A V+   +   TPLHL S  G+ E+++LLL   A++      G   L +A E +  ++
Sbjct:    5 MTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLF----------------VAAELRGGWSTVSKMVTDQDREEQ-------TALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVI--------IICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAAL------------EHQKPV--------WTICDDVCLNG----LVGGSNKLILVLRIS------SQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEV 431          

HSP 2 Score: 102.064 bits (253), Expect = 2.513e-22
Identity = 122/493 (24.75%), Postives = 211/493 (42.80%), Query Frame = 2
Query:  440 FTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAK-KDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILIL---LENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNN------CN-VNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLD 1885
             TPL++A     + V K L+E GA+     ++  TPL  A  +GN  V ++L               +AA+ +   +  S ++  +D + + Q+A     LH+A    + ++AKL +EK A+VN   ++     H      +E +  ++   K    S  +     I       F ++++I+   +   A I+ + K+  T L +A + +  +  +TL+  G D+ A  ++   ++  AA  G +   E  L++       C+ V    L G +   I   +I S   +LL+   A I+S  +  +TP+H AA  G    V  LLK   +I                                  N     + TPLH+A   G+ ++V++LL  G   +      +T L  AA  G  E++ +LL+     D   K   TPLH+AS+ G V++ + LLLS K N       G   L +A   +H E+   ++D
Sbjct:    5 MTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLF--------------VAAELRGGWSTVSKMV--TDQDREEQTA-----LHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKS--EKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISS---QLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAI---------------------------------INDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVK-LLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIID 437          

HSP 3 Score: 98.2117 bits (243), Expect = 4.153e-21
Identity = 107/434 (24.65%), Postives = 182/434 (41.94%), Query Frame = 2
Query: 1016 KNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGF---------------TPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLL-----HPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRV----QVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTE-ANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAV 2242
            K  +T L +A       V K L+  G D+ ++  + +T LH A   GN+  A++L      V A    G+               T LH+A +     + +L ++  A++N+  E+     H    + ++E + +++K       +  K E       R      F ++++        A    R ++  TPL IA    +   V  LL  GAD      ++  ++  AA EG  E     LEHQ KP            +     ++    +++ QLLL      +S     +TP+H A  +     +  LL  + A +N       TPLHL A      V K L+ RG  ++A++   +TPL   +  G  E+  +LLD +A V+   +   T LHLA+ +   ++V+ LL  +A+I+     G   L  A+
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLF-----VAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFH-KTIVVARECIFVMIKVSKLKYLSFCKSEKI----KREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQ-KPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAI 424          

HSP 4 Score: 95.5153 bits (236), Expect = 3.872e-20
Identity = 107/443 (24.15%), Postives = 185/443 (41.76%), Query Frame = 2
Query: 1223 FTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNIL-----LKNGAS-----ISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHE---------ISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLL-SAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVN------CL--YKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGN-KEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIA 2464
             TPLH+AC      + + L++  A + S  E  +TPLH A   G+  +  +L     L+ G S     ++    + + ALHLA      +  K L L   AN NA         H  + +    I   +         V+K  Y +   + K  R           I   ++  +   + + K   TPL IA++   V   R LL   A +    +       +  A      E +E  L+ +  V       CL     G   L LV + +    ++LL+D GA +++++ +  TP+H  +  G  + +  LL    A +N +     T LHLAA      +V++LL     I  +    +T L  A   G ++   +LL ++  V+       T LHLA+++GH+ +V+LLL  + ++   +  G   L++A +  +  +A
Sbjct:    5 MTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAK-LCLEKGANVNAVKESKNKTFHKTIVVARECIFVMI--------KVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDR--NSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRIS----SQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVA 432          

HSP 5 Score: 87.0409 bits (214), Expect = 1.934e-17
Identity = 79/356 (22.19%), Postives = 148/356 (41.57%), Query Frame = 2
Query:  245 NAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGK----------------------------------LEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAI------------TTDDGFTPLAVALQQ------------------GNDKVV-------QILLDN----DSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLIN 1087
             A+HLA + G+ ++ +L +E G +V+      N + H   +  +                                  + ++  ++  +A I  + ++  TPL +AA++NH+D V+ LL++GA+ A               +     L  AL+                   G++K++       Q+LLDN    DS++   +  +H AAK   V     L+      ++ +  +  TPLH+AA + +  V K L+ +   ++       TPL  AA  G  E+  +L+ + A V+   +   +P+H A+R G   ++ +LL   A+I      G   L +A +    EV   +I+
Sbjct:   82 TALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIID 437          

HSP 6 Score: 84.3445 bits (207), Expect = 1.140e-16
Identity = 114/451 (25.28%), Postives = 190/451 (42.13%), Query Frame = 2
Query:  242 LNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLL--------ESKANINVKSQNGF--TPLYMAAQENHLDVVKVLLEYGAN-QAI--TTDDGFTPLAVALQQGNDKVVQIL-LDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRD----GLSPIHCAARSGFENIILIL-------LENGADIQHKSKNGLTALQMATQ-GDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARAR 1516
            +  +H+A   G   V + L+E G  +     +  T LH A + G L V  LL          S  +  V  Q+    T L++A +  H D+ K+ LE GAN  A+  + +  F    V  ++    ++++  L   S  K       I     DV      I      ++ +     TPL IAA  N+V+  + L++  AD+     N+   +  AA  G  E L+  +  +  V ++  D    GL         G   +IL+L       L+NGA I  K+   +T +  A + G    VC  L      ++       T LH+AA  G+    + LL     ++AR    +TPL  A  +   ++  +L+   A ++ T +   TPLH+A+  G  E+V +LL   A+I+ T     N L +A  ++ +E    ++ H +     R R
Sbjct:    5 MTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLV-------GGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDHVDWKQAMRNR 448          

HSP 7 Score: 66.6254 bits (161), Expect = 4.435e-11
Identity = 49/158 (31.01%), Postives = 85/158 (53.80%), Query Frame = 2
Query:  161 AARSGNVEKVKEFLQAD--IKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDN-DSRSKVR 625
            AA+ G V  V   L+ D  I  D   A+    +HLAA  G+  VV+ L+  G ++D       T L  A+  G +EV ++LL+  A ++   +   TPL++A++E H+++VK+LL   AN  +T   G   L +A++  + +V   ++D+ D +  +R
Sbjct:  290 AAKFGRVRTVCALLKRDPAIINDEDGASN-TPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDHVDWKQAMR 446          
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 105.916 bits (263), Expect = 9.556e-25
Identity = 77/242 (31.82%), Postives = 129/242 (53.31%), Query Frame = 2
Query:  152 FLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQG---NDKVVQILLD----NDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKW 856
            FL A  SG+V++VK+ L      +  N +GL A+H A  + N ++V++L++ G S+D+   +G TSLH A+  G +E+   L+E+ A++   +  G  PL +A +E+  D++   +E   NQ I  DD     A A+++    ND   Q  L+    N+S+ K    ALH+A+ K  +    LL+    + ++ + A  +TPLH AAH+   +  +LL E  AD  F A+N +  +     W
Sbjct:   53 FLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIE---NQGIDVDD-----ARAVEEKIMLND--AQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVE-INAKDADNWTPLHAAAHWGQKDACELLSENGAD--FNARNKMVGIDHQQNW 281          

HSP 2 Score: 89.7373 bits (221), Expect = 3.038e-19
Identity = 70/233 (30.04%), Postives = 112/233 (48.07%), Query Frame = 2
Query:  713 QSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLI-NKGIDVD---AVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASI 1399
            Q  SG   L  A    +V+  K L+ K AD+N+   + +T LH A      +++K+L+ + A+++    +G + +H AA  G   I   L+ENGAD+   +  G   L +A + D  ++    I N+GIDVD   AV    +           +N A+  L  NC   ++     + LH+A  K   K++ LL++    IN+      TPLH AA  G K+   +L +NGA  
Sbjct:   46 QFNSGIVFLS-AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIM-----------LNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADF 266          

HSP 3 Score: 83.5741 bits (205), Expect = 3.859e-17
Identity = 71/245 (28.98%), Postives = 113/245 (46.12%), Query Frame = 2
Query: 1694 KPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDA------NADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNK 2410
            KP  +   G   L   S     +V + L   A +N  ++   GLT LH A    +++++++L+D  A+++     G+T LH  A    +E+ K LI+ GA+V A + +G  PL L   A  +++ +LL D       + D     E  +      +  N+  I E   KTEA          +ALH A   G ++ + +LLQ   ++NA+     T LH AA  G      LL +N  D N +NK
Sbjct:   42 KPKIQFNSGIVFLSAVSSGDVDEVKKLLAKGADINYQNV--DGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDL---AEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEA----------SALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 4 Score: 80.1073 bits (196), Expect = 5.802e-16
Identity = 58/216 (26.85%), Postives = 97/216 (44.91%), Query Frame = 2
Query: 1142 AAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETF-------------------KILLLHPEANFN------ARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTK 1714
            A   G+++  + LL    ++N + ++G T LH AC      +V++L+   A ++     G T LH AA  GS EI   L++NGA ++    + E  L LA   + E+                     KI+L   ++  N      ++ +   + LH+A   G   ++  LL  G + N    DN+T LH AA  G+ +   LL E+    +A+ K
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 5 Score: 78.5666 bits (192), Expect = 1.906e-15
Identity = 60/216 (27.78%), Postives = 100/216 (46.30%), Query Frame = 2
Query: 1541 AVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLD-------------------------TEANVNCLY----KNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVN 2101
            AV  G+   V++LL  GAD N    D  TALH A  +   ++ ++L++     D +  +G+T LH A+  G V++A+ L+ +   +  ++ + G  PL +A      +M +LL D                         +  N NC+     K   + LH+ + K  ++V  LL+  G  +NA+    +TPLH  +  G K+  ELL +  AD N
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENG-ADVAAVNNEGELPLDLAE---EEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFN 267          

