Beta-hexosaminidase subunit beta

Overview
NameBeta-hexosaminidase subunit beta
Smed IDSMED30012514
Length (bp)3096
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Beta-hexosaminidase subunit beta (SMED30012514) t-SNE clustered cells

Violin plots show distribution of expression levels for Beta-hexosaminidase subunit beta (SMED30012514) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Beta-hexosaminidase subunit beta (SMED30012514) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Beta-hexosaminidase subunit beta (SMED30012514) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012514

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30012514SMESG000066985.1 dd_Smed_v4_2271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012514SMESG000066985.1 dd_Smed_v4_2271_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30012514SMESG000002681.1 dd_Smed_v4_3964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012514SMESG000002681.1 dd_Smed_v4_3964_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012514SMESG000066985.1 dd_Smed_v4_2271_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Human
Match: HEXB (hexosaminidase subunit beta [Source:HGNC Symbol;Acc:HGNC:4879])

HSP 1 Score: 362.459 bits (929), Expect = 4.133e-113
Identity = 185/449 (41.20%), Postives = 263/449 (58.57%), Query Frame = 3
Query:  846 YAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWK-SQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            + AK + +  +V+I ++S+   +P++  +E+Y + V      + A   WGALRGLE+ SQ++++   G   INE+ + D PRF HRG+++DT+RH++P  II+K LDAM  NK NV HWH+ DDQSFP  +    E +  G+Y   H VY P  V+ +IEYAR+RGIRV+PE D+P HTLSW K   +++T C     K    +GP+N    +TY  LT+ +K+I  +FPDQ+IHLG DEV   C  SN  IQ +MR +G F  D   L  FY +K+ +II  +        +G IVWQE ++  + L  GTIV++WK S    E + +      VI SA WYLD + YG  W  +Y+ +P D  G Q               ++  +GGEA +W E++DA N+ PR+WP ASA  ERLWS   + + + A  RL   RCRM  R I A
Sbjct:  118 FQAKTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVYQDSYGTFTINESTIIDSPRFSHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSYSLSH-VYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGKGQKDLLTPCYSRQNKLDS-FGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCWESNPKIQDFMRQKG-FGTDFKKLESFYIQKVLDIIATI-------NKGSIVWQEVFDDKAKLAPGTIVEVWKDSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQ-------------KQKQLFIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRMVERGIAA 543          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Human
Match: HEXA (hexosaminidase subunit alpha [Source:HGNC Symbol;Acc:HGNC:4878])

HSP 1 Score: 344.354 bits (882), Expect = 1.302e-106
Identity = 185/513 (36.06%), Postives = 284/513 (55.36%), Query Frame = 3
Query:  732 YPSHWRHQEPILNNANEG-DLLTNGKQTKSKTKFGSSYPYAAKLKGELHIV--NIYVES----DSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTA----EAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERS 2231
            YP++++ Q  + + A  G  +L    Q      FGS       L G+ H +  N+ V S      +Q P+L   E Y ++++     + ++  WGALRGLE+ SQ++W++  G  FIN+T+++D PRF HRG++LDT+RH++P   I+  LD M  NK+NVFHWHL DD SFP  +    E    G+Y+P   +Y  + VKE+IEYAR+RGIRV+ E D+P HTLSW    P ++T C     + SG +GPVN +  +TY  +++ + ++ ++FPD ++HLG DEV  +C  SN  IQ +MR +G F  D   L  FY + L +I++  G       +G++VWQE ++    ++  TI+Q+W+         E   + K   + + SA WYL+R+ YG  W + Y  +P    G                 +  ++GGEA MW E++D  N++PR+WP A A AERLWS    ++   A  RL   RC +  R + A   +  G C Q  E++
Sbjct:   40 YPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYS-GSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKG-FGEDFKQLESFYIQTLLDIVSSYG-------KGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTP-------------EQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLN-VGFCEQEFEQT 529          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Human
Match: HEXA (hexosaminidase subunit alpha [Source:HGNC Symbol;Acc:HGNC:4878])

HSP 1 Score: 342.428 bits (877), Expect = 8.570e-106
Identity = 191/566 (33.75%), Postives = 301/566 (53.18%), Query Frame = 3
Query:  567 IWPHPFSVITRADIYEVCPKSDNLIFKLTNVNN---YILQEAVMRYKDIICTQKAVSY-YPSHWRHQE-PILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTA----EAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERS 2231
            +WP P +  T    Y + P +    + +++       +L EA  RY+D++    +    Y + W HQ  P+            GK+                L+  + +V++ V    +Q P+L   E Y ++++     + ++  WGALRGLE+ SQ++W++  G  FIN+T+++D PRF HRG++LDT+RH++P   I+  LD M  NK+NVFHWHL DD SFP  +    E    G+Y+P   +Y  + VKE+IEYAR+RGIRV+ E D+P HTLSW    P ++T C     + SG +GPVN +  +TY  +++ + ++ ++FPD ++HLG DEV  +C  SN  IQ +MR +G F  D   L  FY + L +I++  G       +G++VWQE ++    ++  TI+Q+W+         E   + K   + + SA WYL+R+ YG  W + Y  +P    G                 +  ++GGEA MW E++D  N++PR+WP A A AERLWS    ++   A  RL   RC +  R + A   +  G C Q  E++
Sbjct:   23 LWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGWPHQAYPVFL----------GKR--------------HTLEKNVLVVSV-VTPGCNQLPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYS-GSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKG-FGEDFKQLESFYIQTLLDIVSSYG-------KGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTP-------------EQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLN-VGFCEQEFEQT 540          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Human
Match: HEXA (hexosaminidase subunit alpha [Source:HGNC Symbol;Acc:HGNC:4878])

HSP 1 Score: 338.961 bits (868), Expect = 6.877e-105
Identity = 179/491 (36.46%), Postives = 274/491 (55.80%), Query Frame = 3
Query:  732 YPSHWRHQEPILNNANEG-DLLTNGKQTKSKTKFGSSYPYAAKLKGELHIV--NIYVES----DSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTA----EAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMF 2165
            YP++++ Q  + + A  G  +L    Q      FGS       L G+ H +  N+ V S      +Q P+L   E Y ++++     + ++  WGALRGLE+ SQ++W++  G  FIN+T+++D PRF HRG++LDT+RH++P   I+  LD M  NK+NVFHWHL DD SFP  +    E    G+Y+P   +Y  + VKE+IEYAR+RGIRV+ E D+P HTLSW    P ++T C     + SG +GPVN +  +TY  +++ + ++ ++FPD ++HLG DEV  +C  SN  IQ +MR +G F  D   L  FY + L +I++  G       +G++VWQE ++    ++  TI+Q+W+         E   + K   + + SA WYL+R+ YG  W + Y  +P    G                 +  ++GGEA MW E++D  N++PR+WP A A AERLWS    ++   A  RL   RC + 
Sbjct:   40 YPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYS-GSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKG-FGEDFKQLESFYIQTLLDIVSSYG-------KGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTP-------------EQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELL 508          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Human
Match: HEXB (hexosaminidase subunit beta [Source:HGNC Symbol;Acc:HGNC:4879])

HSP 1 Score: 271.166 bits (692), Expect = 4.321e-82
Identity = 143/341 (41.94%), Postives = 192/341 (56.30%), Query Frame = 3
Query: 1170 MVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWK-SQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            M  NK NV HWH+ DDQSFP  +    E +  G+Y   H VY P  V+ +IEYAR+RGIRV+PE D+P HTLSW K   +++T C     K    +GP+N    +TY  LT+ +K+I  +FPDQ+IHLG DEV   C  SN  IQ +MR +G F  D   L  FY +K+ +II  +        +G IVWQE ++  + L  GTIV++WK S    E + +      VI SA WYLD + YG  W  +Y+ +P D  G Q               ++  +GGEA +W E++DA N+ PR+WP ASA  ERLWS   + + + A  RL   RCRM  R I A
Sbjct:    1 MAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSYSLSH-VYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGKGQKDLLTPCYSRQNKLDS-FGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCWESNPKIQDFMRQKG-FGTDFKKLESFYIQKVLDIIATI-------NKGSIVWQEVFDDKAKLAPGTIVEVWKDSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQ-------------KQKQLFIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRMVERGIAA 318          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Celegans
Match: hex-1 (Beta-hexosaminidase A [Source:UniProtKB/Swiss-Prot;Acc:Q22492])