HSP 6 Score: 75.485 bits (184), Expect = 1.594e-14
Identity = 71/231 (30.74%), Postives = 108/231 (46.75%), Query Frame = 2
Query:  944 AARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGAS------ISQTTMKCE-NALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTK 1615
            A  SG  + +  LL  GADI +++ +GLTAL  A   +  ++ K L++KG  +D    +  T+LH AA CG++  A+ L++N  +V A    G  PL +A    +  M +LL         T E     + +      +E   I+L +  S      I+++  K E +ALH+A+     +    LLL      NA+  +N TPLH A   G     E L   GAD N   K
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLA---EEEDMEDLL---------TDEIENQGIDVDDARAVEE--KIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIG-LLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 7 Score: 70.4774 bits (171), Expect = 8.848e-13
Identity = 60/222 (27.03%), Postives = 113/222 (50.90%), Query Frame = 2
Query:  368 AGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDS-----RSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSK 1018
            +G ++ V  LL   A+IN ++ +G T L+ A  + + D+VKVL++ GA+  +  ++G+T L  A   G+ ++ + L++N +      ++  LP L +A ++D  +  +  I +   +VD   A     +        +N A+  + KN       K   + LHVA+  G  +++ LL+     +N+   D  +P+H AA  G ++   +L ENGAD   ++K
Sbjct:   59 SGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELP-LDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIM--------LNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 8 Score: 57.7658 bits (138), Expect = 1.262e-8
Identity = 36/103 (34.95%), Postives = 55/103 (53.40%), Query Frame = 2
Query: 2138 AAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQ 2446
            A      D V++LL   ADI+ +   G TALH A        VK+L+ K   ++ + N G TSLH AA  G + I + L++N  DV   N +G   L++A+++
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEE 158          
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Match: EDO39113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB41])

HSP 1 Score: 100.908 bits (250), Expect = 3.956e-24
Identity = 65/185 (35.14%), Postives = 100/185 (54.05%), Query Frame = 2
Query: 1739 ASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGY---TPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLL-DANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQ 2281
            A + GR    R+LL     N N+L   G +PLH AT  NH +++++LLD  A+V+           P+   AK N IE  ++L+  GA+VN  +  G T LH  +  G+ +++ELLL D   DVN    +  T+LH+AA      I++ LL   A+I+ K   G+TA H A   G+ + ++ LL+
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          

HSP 2 Score: 88.9669 bits (219), Expect = 5.853e-20
Identity = 56/181 (30.94%), Postives = 93/181 (51.38%), Query Frame = 2
Query: 1154 GNINAAEVLLKNN-CNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHIN---STTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLE 1684
            G  +    LL+ N  N+N    +GF+PLH A       +V++L+   A ++   S +   + P+  AA   + E   +LL+ GA ++ T    + ALH A R    +  ++LL   + + N   R+N T LH+A  +G+  I++ LL  GA+      D +TA H+AA+EG  E+ + LL 
Sbjct:    6 GRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          

HSP 3 Score: 85.1149 bits (209), Expect = 1.128e-18
Identity = 63/214 (29.44%), Postives = 101/214 (47.20%), Query Frame = 2
Query:  359 ASLAGKLEVVSLLLESK-ANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLI-EKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENG 994
            A   G+ + V  LL     N+N    +GF+PL+ A   NH+D+V++LL+ GA+  +                            S S  R+P +  AAK + + +  +L+ +  D V+  +  G T LH A    +  + +LL+ +   DVN   ++N T LHVAA  G   ++K L+   AN+ +   DG +  H AAR G E ++  LL  G
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDV--------------------------RGSPSIQRIPPIICAAKFNAIESCRVLLRAGAD-VNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 4 Score: 81.2629 bits (199), Expect = 2.975e-17
Identity = 55/173 (31.79%), Postives = 92/173 (53.18%), Query Frame = 2
Query: 1871 ELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQ---SQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKT-EADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLL 2377
            +LL     N+N L  +G++PLH     N +++ ++L+D GA+V+ +   S +   P+   +     E   +LL A ADVN     G TALH A  +  + +VE LL+  + D++   +   T+LH A   G    +K LL    ++ A+ N G T+ HLAA++G   +++ LL
Sbjct:   13 KLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLL 185          

HSP 5 Score: 78.1814 bits (191), Expect = 3.238e-16
Identity = 55/187 (29.41%), Postives = 93/187 (49.73%), Query Frame = 2
Query: 1640 AAKEGRHEISRLLLEHQ-CKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGH---HGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRG-ANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKT 2185
            A ++GR +  R LL       +     GF+PLH A+    V +  Q+LL A  + +  G      + P+  A  +N  E   +LL   A+VN     G T LH   ++   ++ +LL+  G  +VN   +   T LH+ +M G+  I++ LL   A++  +  +G TA HLAA +   ++++ LL+T
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIV-QMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRT 187          

HSP 6 Score: 78.1814 bits (191), Expect = 3.495e-16
Identity = 55/187 (29.41%), Postives = 97/187 (51.87%), Query Frame = 2
Query:  845 AAKWGKEEML-KLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHK---SKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNN-CNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNG 1390
            A + G+++ + KLL     N+N++  DG SP+H A  +   +I+ +LL+ GAD+  +   S   +  +  A + +  E C+ L+  G DV+       TALH A   G+    E+LL++   +VN    +  T LH+A     + +++ L+   A+I +    G T  H+AA  G +E++  LL+ G
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 7 Score: 77.411 bits (189), Expect = 5.920e-16
Identity = 55/176 (31.25%), Postives = 89/176 (50.57%), Query Frame = 2
Query: 1964 VTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALH---LAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKN-FDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSK 2479
            V KLL     N+N     GF+PLH  +   + +I+++LLDA ADV+ +    +  +     AA+ N  +    LL+  AD++     G TALH A   G  + V++LL+    DVN       TSLH+AA  G   I++ LL    ++  ++  G TA  +A ++    + +TL +
Sbjct:   11 VRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          

HSP 8 Score: 76.2554 bits (186), Expect = 1.388e-15
Identity = 39/117 (33.33%), Postives = 69/117 (58.97%), Query Frame = 2
Query:  161 AARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENG-LSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYG 508
            AA+   +E  +  L+A    +++N  G  A+H A + G+ ++V+LL+ +G + V++  R   TSLH+A++ G   ++  LL   ANI  K  +GFT  ++AA+E   +V++ LL  G
Sbjct:   72 AAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 9 Score: 75.8702 bits (185), Expect = 1.798e-15
Identity = 55/199 (27.64%), Postives = 97/199 (48.74%), Query Frame = 2
Query:  701 NVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNF---PAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKG-IDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIK 1285
            N++   A GF+PLH A   N+V++ ++L++  ADV+    P+   I P+  AAK+   E  +                                 +LL  GAD+   +  G TAL  AT+   +++ + L+  G +DV+ V  D  T+LHVAA  G+    + LL    N+ A+  +GFT  H+A ++ + ++++ L++
Sbjct:   21 NLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCR---------------------------------VLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLR 186          

HSP 10 Score: 67.781 bits (164), Expect = 1.140e-12
Identity = 53/187 (28.34%), Postives = 86/187 (45.99%), Query Frame = 2
Query: 1439 AARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALH---IAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRG 1990
            A R+ +++  + LL     N N    +  +PLH A    +  IV+ LL+AGAD ++    +   +     AAK    E  R+LL      +     G T LH A++ G  ++   LL   +++ N +     T LHVA       +I+ LL   AN+     +G+T  HL A++   EV + L+  G
Sbjct:    2 ACRDGRKDCVRKLLRGNLTNLNTLDADGFSPLHYATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLLRTG 188          

HSP 11 Score: 61.6178 bits (148), Expect = 1.537e-10
Identity = 46/150 (30.67%), Postives = 79/150 (52.67%), Query Frame = 2
Query:  161 AARSGNVEKVKEFLQADIKPDMSNANGLNAMH---LAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLL-ESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILL 598
            A  + +V+ V+  L A    D+  +  +  +     AAK    E  ++L+  G  V+I    G T+LH A+  G  ++V LLL + + ++NV  ++  T L++AA      ++K LL  GAN     +DGFT   +A ++G ++V+Q LL
Sbjct:   36 ATTTNHVDIVQMLLDAGADVDVRGSPSIQRIPPIICAAKFNAIESCRVLLRAGADVNITNCYGQTALHHATRRGHSKMVELLLRDGQMDVNVVDRDNTTSLHVAAMIGSNPIIKTLLFCGANITAKDNDGFTAFHLAAREGEEEVLQTLL 185          
BLAST of Ankyrin-2 vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 801.971 bits (2070), Expect = 0.000e+0
Identity = 416/803 (51.81%), Postives = 566/803 (70.49%), Query Frame = 2
Query:  149 AFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            +FLRAAR+GN++KV E+L+  +     N NGLNA+HLAAKEG+ ++VQ L++ G  VD +T+KGNT+LHI+SLAG+ EVV  L++  A+IN +SQNGFTPLYMAAQENHLDVV+ LLE G NQ+  T+DGFTPLA+ALQQG+++VV ILL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D QS SGFTPLHIAAHY NVNVA LL+ + A V+F A+N ITPLHVA+K G   M++LL+ + + +++ TRDGL+P+HCAARSG E  + +LLE GA +  ++KNGL+ L MA QGD  E  K L+     VD VT+DYLTALHVAAHCG+    ++LL    N NARALNGFTPLHIACKK + K++ELL+KY A I + TE+GLTP+H+AAFMG   IV +LL+NGAS   + ++ E +LH+AAR  Q E  + LL +  A  +ARARE+QTPLHIA R+G   IV+ LL   A P+  T + YT LHI+A+EG+ E + +LLE        TKKGFTPLH+ SKYG + VA+ LLL  +  P+S G +GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++  +L+  GA  NA +++G TPLHL S  G+ ++  LL+   A +N   ++GLTALHLAA+++R  + E L++  A++  +T++GYT L  A H+G  + V  LLQ    VNA+T  G T LH AAQQG+  I+ +LL +    N     G TAL +A++  Y+++ +TL  VT      + +  +K  L+ PE M +
Sbjct:   35 SFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRN-GAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAK-LLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLRVVTEEVVTTTTTVTEKHKLNVPETMTE 834          

HSP 2 Score: 444.121 bits (1141), Expect = 4.471e-128
Identity = 244/633 (38.55%), Postives = 358/633 (56.56%), Query Frame = 1
Query: 2833 LDSVQLIQRPVRAG-----------FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT-KPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV---KTCIHDISIVDESERKFAE 4683
            LD+V L   PV +G           FL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++    T+P + + E LA R+I +  S     GP+++EIPH A+LR  ERE+V+L+S+ G SWKEH    T   +   L  + E++ T E   R RI RIIT   PQYF+ +SR+KQD   IG EGG ++S+V  QVQAVFPEGAL K+I++ LQ   +  N+++K  GN    SPIVTLEPRRRKFH+ IT+T+P+P  +       +   T +LRLLCSI+G  TP  WEDITGT+PLT  + CVSFTT +SAR WLIDC +  E +  ++ +Y E   VP++ +F++F +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    + +  GN++P+T S +        F+ENRL+ + +I+D +  PCG+++FM++PR                 + L Q  IC L+ITLP+     + L  +D          P ++ E       K E  +  +A  +G  W +L  +LG  +E+I  I  ++  +  D+++  L  W    ++ Q +     L   L  I R DIV   +T ++  +  D S   +AE
Sbjct:  940 LDNVALSSSPVHSGRCSPCHGDHSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCSAPTRITCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFASLRGRERELVILRSETGESWKEHHCEHTQEELNQILNGMDEDLDTPEELERKRICRIITRDFPQYFAAVSRIKQDSHLIGPEGGILSSTVVPQVQAVFPEGALTKRIRVGLQAQPVSVNVVRKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPGSNSDPVLNGFGGYTPTLRLLCSITGGTTPAQWEDITGTTPLTFINDCVSFTTNVSARFWLIDCRQVQESINFSTQVYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFYAFKENRLALFIKIRDNTQEPCGRLSFMKEPRN---------------YRALTQNAICNLNITLPSYSKVSRTLEKLD----------PQEEAE-------KREQRLAVIADHLGFSWTELARDLGFSEEKINTIRNENPNSLLDQSHALLNQW--AQREAQHATAEATLVKQLTKINRMDIVHLIETGLNRSTQEDTSSHTYAE 1538          

HSP 3 Score: 340.502 bits (872), Expect = 2.062e-94
Identity = 244/775 (31.48%), Postives = 392/775 (50.58%), Query Frame = 2
Query:  119 TKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDS----RSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGN-----------------------------KEIMELLLDANAD--------------------------VNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTV 2266
            T+D  T  A A     + G+ + V   L+ D K  +     L A+H+AA++ + +   LL++N  + D+ ++ G T LHIA+  G + V +LLL   A ++  ++NG TPL++A++  + ++V++LL+ G+     T DG TPL  A + G++  V++LL+  +    R+K  L  LH+AA+ D V     L+      VD  +    T LH+AAH  +  V KLL++K A+ N  A N  TPLH+A K  + ++++LL+   A++ +VT  GL+PIH AA  G  NI+L+LL+NGA     +  G T+L MA +  QAEV + L+  G  VDA   +  T LH+A+  G     ++LL++  + +A   NG+TPLHI+ ++ Q +   +L++  A  +  T+ G TPLH+ +  GS ++  +LL+  A            LH+AA  + ++   +LLL   A+ +  A+   TPLHIA +     I   LL  GA+ N +TK   T LH+A++EG  +++ LL+    + +  TK G T LH+A++  RV VA ++L+    N +     G TPL VA +Y + +M+  LL   A+VN   KNGYTPLH  A++    +  +L+  GA  NA +  G T L +    G                               E M  +LD + +                          +  Q  +G+  LH + E  RTD  E+         T T  GY   ++  H G ++ V
Sbjct:  161 TEDGFTPLAIAL----QQGHNQVVSILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQK-VALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVA-EILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLRVVTEEVVTTTTTVTEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDLRELGDDSLPGQYLDGMNYLHFSLEGGRTDSAERSF-------TPTHHGY---YSPRHEGVLEDV 914          

HSP 4 Score: 245.358 bits (625), Expect = 7.815e-65
Identity = 175/559 (31.31%), Postives = 281/559 (50.27%), Query Frame = 2
Query: 1010 KSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTT--------------------MKCEN---------ALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYG---------------------------------RVQVARQLLL-SAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPE 2497
            KS +  + L+ A  G+  +V + L   G+D+     + L ALH+AA  G+++  + LL     V++    G T LHI+    Q+++V+ L+K  A IN+ ++ G TPL++AA     ++V  LL+NG + S  T                    +  EN         ALH+AAR +  ++   LLL  + N + +++   TPLHIA   GN ++   LLN GA  +   ++  T LH+A+K G   + RLLL+   + DAKT+ G TPLH A++ G                                  V+  + LL   A V+  +L +  LT LHVA +  HY + +LLLD  AN N    NG+TPLH+  KKN ++V +LL+  GA++ A ++ G TP+H+ +  G+  I+ LLL   A  +     G T+LH+AA   + ++V  LL+  A +  + +   T LH A   G+ + V++LLQ     +A T  G T LH++A++G +    +LL+     +   K+G T L V  K   L++A+ L +    P+
Sbjct:   29 KSDSNTSFLRAARAGNIDKVLEYL-KGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKS-AALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDY--LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPD 583          
BLAST of Ankyrin-2 vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 417/809 (51.55%), Postives = 569/809 (70.33%), Query Frame = 2
Query:  131 LTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMID 2557
            L++   +FLRAAR+GN++KV E+L+  +     N NGLNA+HLAAKEG+ ++VQ L++ G  VD +T+KGNT+LHI+SLAG+ EVV  L++  A+IN +SQNGFTPLYMAAQENHLDVV+ LLE G NQ+  T+DGFTPLA+ALQQG+++VV ILL+ND++ KVRLPALHIAA+KDD  +A+LL+  +D N D QS SGFTPLHIAAHY NVNVA LL+ + A V+F A+N ITPLHVA+K G   M++LL+ + + +++ TRDGL+P+HCAARSG E  + +LLE GA +  ++KNGL+ L MA QGD  E  K L+     VD VT+DYLTALHVAAHCG+    ++LL    N NARALNGFTPLHIACKK + K++ELL+KY A I + TE+GLTP+H+AAFMG   IV +LL+NGAS   + ++ E +LH+AAR  Q E  + LL +  A  +ARARE+QTPLHIA R+G   IV+ LL   A P+  T + YT LHI+A+EG+ E + +LLE        TKKGFTPLH+ SKYG + VA+ LLL  +  P+S G +GLTPLHVA +Y++ ++  LLLD  A+ +   KNGYTPLH+ AKKN +++  +L+  GA  NA +++G TPLHL S  G+ ++  LL+   A +N   ++GLTALHLAA+++R  + E L++  A++  +T++GYT L  A H+G  + V  LLQ    VNA+T  G T LH AAQQG+  I+ +LL +    N     G TAL +A++  Y+++ +TL  VT      + +  +K  L+ PE M +
Sbjct:   44 LSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLL-QNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRN-GAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAK-LLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLRVVTEEVVTTTTTVTEKHKLNVPETMTE 849          

HSP 2 Score: 444.121 bits (1141), Expect = 4.885e-128
Identity = 244/633 (38.55%), Postives = 358/633 (56.56%), Query Frame = 1
Query: 2833 LDSVQLIQRPVRAG-----------FLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPT-KPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV---KTCIHDISIVDESERKFAE 4683
            LD+V L   PV +G           FL+SF+VDA+GG M+  RH  +RI +P      PTRI C L ++    T+P + + E LA R+I +  S     GP+++EIPH A+LR  ERE+V+L+S+ G SWKEH    T   +   L  + E++ T E   R RI RIIT   PQYF+ +SR+KQD   IG EGG ++S+V  QVQAVFPEGAL K+I++ LQ   +  N+++K  GN    SPIVTLEPRRRKFH+ IT+T+P+P  +       +   T +LRLLCSI+G  TP  WEDITGT+PLT  + CVSFTT +SAR WLIDC +  E +  ++ +Y E   VP++ +F++F +  +  E ++RC C+TDD  +KTLE QENF  ++    VEVLE    + +  GN++P+T S +        F+ENRL+ + +I+D +  PCG+++FM++PR                 + L Q  IC L+ITLP+     + L  +D          P ++ E       K E  +  +A  +G  W +L  +LG  +E+I  I  ++  +  D+++  L  W    ++ Q +     L   L  I R DIV   +T ++  +  D S   +AE
Sbjct:  955 LDNVALSSSPVHSGRCSPCHGDHSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCSAPTRITCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFASLRGRERELVILRSETGESWKEHHCEHTQEELNQILNGMDEDLDTPEELERKRICRIITRDFPQYFAAVSRIKQDSHLIGPEGGILSSTVVPQVQAVFPEGALTKRIRVGLQAQPVSVNVVRKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPGSNSDPVLNGFGGYTPTLRLLCSITGGTTPAQWEDITGTTPLTFINDCVSFTTNVSARFWLIDCRQVQESINFSTQVYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFYAFKENRLALFIKIRDNTQEPCGRLSFMKEPRN---------------YRALTQNAICNLNITLPSYSKVSRTLEKLD----------PQEEAE-------KREQRLAVIADHLGFSWTELARDLGFSEEKINTIRNENPNSLLDQSHALLNQW--AQREAQHATAEATLVKQLTKINRMDIVHLIETGLNRSTQEDTSSHTYAE 1553          

HSP 3 Score: 339.732 bits (870), Expect = 3.936e-94
Identity = 244/775 (31.48%), Postives = 392/775 (50.58%), Query Frame = 2
Query:  119 TKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDS----RSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGN-----------------------------KEIMELLLDANAD--------------------------VNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTV 2266
            T+D  T  A A     + G+ + V   L+ D K  +     L A+H+AA++ + +   LL++N  + D+ ++ G T LHIA+  G + V +LLL   A ++  ++NG TPL++A++  + ++V++LL+ G+     T DG TPL  A + G++  V++LL+  +    R+K  L  LH+AA+ D V     L+      VD  +    T LH+AAH  +  V KLL++K A+ N  A N  TPLH+A K  + ++++LL+   A++ +VT  GL+PIH AA  G  NI+L+LL+NGA     +  G T+L MA +  QAEV + L+  G  VDA   +  T LH+A+  G     ++LL++  + +A   NG+TPLHI+ ++ Q +   +L++  A  +  T+ G TPLH+ +  GS ++  +LL+  A            LH+AA  + ++   +LLL   A+ +  A+   TPLHIA +     I   LL  GA+ N +TK   T LH+A++EG  +++ LL+    + +  TK G T LH+A++  RV VA ++L+    N +     G TPL VA +Y + +M+  LL   A+VN   KNGYTPLH  A++    +  +L+  GA  NA +  G T L +    G                               E M  +LD + +                          +  Q  +G+  LH + E  RTD  E+         T T  GY   ++  H G ++ V
Sbjct:  176 TEDGFTPLAIAL----QQGHNQVVSILLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLL-QHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQK-VALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVA-EILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLRVVTEEVVTTTTTVTEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYLRPEDLRELGDDSLPGQYLDGMNYLHFSLEGGRTDSAERSF-------TPTHHGY---YSPRHEGVLEDV 929          
BLAST of Ankyrin-2 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 384/783 (49.04%), Postives = 548/783 (69.99%), Query Frame = 2
Query:  137 EKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVT 2485
            + A +FLRAARSGN++K  + ++  I  +++N NGLN +HLA+KEG+ ++V  L+ +G+ ++  T+KGNT+LHIA+LAG+ +VV+ L+   AN+N +S  GF+PLYMAAQENHL+VVK LLE GANQ++ T+DGFTPLAVALQQG++ VV +L++  ++ KVRLPALHIAA+ DD   A++L+  +D N D  S +GFTPLHIAAHY N++VA+LL+ + A+VNF  KN ITPLH+A++ G   M++LL+ + A +++ T+D L+P+HCAAR+G   II ILLE+GA IQ K+KNGL+ + MA QGD  +  + L+    ++D +T+D+LT LHVAAHCG+   A+VLL      NARALNGFTPLHIACKK   + ++LL+K+ A + + TE+GLTPLH+AAFMG   IV  LL+ GAS + + +K E  LH+A+R    E  + LL +  A  +ARA+++QTPLH A RMG+  +V+ LL+  A+P+  T   +T LHIAA+EG     R+LL+   +    TKKGFTPLH+ASKYG+V VA +LLL    NPN+ G +GLTPLHVA ++N+ ++++LL+    + +   +NGYTPLH+ AK+N IEV  +L+  GA+ N +S +G TPLHL S  G  +++ +L+   A+VN   +NGLT LHL A++    I + L+K  A +   ++MGYT LH A H+G I+ VK LLQ+   VNA+T +G T LH AAQQGH  IV LLL +    N     G + L +A++  Y+++ + L  VT
Sbjct:    9 DAATSFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLL-QNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQN-AAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVA-ELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKLVT 788          