HSP 1 Score: 284.263 bits (726), Expect = 1.853e-84
Identity = 165/471 (35.03%), Postives = 254/471 (53.93%), Query Frame = 3
Query:  840 YPYAAKLKG---ELHIVNIYVESDSHQWPSLY-MNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIF-INETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVA---TSCLSSNQAIQSWMRSRGMFSVDSLI--DFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAE----AATLAKQNIQVIYSACWYLDRLEYGAQWLN-----------HYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSP-NFINNAEKAASRLEEMRCRMFSRS 2174
            +P+  ++K    E  I+ + V+ +    P ++  +E Y + VSL    I+A+  WGALR +ESLS +++     + + I   ++ D+PRF  RG+M+D++RHF+  ++I + L+ M MNK+NV HWHL D +SFP  +    E    GAY P H VY  E + ++I +AR+RGIRVIPE D P HT SWR      +T C D  G  +     V+    + +  ++   +++   FPDQ++HLG DEV+     C   N+ I+ +M  +G F  D+++  +++  KL  I+  L L     +R  I WQE ++ N++     ++ +WK  +  E       +  QN  VI SACWYL+ ++YGA W +           +Y CDP +  G                 +E + GG AA+W E +D  N+  R+WP ASAAAERLWSP      AE A  R+ E+RCR+ SR 
Sbjct:   81 FPFPVEMKTGGTEDFIITVTVKDECPSGPPVHGASEEYLLRVSLTEAVINAQTVWGALRAMESLSHLVFYDHKSQEYQIRTVEIFDKPRFPVRGIMIDSSRHFLSVNVIKRQLEIMSMNKLNVLHWHLVDSESFPYTSVKFPELHGVGAYSPRH-VYSREDIADVIAFARLRGIRVIPEFDLPGHTSSWR-GRKGFLTECFDEKGVETFLPNLVDPMNEANFDFISEFLEEVTETFPDQFLHLGGDEVSDYIVECWERNKKIRKFMEEKG-FGNDTVLLENYFFEKLYKIVENLKL-----KRKPIFWQEVFD-NNIPDPNAVIHIWKGNTHEEIYEQVKNITSQNFPVIVSACWYLNYIKYGADWRDEIRGTAPSNSRYYYCDPTNFNGTVAQ-------------KELVWGGIAAIWGELVDNTNIEARLWPRASAAAERLWSPAEKTQRAEDAWPRMHELRCRLVSRG 529          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Celegans
Match: hex-1 (Beta-hexosaminidase A [Source:UniProtKB/Swiss-Prot;Acc:Q22492])

HSP 1 Score: 284.263 bits (726), Expect = 1.853e-84
Identity = 165/471 (35.03%), Postives = 254/471 (53.93%), Query Frame = 3
Query:  840 YPYAAKLKG---ELHIVNIYVESDSHQWPSLY-MNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIF-INETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVA---TSCLSSNQAIQSWMRSRGMFSVDSLI--DFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAE----AATLAKQNIQVIYSACWYLDRLEYGAQWLN-----------HYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSP-NFINNAEKAASRLEEMRCRMFSRS 2174
            +P+  ++K    E  I+ + V+ +    P ++  +E Y + VSL    I+A+  WGALR +ESLS +++     + + I   ++ D+PRF  RG+M+D++RHF+  ++I + L+ M MNK+NV HWHL D +SFP  +    E    GAY P H VY  E + ++I +AR+RGIRVIPE D P HT SWR      +T C D  G  +     V+    + +  ++   +++   FPDQ++HLG DEV+     C   N+ I+ +M  +G F  D+++  +++  KL  I+  L L     +R  I WQE ++ N++     ++ +WK  +  E       +  QN  VI SACWYL+ ++YGA W +           +Y CDP +  G                 +E + GG AA+W E +D  N+  R+WP ASAAAERLWSP      AE A  R+ E+RCR+ SR 
Sbjct:   81 FPFPVEMKTGGTEDFIITVTVKDECPSGPPVHGASEEYLLRVSLTEAVINAQTVWGALRAMESLSHLVFYDHKSQEYQIRTVEIFDKPRFPVRGIMIDSSRHFLSVNVIKRQLEIMSMNKLNVLHWHLVDSESFPYTSVKFPELHGVGAYSPRH-VYSREDIADVIAFARLRGIRVIPEFDLPGHTSSWR-GRKGFLTECFDEKGVETFLPNLVDPMNEANFDFISEFLEEVTETFPDQFLHLGGDEVSDYIVECWERNKKIRKFMEEKG-FGNDTVLLENYFFEKLYKIVENLKL-----KRKPIFWQEVFD-NNIPDPNAVIHIWKGNTHEEIYEQVKNITSQNFPVIVSACWYLNYIKYGADWRDEIRGTAPSNSRYYYCDPTNFNGTVAQ-------------KELVWGGIAAIWGELVDNTNIEARLWPRASAAAERLWSPAEKTQRAEDAWPRMHELRCRLVSRG 529          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Celegans
Match: hex-1 (Beta-hexosaminidase A [Source:UniProtKB/Swiss-Prot;Acc:Q22492])