HSP 2 Score: 395.201 bits (1014), Expect = 3.929e-112
Identity = 218/608 (35.86%), Postives = 342/608 (56.25%), Query Frame = 1
Query: 2836 DSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPL-PNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQ-LSLKITPFQENRLSFYARIKDLSNPPCGKVAFM------EDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQS-GTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKT 4632
            D+V  +  P+  GFL+SF+VDA+GG M+  RH  +R+ +P  +   PTRI C L + +   T P L + E LA RII L  S+    GP+++EIPH A+L +G+RE+VVL+S+NG+ WKEH N + D  ++  L  + E++++ E   + RI+RII+T  P YF+++SR++Q+   IG EGG + S +   V+A+FPE A+ K++++ LQ   I   L+ +  GN    SP+VT+EPRRRKFH  I L +PL P+W ++ R       T+SLRLLCS+ G   P  WEDITGT+ L     C SFTT +SAR WL DC RT E V  A+ LY+E   +P++ +F++F +     E ++RC C+TDD  +KTLE  ENF  ++    +E++E     LE SGN++PI  + +Q  S     F++NRL    +++D +    G ++F+      ED                       Q  +C L+IT+P  P  K             +   ++++    RT+  + L +RE    +     +L   L  G ++I RI +++  +  D++   L LW   +++ +K+ +   L  +LR+I R DIV +
Sbjct:  884 DNVSPVASPIHTGFLVSFMVDARGGSMRGSRHHGLRVIIPPRTCAAPTRITCRLVKPQKLTTPPPLVEGEGLASRIISLGPSSMQFLGPVIVEIPHFASLGRGDRELVVLRSENGSVWKEHRNRYGDEVLETILNGMDEDLESQEELEKKRIRRIISTDFPLYFAVVSRIQQESDLIGPEGGRLTSKLVPHVEAIFPESAVTKRVRLGLQAQPIPDELLTRQLGNQATFSPVVTIEPRRRKFHRPIGLRIPLPPSWRESPRDAGEG-DTTSLRLLCSVIGGTAPAQWEDITGTTKLMYAHNCASFTTNVSARFWLADCPRTAEAVTFANLLYKELMAIPYMAKFVIFAKMNEAREGRLRCYCMTDDKMDKTLELHENFSEVARSRDIELMEGMPLHLECSGNLVPIRKATQQPRSFSFQAFRDNRLPVSVKVRDSNKEATGFLSFLRKCTKYED----------------------AQHVLCNLNITMP--PCVK-------------VAGSEERR----RTL--TPLALRERYSALNDPAAELARELQFGVDDINRIRVENPNSLLDQSSTLLNLW--ASREGKKAKM-ESLYTALRNIDRADIVAS 1444          
BLAST of Ankyrin-2 vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 347/802 (43.27%), Postives = 497/802 (61.97%), Query Frame = 2
Query:  137 EKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTN---LGC------------TSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPE 2497
            +  ++FLRAARSGN++K  E ++  I  + +N NGLNA+HLA+KEG+ ++V  L+ NG+ ++  T+KGNT+LHIA+LAG+ +VV+ L+    N+N +SQ GFTPLYMAAQENHL+VVK LLE GANQ+I T+DGFTPLAVALQQG++ VV +L+   ++ KVRLPAL                    D     S +GFTPLHIAAHY N+NVA+LL+ + A+      + +TPLH AA+ G   ++++L+   A + + T++GLSPIH                                 MA QGD  +  K L+    ++D +T+D+LT LHVAAHCG+   A+VLL      N+RALNGFTPLHIACKK   ++++LL+K+ A I + TE+GLTPLH+A+FMG   IV ILL+ GAS S + +K E  LH+A+R+   E  + LL +  A  +A+A+++QTPLH A RMG+  +V+ LL   A+PN  T   ++ LHIAA+EG  +  RLLL+ + +    TKKGFTPLH+ASKYG+V VA +LLL    NPN+ G +GLTPLHVA ++N+ +++ LL+    + +   +NGYT LH+ AK+N +EV   L+  GA+ NA+S +G TPLHL S  G  +I+ LL+   A+VN   ++GLT LHL A++    I + L+K  A +   T+MGYT LH A H+G I+ VK LLQ+  +VN++T    + C            T LH     G+I+++ +L              L   E    +H ++  ET+ ++  V E
Sbjct:    6 DAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPAL-------------------TDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAN------DELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIH---------------------------------MAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQN-AAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVA-ELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCHYKDHYCEYKHTTPLHTHLWLGYISVIDVL-------------KLVTEETVSMKHRMSFPETVDEILDVSE 734          

HSP 2 Score: 400.593 bits (1028), Expect = 5.582e-114
Identity = 218/604 (36.09%), Postives = 345/604 (57.12%), Query Frame = 1
Query: 2836 DSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPL-PNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQ-LSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLI---FNPDDKKERMCRTIV-KSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALL-LWITTTKDIQKSNLGNQLELSLRDIGREDIV 4626
            D+V  +  P+  GFL+SF+VDA+GG M+  RH  +R+ +P  +   PTRI C L + +   + P L + E LA RII L  +     GP+++EIPH AAL +G+RE+VVL+S+NG+ WKEH N + D  ++  L  + E +++ E   + RI+RII+T  P YF+++SR++Q+   IG EGG++ S +   VQA FPE A+ K++++ LQ   +   L+ K  GN    SP+VT+EPRRRKFH  I L +PL P+W D+ R       T+SLRLLCS+ G      WEDITGT+ L   + C SFTT +SAR WL DC RT E V  A+ LY E   VP++ +F+VF +     E ++RC C+TDD  +KTLE  ENF  ++    +EV+E     LE SGN++P+  + +Q        F++NRL    +++D S  P G ++F+        S++   +          Q  +C L+IT+P   T +G  +     +   +   +N  ++      + + ++EL +  +A ++G  W +L   L +  ++I +I +++     +   ALL LW   T++ +++ +   L  +L+ I R DI+
Sbjct:  806 DNVSPVASPIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPTRITCRLVKPQKLTSPPPLVEGEGLASRIISLGPAGMQFLGPVIVEIPHFAALGRGDRELVVLRSENGSVWKEHRNRYGDEVLETILNGMDEELESQEELGKKRIRRIISTDFPLYFAVVSRVQQESDLIGPEGGSLTSKLVPMVQATFPETAVTKRVRLGLQAQPVPDELVAKLLGNQANFSPVVTVEPRRRKFHRPIGLRIPLPPSWRDSPRD-SGEGDTTSLRLLCSVIGGTASAQWEDITGTTKLIYANDCASFTTNVSARFWLADCPRTAEAVSFANLLYRELSAVPYMAKFVVFAKMNELREGRLRCYCMTDDKMDKTLEQHENFAEVARSRDIEVMEGMPLHLECSGNLLPVRKATQQPRCFSFQAFRDNRLPVTVKVRDSSKEPTGFLSFLRK------STKYEDS----------QHVLCNLNITMPPCITMRGSEDRRRTLTPLALRERYNALNEPAMASMSAMERTELKMAVIAEQLGLSWAELARELQLSVDDINKIRVENPNSLLEQSSALLNLW--ATREGKRAKM-ESLYTALKSIDRMDII 1389          
BLAST of Ankyrin-2 vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 506.138 bits (1302), Expect = 8.996e-164
Identity = 252/440 (57.27%), Postives = 340/440 (77.27%), Query Frame = 2
Query:   95 RIFQMVEETKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTM 1414
            ++F     T DS      ++LRAAR+GN+EKV ++L++ ++ ++ N NGLNA+HLA+KEG+ EVV  L++ G SVD AT+KGNT+LHI+SLAG+ EVV+ L+ + AN+N +SQNGFTPLYMAAQENHL+VV+ LLE  A+Q+I T+DGFTPLAVALQQG+D+VV +LL+ND++ KVRLPALHIAA+KDD  AA+LL+  +D N D +S SGFTPLHIAAHY N+NVA LL+ + A V+F A+N+ITPLHVAAK G   M+KLL+ + A + + T+DGL+P+HC ARSG E ++ ILL+ GA I  K+KNGL+ L MATQGD     + L+   + VD VT DYLTALHVAAHCG+   A++++    N NA+ALNGFTPLHIACKK + +++ELL+K+ A I + TE+GLTP+H+AAFMG + IV+ L+ +GAS + T +
Sbjct:    6 QLFNESSRTSDSNA----SYLRAARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL-QNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGASPNTTNV 440          

HSP 2 Score: 214.157 bits (544), Expect = 8.943e-60
Identity = 134/398 (33.67%), Postives = 220/398 (55.28%), Query Frame = 2
Query: 1280 IKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            +K    IN   + GL  LH+A+  G  E+V  LLK GAS+   T K   ALH+++   Q E    L+ +  AN NA+++   TPL++A +  +  +V  LL   A  ++ T+D +T L +A ++G  ++  LLLE+    D K K     LHIA++    + A  LLL    N +     G TPLH+A +Y +  +  LLL+  A V+ + +N  TPLH+ AK+    + KLL+DRGA + A+++ G TPLH  + +G+++++E+LLD  A +  + +NGL+ LH+A + +  + V+ LL+ +  +   T    TALH A H G  +  K+++ K  + NA+   G T LH+A ++  + ++ LLL +   +    + GLT + VA    + NI   L
Sbjct:   37 LKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTN-GANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAA-ALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSAL 428          