HSP 1 Score: 284.263 bits (726), Expect = 1.853e-84
Identity = 165/471 (35.03%), Postives = 254/471 (53.93%), Query Frame = 3
Query:  840 YPYAAKLKG---ELHIVNIYVESDSHQWPSLY-MNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIF-INETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVA---TSCLSSNQAIQSWMRSRGMFSVDSLI--DFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAE----AATLAKQNIQVIYSACWYLDRLEYGAQWLN-----------HYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSP-NFINNAEKAASRLEEMRCRMFSRS 2174
            +P+  ++K    E  I+ + V+ +    P ++  +E Y + VSL    I+A+  WGALR +ESLS +++     + + I   ++ D+PRF  RG+M+D++RHF+  ++I + L+ M MNK+NV HWHL D +SFP  +    E    GAY P H VY  E + ++I +AR+RGIRVIPE D P HT SWR      +T C D  G  +     V+    + +  ++   +++   FPDQ++HLG DEV+     C   N+ I+ +M  +G F  D+++  +++  KL  I+  L L     +R  I WQE ++ N++     ++ +WK  +  E       +  QN  VI SACWYL+ ++YGA W +           +Y CDP +  G                 +E + GG AA+W E +D  N+  R+WP ASAAAERLWSP      AE A  R+ E+RCR+ SR 
Sbjct:   81 FPFPVEMKTGGTEDFIITVTVKDECPSGPPVHGASEEYLLRVSLTEAVINAQTVWGALRAMESLSHLVFYDHKSQEYQIRTVEIFDKPRFPVRGIMIDSSRHFLSVNVIKRQLEIMSMNKLNVLHWHLVDSESFPYTSVKFPELHGVGAYSPRH-VYSREDIADVIAFARLRGIRVIPEFDLPGHTSSWR-GRKGFLTECFDEKGVETFLPNLVDPMNEANFDFISEFLEEVTETFPDQFLHLGGDEVSDYIVECWERNKKIRKFMEEKG-FGNDTVLLENYFFEKLYKIVENLKL-----KRKPIFWQEVFD-NNIPDPNAVIHIWKGNTHEEIYEQVKNITSQNFPVIVSACWYLNYIKYGADWRDEIRGTAPSNSRYYYCDPTNFNGTVAQ-------------KELVWGGIAAIWGELVDNTNIEARLWPRASAAAERLWSPAEKTQRAEDAWPRMHELRCRLVSRG 529          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Fly
Match: fdl (gene:FBgn0045063 transcript:FBtr0346633)