HSP 3 Score: 208.379 bits (529), Expect = 9.415e-58
Identity = 136/422 (32.23%), Postives = 231/422 (54.74%), Query Frame = 2
Query: 1142 AAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQN 2407
            AA  GN+      LK+   +N    NG   LH+A K+   ++V  L+K  A +++ T+ G T LHI++  G  E+V  L+ NGA+++  +      L++AA+ N  E  +  LL   A+ +    +  TPL +A++ G+  +V  LL    + +   K    ALHIAA++   + + LLL++    D ++K GFTPLHIA+ YG + VA  LLL+     + +  + +TPLHVA    +  M++LLLD  A +    K+G TPLH  A+    +V ++L+DRGA + ++++ G +PLH+ +   +   ++LLL  +  V+    + LTALH+AA      + + ++  +A+ + K   G+T LH A    +++ +++LL+    + A T  G T +H+AA  GH  IV  L+++    N  N
Sbjct:   24 AARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVR-FLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVA-TLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGASPNTTN 439          

HSP 4 Score: 192.2 bits (487), Expect = 3.485e-52
Identity = 129/380 (33.95%), Postives = 202/380 (53.16%), Query Frame = 2
Query: 1340 AAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSK 2479
            AA  G+ E V   LK+G  I+       NALHLA++    E     LL   A+ +A  ++  T LHI+   G   +V +L+  GA+ N  +++ +T L++AA+E   E+ R LLE+       T+ GFTPL +A + G  QV   LL       ++ G   L  LH+A   +  +   LLL  + N +   K+G+TPLH+ A    I V  LL++R A V+  ++   TPLH+ +  GN  +++LLLD  A +  + ++GLT LH  A      +VE LL   A I +KT+ G + LH A     +  V++LLQ +  V+  TN   T+LH+AA  GH  + +L++D + + N +   G T L +A K++ + + E L K
Sbjct:   24 AARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVA-ELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLL-----ENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLK 397          

HSP 5 Score: 173.326 bits (438), Expect = 1.015e-45
Identity = 113/355 (31.83%), Postives = 184/355 (51.83%), Query Frame = 2
Query: 1496 NFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTP-----------------------------LHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            N ++R  ++      A R GN   V   L +G + N+  ++   ALH+A+KEG  E+   LL+     DA TKKG T LHI+S  G+ +V  +L+ +   N N+   +G TPL++A   NH E++  LL+  A+ +   ++G+TP                             LH+ A+K+  +   LL+    N + +S+ GFTPLH+ +  GN  +  LLL+  A V+  A N +T LH+AA++  +++V+ LL   A I  KT+ G T LH     G  Q V++LL +   + ++T  G + LH+A Q  H+  V+LLL +++ V+      LTAL VA    +  +A+ +
Sbjct:    9 NESSRTSDSNASYLRAARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNG-ANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLI 362          
BLAST of Ankyrin-2 vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 1711.43 bits (4431), Expect = 0.000e+0
Identity = 865/867 (99.77%), Postives = 867/867 (100.00%), Query Frame = 2
Query:  107 MVEETKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMIDHSMXXXXXXXXXXXXXXXXXXXXXXXXIKDISRNNSLRKPNRPVSIGAFN 2707
            MVEETKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVC+TLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLL+KNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMIDHSMSDSEEEGSSLNLNSGSSRSSLNLSIKDISRNNSLRKPNRPVSIGAFN
Sbjct:    1 MVEETKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMIDHSMSDSEEEGSSLNLNSGSSRSSLNLSIKDISRNNSLRKPNRPVSIGAFN 867          

HSP 2 Score: 1521.14 bits (3937), Expect = 0.000e+0
Identity = 788/791 (99.62%), Postives = 789/791 (99.75%), Query Frame = 1
Query: 2752 FQGDLGYRHSANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDISIVDESERKFAETIINGGDPXXXXXXXXXHELTNSIESDAMEEEIAESKIKHEEFKSITXXXXXXXXXXXXXXXXXXXXXXXXXXEAELEKMNPNQDCYLGDXXXXXXXXXXXXXXXXAGKTAKSKYHSTVPGNFDLEELEEEIKPQKKMGLRSESYQI 5124
            F GDLGYRHSANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSI SELNGTVGSPLTQLLPQKP+CTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDISIVDESERKFAETIINGGDPSQKSSSLSSHELTNSIESDAMEEEIAESKIKHEEFKSITEEEERQLKQEKLLDLIDYLDSILPDPEAELEKMNPNQDCYLGDEIQEESIQIENISENQAGKTAKSKYHSTVPGNFDLEELEEEIKPQKKMGLRSESYQI
Sbjct:  866 FNGDLGYRHSANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSICSELNGTVGSPLTQLLPQKPLCTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDISIVDESERKFAETIINGGDPSQKSSSLSSHELTNSIESDAMEEEIAESKIKHEEFKSITEEEERQLKQEKLLDLIDYLDSILPDPEAELEKMNPNQDCYLGDEIQEESIQIENISENQAGKTAKSKYHSTVPGNFDLEELEEEIKPQKKMGLRSESYQI 1656          
BLAST of Ankyrin-2 vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 1694.09 bits (4386), Expect = 0.000e+0
Identity = 856/858 (99.77%), Postives = 858/858 (100.00%), Query Frame = 2
Query:  134 TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMIDHSMXXXXXXXXXXXXXXXXXXXXXXXXIKDISRNNSLRKPNRPVSIGAFN 2707
            TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVC+TLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLL+KNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMIDHSMSDSEEEGSSLNLNSGSSRSSLNLSIKDISRNNSLRKPNRPVSIGAFN
Sbjct:   70 TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMIDHSMSDSEEEGSSLNLNSGSSRSSLNLSIKDISRNNSLRKPNRPVSIGAFN 927          

HSP 2 Score: 1521.14 bits (3937), Expect = 0.000e+0
Identity = 788/791 (99.62%), Postives = 789/791 (99.75%), Query Frame = 1
Query: 2752 FQGDLGYRHSANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDISIVDESERKFAETIINGGDPXXXXXXXXXHELTNSIESDAMEEEIAESKIKHEEFKSITXXXXXXXXXXXXXXXXXXXXXXXXXXEAELEKMNPNQDCYLGDXXXXXXXXXXXXXXXXAGKTAKSKYHSTVPGNFDLEELEEEIKPQKKMGLRSESYQI 5124
            F GDLGYRHSANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSI SELNGTVGSPLTQLLPQKP+CTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDISIVDESERKFAETIINGGDPSQKSSSLSSHELTNSIESDAMEEEIAESKIKHEEFKSITEEEERQLKQEKLLDLIDYLDSILPDPEAELEKMNPNQDCYLGDEIQEESIQIENISENQAGKTAKSKYHSTVPGNFDLEELEEEIKPQKKMGLRSESYQI
Sbjct:  926 FNGDLGYRHSANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSICSELNGTVGSPLTQLLPQKPLCTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDISIVDESERKFAETIINGGDPSQKSSSLSSHELTNSIESDAMEEEIAESKIKHEEFKSITEEEERQLKQEKLLDLIDYLDSILPDPEAELEKMNPNQDCYLGDEIQEESIQIENISENQAGKTAKSKYHSTVPGNFDLEELEEEIKPQKKMGLRSESYQI 1716          

HSP 3 Score: 225.328 bits (573), Expect = 7.165e-59
Identity = 165/552 (29.89%), Postives = 271/552 (49.09%), Query Frame = 2
Query: 1004 QHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTT--------------------MKCEN---------ALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYG------------------------RVQVAR--------QLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVE-QLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            Q KS     A   A +    E  K  +   I  D    + L A+H+AA  GN    ++L++N  +V+     G T LHIA    + ++V LL++ KA+IN  ++ G TPL++AA     ++V +LL+ GA+ + TT                    +  +N         ALH+AA+ +      +L+   + N + ++    TPLHIA    N ++ + L+   AD N   K+N T LH+AAK G+ E+ +LL+  +   ++ T+ G +P+H A++ G                         +Q+A         Q L++  ++ +++    LT LHVA +  +    E+LL    NVN    NG+TPLH+  KK   ++ +LLI   A++N+ ++ G TPLH+ +  G+KEI+ +LL   A ++        ALHLAA  N+ +  +  LL  EA+ + + +   T LH AV  G    V+ LL    D N  T    T+LH+AA++G   I RLLL+++   + + K+G T L +A K   + +A  L
Sbjct:   66 QKKSTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQL 617          
BLAST of Ankyrin-2 vs. Planmine SMEST
Match: SMESG000026655.1 (SMESG000026655.1)

HSP 1 Score: 1693.32 bits (4384), Expect = 0.000e+0
Identity = 856/858 (99.77%), Postives = 858/858 (100.00%), Query Frame = 2
Query:  134 TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMIDHSMXXXXXXXXXXXXXXXXXXXXXXXXIKDISRNNSLRKPNRPVSIGAFN 2707
            TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVC+TLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLL+KNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMIDHSMSDSEEEGSSLNLNSGSSRSSLNLSIKDISRNNSLRKPNRPVSIGAFN
Sbjct:   90 TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLEKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMSGSEEKKLILDQPEKMIDHSMSDSEEEGSSLNLNSGSSRSSLNLSIKDISRNNSLRKPNRPVSIGAFN 947          

HSP 2 Score: 1522.29 bits (3940), Expect = 0.000e+0
Identity = 788/791 (99.62%), Postives = 789/791 (99.75%), Query Frame = 1
Query: 2752 FQGDLGYRHSANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDISIVDESERKFAETIINGGDPXXXXXXXXXHELTNSIESDAMEEEIAESKIKHEEFKSITXXXXXXXXXXXXXXXXXXXXXXXXXXEAELEKMNPNQDCYLGDXXXXXXXXXXXXXXXXAGKTAKSKYHSTVPGNFDLEELEEEIKPQKKMGLRSESYQI 5124
            F GDLGYRHSANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSI SELNGTVGSPLTQLLPQKP+CTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDISIVDESERKFAETIINGGDPSQKSSSLSSHELTNSIESDAMEEEIAESKIKHEEFKSITEEEERQLKQEKLLDLIDYLDSILPDPEAELEKMNPNQDCYLGDEIQEESIQIENISENQAGKTAKSKYHSTVPGNFDLEELEEEIKPQKKMGLRSESYQI
Sbjct:  946 FNGDLGYRHSANLYAITPTPNNDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSICSELNGTVGSPLTQLLPQKPLCTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDISIVDESERKFAETIINGGDPSQKSSSLSSHELTNSIESDAMEEEIAESKIKHEEFKSITEEEERQLKQEKLLDLIDYLDSILPDPEAELEKMNPNQDCYLGDEIQEESIQIENISENQAGKTAKSKYHSTVPGNFDLEELEEEIKPQKKMGLRSESYQI 1736          