HSP 1 Score: 196.052 bits (497), Expect = 2.407e-52
Identity = 147/500 (29.40%), Postives = 234/500 (46.80%), Query Frame = 3
Query:  816 SKTKFGSSYPYAAKLKGELHIVNIYV---ESDSHQWPSLYMNETYQISVSLKG----IFISAKETWGALRGLESLSQMMWRTRAGRIF--INETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPE----VMTRCIDMNGKWSGHYGP-----VNMAAASTYRLLTSLYKDII-NLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNN-KQRGFIVWQEAYERNSVLKKGTI-VQLWKSQSTAEAATLAKQNIQVIYSA--CWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWS------------PNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDC 2210
            + T FG+++    K  G+L  V + +   +S    + SL  +ETYQ+S   +G    + I A   +GA  GL +L Q++W      +      +KV+D P+F++RG+MLDT+RHF   + I + +  M + KMN FHWHLTD QSFP I+  + E A+HGAY  E + Y  + V+E+ E+A++ G++VIPEID+P+H  +     P+     +  CI+    WS + G      +N     TY +L  +Y++++ +  P  + HLG DEV   C +              F+   L   +   +   + +L L+NN    +   VW  A      L      VQ+W   +  E   L      VI+S    WYLD      +      C P   + N      +  + ++   ++ +LGGE  MW E +D + +  R+WP  +A AERLW+            P+         +RL E+  R      P   A   G+C
Sbjct:  178 AATLFGATF--GVKKAGDLTSVQVKISVLKSGDLNF-SLDNDETYQLSTQTEGHRLQVEIIANSYFGARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHFFSVESIKRTIVGMGLAKMNRFHWHLTDAQSFPYISRYYPELAVHGAYS-ESETYSEQDVREVAEFAKIYGVQVIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQ-PWSFYCGEPPCGQLNPKNNYTYLILQRIYEELLQHTGPTDFFHLGGDEVNLDCWAQ------------YFNDTDLRGLWCDFMLQAMARLKLANNGVAPKHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGSWRATGDAACAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTEQVDENQLDNRLWPRTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRA-EALFPKYCAQNPGEC 659          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Fly
Match: fdl (gene:FBgn0045063 transcript:FBtr0087946)

HSP 1 Score: 196.052 bits (497), Expect = 2.407e-52
Identity = 147/500 (29.40%), Postives = 234/500 (46.80%), Query Frame = 3
Query:  816 SKTKFGSSYPYAAKLKGELHIVNIYV---ESDSHQWPSLYMNETYQISVSLKG----IFISAKETWGALRGLESLSQMMWRTRAGRIF--INETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPE----VMTRCIDMNGKWSGHYGP-----VNMAAASTYRLLTSLYKDII-NLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNN-KQRGFIVWQEAYERNSVLKKGTI-VQLWKSQSTAEAATLAKQNIQVIYSA--CWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWS------------PNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDC 2210
            + T FG+++    K  G+L  V + +   +S    + SL  +ETYQ+S   +G    + I A   +GA  GL +L Q++W      +      +KV+D P+F++RG+MLDT+RHF   + I + +  M + KMN FHWHLTD QSFP I+  + E A+HGAY  E + Y  + V+E+ E+A++ G++VIPEID+P+H  +     P+     +  CI+    WS + G      +N     TY +L  +Y++++ +  P  + HLG DEV   C +              F+   L   +   +   + +L L+NN    +   VW  A      L      VQ+W   +  E   L      VI+S    WYLD      +      C P   + N      +  + ++   ++ +LGGE  MW E +D + +  R+WP  +A AERLW+            P+         +RL E+  R      P   A   G+C
Sbjct:  178 AATLFGATF--GVKKAGDLTSVQVKISVLKSGDLNF-SLDNDETYQLSTQTEGHRLQVEIIANSYFGARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHFFSVESIKRTIVGMGLAKMNRFHWHLTDAQSFPYISRYYPELAVHGAYS-ESETYSEQDVREVAEFAKIYGVQVIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQ-PWSFYCGEPPCGQLNPKNNYTYLILQRIYEELLQHTGPTDFFHLGGDEVNLDCWAQ------------YFNDTDLRGLWCDFMLQAMARLKLANNGVAPKHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGSWRATGDAACAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTEQVDENQLDNRLWPRTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRA-EALFPKYCAQNPGEC 659          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Fly
Match: fdl (gene:FBgn0045063 transcript:FBtr0087947)

HSP 1 Score: 196.438 bits (498), Expect = 2.456e-52
Identity = 147/500 (29.40%), Postives = 234/500 (46.80%), Query Frame = 3
Query:  816 SKTKFGSSYPYAAKLKGELHIVNIYV---ESDSHQWPSLYMNETYQISVSLKG----IFISAKETWGALRGLESLSQMMWRTRAGRIF--INETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPE----VMTRCIDMNGKWSGHYGP-----VNMAAASTYRLLTSLYKDII-NLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNN-KQRGFIVWQEAYERNSVLKKGTI-VQLWKSQSTAEAATLAKQNIQVIYSA--CWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWS------------PNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDC 2210
            + T FG+++    K  G+L  V + +   +S    + SL  +ETYQ+S   +G    + I A   +GA  GL +L Q++W      +      +KV+D P+F++RG+MLDT+RHF   + I + +  M + KMN FHWHLTD QSFP I+  + E A+HGAY  E + Y  + V+E+ E+A++ G++VIPEID+P+H  +     P+     +  CI+    WS + G      +N     TY +L  +Y++++ +  P  + HLG DEV   C +              F+   L   +   +   + +L L+NN    +   VW  A      L      VQ+W   +  E   L      VI+S    WYLD      +      C P   + N      +  + ++   ++ +LGGE  MW E +D + +  R+WP  +A AERLW+            P+         +RL E+  R      P   A   G+C
Sbjct:  191 AATLFGATF--GVKKAGDLTSVQVKISVLKSGDLNF-SLDNDETYQLSTQTEGHRLQVEIIANSYFGARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHFFSVESIKRTIVGMGLAKMNRFHWHLTDAQSFPYISRYYPELAVHGAYS-ESETYSEQDVREVAEFAKIYGVQVIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQ-PWSFYCGEPPCGQLNPKNNYTYLILQRIYEELLQHTGPTDFFHLGGDEVNLDCWAQ------------YFNDTDLRGLWCDFMLQAMARLKLANNGVAPKHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGSWRATGDAACAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTEQVDENQLDNRLWPRTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRA-EALFPKYCAQNPGEC 672          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Fly
Match: fdl (gene:FBgn0045063 transcript:FBtr0474148)

HSP 1 Score: 196.052 bits (497), Expect = 2.724e-52
Identity = 147/500 (29.40%), Postives = 234/500 (46.80%), Query Frame = 3
Query:  816 SKTKFGSSYPYAAKLKGELHIVNIYV---ESDSHQWPSLYMNETYQISVSLKG----IFISAKETWGALRGLESLSQMMWRTRAGRIF--INETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPE----VMTRCIDMNGKWSGHYGP-----VNMAAASTYRLLTSLYKDII-NLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNN-KQRGFIVWQEAYERNSVLKKGTI-VQLWKSQSTAEAATLAKQNIQVIYSA--CWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWS------------PNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDC 2210
            + T FG+++    K  G+L  V + +   +S    + SL  +ETYQ+S   +G    + I A   +GA  GL +L Q++W      +      +KV+D P+F++RG+MLDT+RHF   + I + +  M + KMN FHWHLTD QSFP I+  + E A+HGAY  E + Y  + V+E+ E+A++ G++VIPEID+P+H  +     P+     +  CI+    WS + G      +N     TY +L  +Y++++ +  P  + HLG DEV   C +              F+   L   +   +   + +L L+NN    +   VW  A      L      VQ+W   +  E   L      VI+S    WYLD      +      C P   + N      +  + ++   ++ +LGGE  MW E +D + +  R+WP  +A AERLW+            P+         +RL E+  R      P   A   G+C
Sbjct:  178 AATLFGATF--GVKKAGDLTSVQVKISVLKSGDLNF-SLDNDETYQLSTQTEGHRLQVEIIANSYFGARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHFFSVESIKRTIVGMGLAKMNRFHWHLTDAQSFPYISRYYPELAVHGAYS-ESETYSEQDVREVAEFAKIYGVQVIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQ-PWSFYCGEPPCGQLNPKNNYTYLILQRIYEELLQHTGPTDFFHLGGDEVNLDCWAQ------------YFNDTDLRGLWCDFMLQAMARLKLANNGVAPKHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGSWRATGDAACAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTEQVDENQLDNRLWPRTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRA-EALFPKYCAQNPGEC 659          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Fly
Match: fdl (gene:FBgn0045063 transcript:FBtr0339637)