HSP 3 Score: 224.942 bits (572), Expect = 8.420e-59
Identity = 165/552 (29.89%), Postives = 271/552 (49.09%), Query Frame = 2
Query: 1004 QHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTT--------------------MKCEN---------ALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYG------------------------RVQVAR--------QLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVE-QLLKTEADISTKTQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETL 2473
            Q KS     A   A +    E  K  +   I  D    + L A+H+AA  GN    ++L++N  +V+     G T LHIA    + ++V LL++ KA+IN  ++ G TPL++AA     ++V +LL+ GA+ + TT                    +  +N         ALH+AA+ +      +L+   + N + ++    TPLHIA    N ++ + L+   AD N   K+N T LH+AAK G+ E+ +LL+  +   ++ T+ G +P+H A++ G                         +Q+A         Q L++  ++ +++    LT LHVA +  +    E+LL    NVN    NG+TPLH+  KK   ++ +LLI   A++N+ ++ G TPLH+ +  G+KEI+ +LL   A ++        ALHLAA  N+ +  +  LL  EA+ + + +   T LH AV  G    V+ LL    D N  T    T+LH+AA++G   I RLLL+++   + + K+G T L +A K   + +A  L
Sbjct:   86 QKKSTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCQTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQL 637          
BLAST of Ankyrin-2 vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 899.042 bits (2322), Expect = 0.000e+0
Identity = 453/787 (57.56%), Postives = 589/787 (74.84%), Query Frame = 2
Query:  134 TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKML--LQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTT 2488
            +E  H+FLRAAR+GN+ KV +FL+     +  N  GL+A+HLAAKEG+  +V+ LI+    +D  T+KGN++LHIASLAGK EVV +L+E+ AN+N++S NGFTPLYMAAQENHL+VV  L+  GA+Q ITT+DGFTPLAVALQQG++++V +LL+ND+RSK RLPALHIA KK+DVNA +LL+ SS+ +V+HQS+SGFTPLHIAAHY N   A+LLIE+ ADVNF AKNNITPLHVAAKWG+  M++LLI   A V+  TRDGL+P+HC+ARSG   +   L++NGAD+  K++NGLT+L MA QGD  +  + L+ K  +++  T D+LT LHV AH GN   A VLL   C+ NARALNGFTPLHIACKK + K+VELL+KY A I +TTETGLTPLH++AF+GSKE VN+LL+ GA+I Q TM+ E ALHLA RNNQ ET K LLL   A  +A+ARENQTPLH+A ++GN  ++   L +G+DPN+ T+DNYTALH+AAKEGR E   LLL+   K +A+TK+GFTPLHIA+KY +V VA  +LL  K NPN+ G +GLTPLHVAT+YNH ++ +LLLD +A+  C  KNGYTPLH+ AKKN  ++  +L+   A+ NA+S+ GF+PL L S  G+ +++ LLL   ADVNH+A+NGLT++HL A++++  +   L+   ADI+  T   YT LHTA HFGQI   K L  L     +N +T LG T LHLAAQQGH+ +V LLL++  D N +N QG TA  +A+KQHYLNI E L KVTT
Sbjct:    9 SESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVK-LLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVA-SILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTT 793          

HSP 2 Score: 577.015 bits (1486), Expect = 1.401e-171
Identity = 285/624 (45.67%), Postives = 413/624 (66.19%), Query Frame = 1
Query: 2815 NDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCR-TIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDISIV-DESERKFA 4680
            +DW+ E ++V ++++PV +GFL+SF+VDA+GG MQA R  ++R YVP +S  GPTR++C L +     + P L D +  ACRI+ +       + PIL+E+PH A+LR  ERE+++L+S+NG +WKEH    TD A+Q+++G   E + T E    NRIQRI+T+ LPQYF+LISR++Q++A IG EG  ++SSV  QVQAVFPEGAL KK ++ +Q H I   ++ +  GN VA SPI+++EPRRRKFH+ ITLT+PLP   +          TSSLRLLCSI+G + P VWEDI+G++PL+    CVSFTTT+SAR+WLIDC     + ++A+ +Y ES +VP++GQF+V+ RR + EE Q R L +TDD+ +KTLE QENF+LI+SGPLVEVL N  +W+E++GN++P+T + +QLS+ I    ENR+SF  R+KD+   P GK+A +   R   + +      G+ L     QKPI TL+I LP++     ++ + +      +   +  K  +C   I KSEL++R VA ++GGDW+KL   LG+   E       + ++E  AY  L+LW +   D+     GN+LE +LRDIGRED+VK C+ +IS V DE E+  A
Sbjct: 1064 SDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGA------GNALGTSAVQKPITTLEICLPSE-----IHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLV---CGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQA 1673          
BLAST of Ankyrin-2 vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 899.042 bits (2322), Expect = 0.000e+0
Identity = 453/787 (57.56%), Postives = 589/787 (74.84%), Query Frame = 2
Query:  134 TEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMHLAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLESKANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAVALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNVDHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKWGKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQHKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCGNINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINSTTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQEETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNMVTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGRVQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNCLYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGNKEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTKTQMGYTALHTAVHFGQIQTVKML--LQKNFDVNAQTNLGCTSLHLAAQQGHIAIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTT 2488
            +E  H+FLRAAR+GN+ KV +FL+     +  N  GL+A+HLAAKEG+  +V+ LI+    +D  T+KGN++LHIASLAGK EVV +L+E+ AN+N++S NGFTPLYMAAQENHL+VV  L+  GA+Q ITT+DGFTPLAVALQQG++++V +LL+ND+RSK RLPALHIA KK+DVNA +LL+ SS+ +V+HQS+SGFTPLHIAAHY N   A+LLIE+ ADVNF AKNNITPLHVAAKWG+  M++LLI   A V+  TRDGL+P+HC+ARSG   +   L++NGAD+  K++NGLT+L MA QGD  +  + L+ K  +++  T D+LT LHV AH GN   A VLL   C+ NARALNGFTPLHIACKK + K+VELL+KY A I +TTETGLTPLH++AF+GSKE VN+LL+ GA+I Q TM+ E ALHLA RNNQ ET K LLL   A  +A+ARENQTPLH+A ++GN  ++   L +G+DPN+ T+DNYTALH+AAKEGR E   LLL+   K +A+TK+GFTPLHIA+KY +V VA  +LL  K NPN+ G +GLTPLHVAT+YNH ++ +LLLD +A+  C  KNGYTPLH+ AKKN  ++  +L+   A+ NA+S+ GF+PL L S  G+ +++ LLL   ADVNH+A+NGLT++HL A++++  +   L+   ADI+  T   YT LHTA HFGQI   K L  L     +N +T LG T LHLAAQQGH+ +V LLL++  D N +N QG TA  +A+KQHYLNI E L KVTT
Sbjct:    9 SESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVK-LLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVA-SILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTT 793          

HSP 2 Score: 577.015 bits (1486), Expect = 1.278e-171
Identity = 285/624 (45.67%), Postives = 413/624 (66.19%), Query Frame = 1
Query: 2815 NDWEMELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGPTRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHSAALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQTRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFPEGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAITLTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTIKDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFCRRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLESSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDPRIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFSNDLIFNPDDKKERMCR-TIVKSELNIREVALKVGGDWKKLTINLGMGQEEITRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIVKTCIHDISIV-DESERKFA 4680
            +DW+ E ++V ++++PV +GFL+SF+VDA+GG MQA R  ++R YVP +S  GPTR++C L +     + P L D +  ACRI+ +       + PIL+E+PH A+LR  ERE+++L+S+NG +WKEH    TD A+Q+++G   E + T E    NRIQRI+T+ LPQYF+LISR++Q++A IG EG  ++SSV  QVQAVFPEGAL KK ++ +Q H I   ++ +  GN VA SPI+++EPRRRKFH+ ITLT+PLP   +          TSSLRLLCSI+G + P VWEDI+G++PL+    CVSFTTT+SAR+WLIDC     + ++A+ +Y ES +VP++GQF+V+ RR + EE Q R L +TDD+ +KTLE QENF+LI+SGPLVEVL N  +W+E++GN++P+T + +QLS+ I    ENR+SF  R+KD+   P GK+A +   R   + +      G+ L     QKPI TL+I LP++     ++ + +      +   +  K  +C   I KSEL++R VA ++GGDW+KL   LG+   E       + ++E  AY  L+LW +   D+     GN+LE +LRDIGRED+VK C+ +IS V DE E+  A
Sbjct: 1064 SDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGA------GNALGTSAVQKPITTLEICLPSE-----IHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLV---CGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQA 1673          
The following BLAST results are available for this feature:
BLAST of Ankyrin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK31.734e-12251.87ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK29.063e-13252.30ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK39.140e-12550.94ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK27.986e-13452.30ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.107e-13052.30ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-444.236e-12554.56AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.236e-12554.56AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.529e-12554.56AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.529e-12554.56AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-449.167e-12554.56AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank22.550e-12455.10gene:FBgn0261788 transcript:FBtr0334060[more]
Ank21.891e-12455.10gene:FBgn0261788 transcript:FBtr0303117[more]
Ank22.882e-12455.10gene:FBgn0261788 transcript:FBtr0303115[more]
Ank21.814e-12455.10gene:FBgn0261788 transcript:FBtr0344223[more]
Ank21.916e-12455.10gene:FBgn0261788 transcript:FBtr0303121[more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank2b2.552e-12952.55ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041... [more]
ank2b3.289e-12052.49ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041... [more]
ank3a1.905e-11751.99ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.905e-11751.99ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a9.400e-11351.46ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm41.878e-12451.30tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm43.249e-12451.38tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm41.249e-12851.31tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm41.760e-12552.12tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.571e-12751.51tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank32.487e-12450.62ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.602e-12450.62ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.979e-12450.62ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank35.009e-12550.06ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.979e-12450.62ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of Ankyrin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q12955|ANK3_HUMAN8.325e-12251.87Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|G5E8K5|ANK3_MOUSE2.783e-12350.62Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|O70511|ANK3_RAT7.301e-12251.02Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|Q01484|ANK2_HUMAN3.634e-12251.79Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
sp|Q8C8R3|ANK2_MOUSE2.612e-12751.66Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
back to top
BLAST of Ankyrin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7Y8Z71.092e-16353.56Ankyrin-2 (Fragment) OS=Clonorchis sinensis OX=799... [more]
A0A4S2MA632.407e-16353.56Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M3X35.090e-16353.56Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M3V61.139e-16353.56Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M4H41.488e-16353.56Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3a4.592e-11550.94ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.165e-11450.43ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ENSAMXT00000017800.27.814e-11552.36pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ank3b1.571e-12150.98ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a7.990e-11050.25ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000095.10.000e+051.55pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.10.000e+050.80pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007446.11.322e-15349.90pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.11.787e-11848.17pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000006531.11.113e-10042.66pep scaffold:Pmarinus_7.0:GL477280:1359:33855:1 ge... [more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NAS65.028e-1735.48Evolutionarily conserved 19S regulatory particle a... [more]
HOS47.107e-1426.93Subunit of the Set3 complex; complex is a meiotic-... [more]
AKR11.067e-1331.20Palmitoyl transferase involved in protein palmitoy... [more]
GDE11.520e-1228.21Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
AVO25.244e-1230.67Component of a complex containing the Tor2p kinase... [more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454874.731e-7535.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454861.523e-4434.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387021.168e-2925.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436909.556e-2531.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391133.956e-2435.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ankyrin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000039458.14.471e-12851.81ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.14.885e-12851.55ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ank1b3.929e-11249.04ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ank1a5.582e-11443.27ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ENSORLT00000039903.18.996e-16457.27pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
back to top
BLAST of Ankyrin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026655.10.000e+099.77SMESG000026655.1[more]
SMESG000026655.17.165e-5999.77SMESG000026655.1[more]
SMESG000026655.18.420e-5999.77SMESG000026655.1[more]
SMESG000000606.11.401e-17157.56SMESG000000606.1[more]
SMESG000000606.11.278e-17157.56SMESG000000606.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012522 ID=SMED30012522|Name=Ankyrin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=5132bp
CGTTGAGCGGTTTCCCATATGTATTTGGAATTTCCCTCAGACATGACAGT
ACAGTTATTAAACTGTGATCAGAAGCACTGTTGAAGAATTTTTCAGGATC
TTTCAAATGGTCGAGGAGACAAAAGACAGCCTGACTGAAAAAGCTCATGC
ATTCCTTCGAGCTGCCAGATCGGGAAATGTTGAAAAAGTCAAAGAATTCC
TTCAAGCGGACATCAAACCAGATATGAGCAATGCAAATGGCCTAAATGCA
ATGCACTTGGCGGCGAAAGAAGGCAACAGAGAAGTCGTGCAATTGCTGAT
TGAAAATGGACTTTCAGTGGATATCGCTACGAGAAAAGGAAATACTTCAC
TACACATTGCAAGTCTGGCTGGTAAACTGGAAGTAGTAAGCTTACTTTTG
GAAAGCAAGGCAAATATTAACGTGAAAAGTCAAAATGGATTCACTCCACT
TTATATGGCCGCACAAGAAAACCATCTAGATGTTGTCAAAGTCCTACTAG
AGTATGGAGCTAATCAAGCAATAACGACAGATGATGGGTTTACGCCTTTG
GCAGTAGCGCTACAACAAGGCAATGACAAGGTCGTACAGATCCTTTTAGA
CAACGATTCTCGGAGTAAAGTGAGACTACCCGCCCTTCATATTGCTGCTA
AAAAGGATGATGTTAATGCAGCGAGCCTGTTAATCGGTTCATCAGATGAT
AATGTAGACCACCAATCTGCAAGTGGCTTCACACCTCTGCACATCGCTGC
TCACTACAACAATGTCAATGTGGCAAAACTACTCATAGAGAAAAATGCTG
ACGTGAATTTTCCAGCTAAAAATAACATCACTCCGTTGCATGTGGCCGCT
AAATGGGGAAAAGAGGAAATGCTGAAATTACTGATATCCCAAAAGGCAAA
CGTAAACAGCGTCACTCGGGATGGGCTCTCTCCAATTCATTGCGCCGCCA
GATCTGGATTTGAAAATATAATTTTGATTCTCTTGGAAAACGGAGCAGAT
ATCCAACACAAGTCGAAGAACGGTCTTACGGCTTTGCAAATGGCAACTCA
AGGAGATCAAGCTGAGGTTTGTAAGACATTAATAAATAAAGGAATAGATG
TTGATGCGGTGACAATGGACTACCTAACGGCATTACACGTAGCCGCTCAC
TGTGGAAATATAAATGCGGCAGAAGTTTTATTGAAGAATAATTGCAATGT
CAATGCTCGAGCATTGAACGGATTTACTCCCCTTCACATTGCTTGTAAAA
AGATCCAAAGTAAAATGGTGGAGCTACTCATCAAATATAAGGCGCATATC
AACAGTACGACTGAGACCGGACTGACTCCGTTGCACATCGCCGCATTTAT
GGGCAGCAAAGAAATCGTGAATATCTTGTTGAAGAACGGAGCGTCTATCA
GTCAAACAACGATGAAATGTGAAAATGCTCTCCATTTAGCTGCAAGGAAT
AATCAAGAAGAAACTTTCAAAATTTTATTACTTCACCCTGAAGCCAATTT
CAATGCTAGAGCAAGGGAAAACCAAACGCCGTTGCATATTGCTGTTAGAA
TGGGCAACTATTCAATTGTAGAACAATTATTAAACGCTGGGGCTGACCCA
AACATGGTTACCAAGGACAACTATACGGCTTTACATATCGCGGCAAAAGA
AGGAAGACACGAAATTAGTCGTCTACTTCTTGAACATCAATGCAAACCAG
ATGCTAAAACAAAGAAAGGATTCACGCCTCTCCACATAGCATCGAAATAC
GGAAGAGTTCAAGTCGCAAGACAATTGCTGTTGTCAGCCAAGGTCAATCC
AAACTCTCTCGGACATCATGGGCTAACCCCTCTTCATGTGGCGACTTATT
ATAACCATTACGAGATGATCGAACTGCTACTTGATACAGAAGCCAATGTC
AATTGCCTCTATAAAAATGGGTACACCCCACTGCATTTGGTGGCAAAAAA
GAACATGATAGAAGTGACGAAATTATTAATCGACAGAGGCGCTAACGTAA
ATGCGCAATCTCAAAAAGGATTTACTCCTCTACATTTGAATTCAATGGCC
GGTAACAAGGAAATCATGGAATTACTTCTGGACGCAAACGCCGATGTCAA
TCACCAAGCAGAGAATGGACTAACTGCGTTACATTTGGCGGCCGAGAAAA
ACCGAACAGATATCGTTGAACAATTGTTGAAGACTGAAGCAGATATATCA
ACGAAAACCCAGATGGGATATACGGCCTTGCATACTGCGGTACATTTCGG
ACAAATCCAAACCGTGAAAATGTTACTGCAAAAGAATTTCGATGTTAATG
CTCAAACAAATCTCGGATGTACGTCTTTACATCTCGCAGCCCAACAAGGC
CACATCGCAATTGTCAGATTGTTGTTGGATAATGAAATTGATGTCAACCA
TCAAAACAAGCAAGGACTAACCGCTCTTGAAGTCGCACAGAAACAGCACT
ATCTAAACATAGCGGAAACTCTCAGCAAGGTGACAACAGTACCGGAAATG
ATGTCAGGATCCGAGGAGAAAAAACTGATATTAGATCAACCGGAAAAAAT
GATTGACCATTCAATGTCAGACAGTGAGGAAGAAGGATCCTCTCTCAATT
TGAACTCGGGTTCTTCAAGAAGCAGCCTGAATTTAAGCATCAAAGACATT
TCGAGAAACAATTCCTTGAGGAAACCGAATCGACCAGTCTCAATTGGGGC
GTTCAATGTAAAATCAAATTGATTTGTACGATATCATTGAGAAATCTTTT
CTTTCAGGGAGATCTTGGGTATCGACATTCGGCTAATCTCTACGCAATCA
CTCCAACTCCGAACAATGACTGGGAGATGGAACTCGACAGTGTTCAGTTG
ATCCAAAGACCAGTTCGAGCCGGATTTCTCATATCTTTCATCGTCGATGC
AAAAGGTGGAGTCATGCAAGCTCACCGACATCCAGATATAAGAATTTATG
TTCCGCAAAATTCAGTCGATGGGCCTACGAGGATCATTTGCCATTTACAA
CGCAAGGAACTCTATCCAACATTACCTCTTTTGGAAGACAGCGAAGCATT
GGCTTGTCGAATTATACACTTAAACGCCAGTACTCAAAGCCTCGATGGAC
CGATTTTATTGGAGATTCCTCATAGTGCTGCATTGAGACAAGGAGAACGA
GAAGTGGTTGTATTGAAAAGCGACAATGGAGCCAGTTGGAAAGAACATAC
TAATTTATTCACCGACATCGCAGTTCAAGATGCTCTGGGAAATTTAGCGG
AAAACATTCAAACAACAGAATATCAAACCCGAAACCGGATACAGAGAATT
ATTACAACGTCATTACCGCAGTATTTTTCATTAATTAGCCGATTAAAACA
AGATATGGCTTTCATTGGAGCGGAAGGAGGAACTGTGAATTCCTCGGTTT
GTACTCAAGTCCAAGCAGTCTTTCCAGAAGGAGCCCTAAAAAAGAAAATT
AAAATTTCATTGCAGATTCACAATATCCAACGAAATCTCATTCAAAAATA
TTTTGGAAATGGAGTGGCAATTTCACCGATCGTTACTTTGGAACCTCGGC
GCAGAAAATTTCATGAAGCTATAACTCTGACTTTACCATTACCGAATTGG
TCAGATGCTAACAGATCTATTCCATATACGGTCCAGACGTCTTCTCTGAG
GCTACTGTGCAGCATTTCCGGACAAAATACACCTACGGTTTGGGAGGACA
TTACCGGAACCTCCCCACTCACAATCAAAGATGGATGTGTATCTTTCACT
ACCACAATATCGGCGAGAGTGTGGCTAATTGACTGCAACCGAACAAATGA
AATAGTCCAAATCGCCTCAACTCTGTATGAAGAGAGCTGTATCGTTCCTT
TTATTGGTCAATTTTTGGTGTTTTGCCGTCGCAAAAATGAAGAAGAATGT
CAGATTCGATGTCTATGCATTACAGATGATACGGCAGAAAAAACTTTGGA
ATTTCAGGAAAACTTTGAACTGATCTCTTCCGGACCTCTTGTTGAAGTGC
TAGAAAATCATACTTACTGGCTAGAATCATCGGGCAACATCATTCCCATT
ACAAATTCAGATGAACAACTTTCCTTGAAGATTACTCCATTTCAAGAAAA
CAGACTTTCATTTTATGCAAGAATTAAAGACCTTTCTAATCCACCTTGCG
GAAAAGTTGCCTTTATGGAAGATCCGAGGATTCCAAGTATATCTTCAGAA
TTGAATGGAACTGTCGGTTCTCCATTGACTCAATTATTACCACAAAAACC
AATATGCACTCTGGACATAACCTTACCGACTAAGCCAACACAAAAAGGCT
TGAACAATATTGATGAAGAGTTCTCTAATGATCTCATATTCAACCCAGAT
GATAAAAAAGAAAGAATGTGCCGGACAATTGTCAAATCCGAACTTAATAT
TCGCGAAGTCGCCTTAAAAGTTGGAGGGGATTGGAAGAAATTGACAATAA
ACCTCGGAATGGGACAAGAAGAAATCACTCGAATTGATCTCCAAAGCGGC
ACCGAAGAAGATAAAGCCTACGTTGCGCTACTACTCTGGATAACGACAAC
CAAAGATATACAAAAATCTAATTTGGGAAATCAGTTAGAATTATCTTTGA
GAGATATCGGCAGAGAGGATATTGTAAAAACATGCATACATGACATCAGC
ATTGTCGACGAAAGTGAAAGGAAATTTGCTGAAACAATCATTAATGGGGG
TGACCCAAGCCAAAAATCCTCATCATTGAGTTCTCATGAGCTTACCAATT
CAATAGAGAGTGACGCTATGGAAGAGGAAATTGCTGAATCGAAAATAAAA
CATGAAGAATTCAAATCTATTACAGAAGAAGAAGAAAGACAATTGAAGCA
AGAAAAGTTACTAGATTTGATTGACTACTTAGATTCAATATTGCCGGATC
CAGAAGCAGAACTTGAAAAAATGAATCCTAACCAAGACTGCTATCTTGGA
GATGAAATCCAAGAAGAAAGCATTCAAATTGAAAATATTAGCGAGAATCA
AGCAGGTAAAACTGCTAAATCTAAATACCATTCCACCGTACCCGGGAATT
TCGACCTGGAAGAACTAGAAGAAGAAATCAAACCTCAAAAAAAAATGGGC
CTCAGATCAGAATCCTACCAAATAGAACAAGT
back to top

protein sequence of SMED30012522-orf-1

>SMED30012522-orf-1 ID=SMED30012522-orf-1|Name=SMED30012522-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=768bp
MELDSVQLIQRPVRAGFLISFIVDAKGGVMQAHRHPDIRIYVPQNSVDGP
TRIICHLQRKELYPTLPLLEDSEALACRIIHLNASTQSLDGPILLEIPHS
AALRQGEREVVVLKSDNGASWKEHTNLFTDIAVQDALGNLAENIQTTEYQ
TRNRIQRIITTSLPQYFSLISRLKQDMAFIGAEGGTVNSSVCTQVQAVFP
EGALKKKIKISLQIHNIQRNLIQKYFGNGVAISPIVTLEPRRRKFHEAIT
LTLPLPNWSDANRSIPYTVQTSSLRLLCSISGQNTPTVWEDITGTSPLTI
KDGCVSFTTTISARVWLIDCNRTNEIVQIASTLYEESCIVPFIGQFLVFC
RRKNEEECQIRCLCITDDTAEKTLEFQENFELISSGPLVEVLENHTYWLE
SSGNIIPITNSDEQLSLKITPFQENRLSFYARIKDLSNPPCGKVAFMEDP
RIPSISSELNGTVGSPLTQLLPQKPICTLDITLPTKPTQKGLNNIDEEFS
NDLIFNPDDKKERMCRTIVKSELNIREVALKVGGDWKKLTINLGMGQEEI
TRIDLQSGTEEDKAYVALLLWITTTKDIQKSNLGNQLELSLRDIGREDIV
KTCIHDISIVDESERKFAETIINGGDPSQKSSSLSSHELTNSIESDAMEE
EIAESKIKHEEFKSITEEEERQLKQEKLLDLIDYLDSILPDPEAELEKMN
PNQDCYLGDEIQEESIQIENISENQAGKTAKSKYHSTVPGNFDLEELEEE
IKPQKKMGLRSESYQIEQ
back to top

protein sequence of SMED30012522-orf-2

>SMED30012522-orf-2 ID=SMED30012522-orf-2|Name=SMED30012522-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=872bp
MVEETKDSLTEKAHAFLRAARSGNVEKVKEFLQADIKPDMSNANGLNAMH
LAAKEGNREVVQLLIENGLSVDIATRKGNTSLHIASLAGKLEVVSLLLES
KANINVKSQNGFTPLYMAAQENHLDVVKVLLEYGANQAITTDDGFTPLAV
ALQQGNDKVVQILLDNDSRSKVRLPALHIAAKKDDVNAASLLIGSSDDNV
DHQSASGFTPLHIAAHYNNVNVAKLLIEKNADVNFPAKNNITPLHVAAKW
GKEEMLKLLISQKANVNSVTRDGLSPIHCAARSGFENIILILLENGADIQ
HKSKNGLTALQMATQGDQAEVCKTLINKGIDVDAVTMDYLTALHVAAHCG
NINAAEVLLKNNCNVNARALNGFTPLHIACKKIQSKMVELLIKYKAHINS
TTETGLTPLHIAAFMGSKEIVNILLKNGASISQTTMKCENALHLAARNNQ
EETFKILLLHPEANFNARARENQTPLHIAVRMGNYSIVEQLLNAGADPNM
VTKDNYTALHIAAKEGRHEISRLLLEHQCKPDAKTKKGFTPLHIASKYGR
VQVARQLLLSAKVNPNSLGHHGLTPLHVATYYNHYEMIELLLDTEANVNC
LYKNGYTPLHLVAKKNMIEVTKLLIDRGANVNAQSQKGFTPLHLNSMAGN
KEIMELLLDANADVNHQAENGLTALHLAAEKNRTDIVEQLLKTEADISTK
TQMGYTALHTAVHFGQIQTVKMLLQKNFDVNAQTNLGCTSLHLAAQQGHI
AIVRLLLDNEIDVNHQNKQGLTALEVAQKQHYLNIAETLSKVTTVPEMMS
GSEEKKLILDQPEKMIDHSMSDSEEEGSSLNLNSGSSRSSLNLSIKDISR
NNSLRKPNRPVSIGAFNVKSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR000906ZU5_dom
IPR011029DEATH-like_dom_sf
IPR000488Death_domain
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 405..420
score: 47.09
coord: 620..634
score: 39.9
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 437..467
e-value: 0.25
score: 20.4
coord: 305..334
e-value: 0.018
score: 24.2
coord: 537..567
e-value: 0.01
score: 25.0
coord: 338..367
e-value: 0.0019
score: 27.5
coord: 670..699
e-value: 2.8E-4
score: 30.2
coord: 77..106
e-value: 4.2E-5
score: 33.0
coord: 703..732
e-value: 6.5E-5
score: 32.3
coord: 143..171
e-value: 3.4
score: 16.6
coord: 44..73
e-value: 4.5E-5
score: 32.9
coord: 239..268
e-value: 4.3E-6
score: 36.2
coord: 371..400
e-value: 1.6E-5
score: 34.4
coord: 571..600
e-value: 8.9E-7
score: 38.5
coord: 11..40
e-value: 100.0
score: 11.7
coord: 637..666
e-value: 4.6E-5
score: 32.8
coord: 604..633
e-value: 7.0E-7
score: 38.9
coord: 504..533
e-value: 0.0015
score: 27.8
coord: 404..433
e-value: 4.6E-5
score: 32.8
coord: 206..235
e-value: 4.9E-7
score: 39.4
coord: 471..500
e-value: 9.7E-7
score: 38.4
coord: 172..202
e-value: 120.0
score: 11.5
coord: 272..301
e-value: 0.0011
score: 28.3
coord: 110..139
e-value: 6.0E-7
score: 39.1
coord: 736..765
e-value: 1.4E-4
score: 31.2
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 504..535
e-value: 0.0039
score: 17.6
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 44..76
score: 13.224
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 404..436
score: 13.571
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 537..570
score: 10.152
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 670..702
score: 12.796
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 703..735
score: 12.529
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 637..669
score: 12.85
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 736..768
score: 12.957
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 371..403
score: 11.701
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 571..603
score: 12.476
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 338..370
score: 9.831
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 239..271
score: 12.449
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 471..503
score: 14.292
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 305..337
score: 10.339
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 143..175
score: 9.137
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 604..636
score: 14.826
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 272..304
score: 12.796
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 206..238
score: 13.785
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 77..109
score: 13.491
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 504..536
score: 10.74
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 110..142
score: 13.651
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 607..701
e-value: 3.5E-33
score: 116.5
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 410..556
e-value: 1.0E-49
score: 170.8
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 2..290
e-value: 2.2E-95
score: 321.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 557..606
e-value: 2.0E-13
score: 52.0
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 702..806
e-value: 8.1E-27
score: 95.7
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 291..409
e-value: 1.2E-34
score: 121.2
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 176..457
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 15..234
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 406..791
NoneNo IPR availablePFAMPF13637Ank_4coord: 739..774
e-value: 4.5E-7
score: 30.3
coord: 320..359
e-value: 9.2E-5
score: 22.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 819..871
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 825..871
NoneNo IPR availablePANTHERPTHR24133:SF33ANKYRIN, ISOFORM Bcoord: 12..837
NoneNo IPR availablePANTHERPTHR24133FAMILY NOT NAMEDcoord: 12..837
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 239..302
e-value: 4.6E-12
score: 46.3
coord: 642..733
e-value: 4.7E-18
score: 65.6
coord: 18..107
e-value: 8.7E-17
score: 61.5
coord: 109..167
e-value: 2.2E-11
score: 44.2
coord: 439..500
e-value: 6.9E-12
score: 45.8
coord: 362..434
e-value: 8.4E-14
score: 51.9
coord: 175..234
e-value: 4.2E-10
score: 40.1
coord: 555..634
e-value: 8.4E-14
score: 51.9
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 11..789
score: 229.514