HSP 1 Score: 196.052 bits (497), Expect = 3.143e-52
Identity = 147/500 (29.40%), Postives = 234/500 (46.80%), Query Frame = 3
Query:  816 SKTKFGSSYPYAAKLKGELHIVNIYV---ESDSHQWPSLYMNETYQISVSLKG----IFISAKETWGALRGLESLSQMMWRTRAGRIF--INETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEV----MTRCIDMNGKWSGHYGP-----VNMAAASTYRLLTSLYKDII-NLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNN-KQRGFIVWQEAYERNSVLKKGTI-VQLWKSQSTAEAATLAKQNIQVIYSA--CWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWS------------PNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDC 2210
            + T FG+++    K  G+L  V + +   +S    + SL  +ETYQ+S   +G    + I A   +GA  GL +L Q++W      +      +KV+D P+F++RG+MLDT+RHF   + I + +  M + KMN FHWHLTD QSFP I+  + E A+HGAY  E + Y  + V+E+ E+A++ G++VIPEID+P+H  +     P+     +  CI+    WS + G      +N     TY +L  +Y++++ +  P  + HLG DEV   C +              F+   L   +   +   + +L L+NN    +   VW  A      L      VQ+W   +  E   L      VI+S    WYLD      +      C P   + N      +  + ++   ++ +LGGE  MW E +D + +  R+WP  +A AERLW+            P+         +RL E+  R      P   A   G+C
Sbjct:  190 AATLFGATF--GVKKAGDLTSVQVKISVLKSGDLNF-SLDNDETYQLSTQTEGHRLQVEIIANSYFGARHGLSTLQQLIWFDDEDHLLHTYANSKVKDAPKFRYRGLMLDTSRHFFSVESIKRTIVGMGLAKMNRFHWHLTDAQSFPYISRYYPELAVHGAYS-ESETYSEQDVREVAEFAKIYGVQVIPEIDAPAHAGNGWDWGPKRGMGELAMCINQQ-PWSFYCGEPPCGQLNPKNNYTYLILQRIYEELLQHTGPTDFFHLGGDEVNLDCWAQ------------YFNDTDLRGLWCDFMLQAMARLKLANNGVAPKHVAVWSSALTNTKCLPNSQFTVQVWGGSTWQENYDLLDNGYNVIFSHVDAWYLDCGFGSWRATGDAACAPYRTWQNVYKHRPWERMRLDKKRKKQVLGGEVCMWTEQVDENQLDNRLWPRTAALAERLWTDPSDDHDMDIVPPDVFRRISLFRNRLVELGIRA-EALFPKYCAQNPGEC 671          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Zebrafish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 342.428 bits (877), Expect = 5.006e-106
Identity = 180/442 (40.72%), Postives = 255/442 (57.69%), Query Frame = 3
Query:  867 ELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEA-ATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            EL +     + +   +PSL  +E+Y +SV      + A   WGALRGLE+ SQ+++    G   IN+T + D PRF HRG++LD++RHF+P  +I+ NL+AM MNK NVFHWH+ DD SFP ++    E +  GAY P   VY P  VK +IE+AR+RGIRV+ E D+P HT SW     +++T C   +   SG +GPVN    S+Y  +  L+K+I  +FPD +IHLG DEV  SC  SN  IQ +M  +G F  D   L  FY ++L +I+          ++G++VWQE ++    LK  T+V++WK     E    +       I SA WYLD + YG  W  +Y+ +P D  G              D  ++ ++GGEA +W E++DA N+ PR+WP ASA AERLWS   + +   A +RL + RCRM  R IPA
Sbjct:  107 ELQVWITSADPECDGYPSLRTDESYSLSVDETSAVLKAANVWGALRGLETFSQLVYEDDYGVRNINKTDISDFPRFAHRGILLDSSRHFLPLKVILANLEAMAMNKFNVFHWHIVDDPSFPFMSRTFPELSQKGAYHPFTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGNGIKDLLTPCYSGSSP-SGSFGPVNPILNSSYEFMAQLFKEISTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMNQQG-FGTDYSKLESFYIQRLLDIVAA-------TKKGYMVWQEVFDNGVKLKDDTVVEVWKGNDMKEELQNVTGAGFTTILSAPWYLDYISYGQDWQRYYKVEPLDFTG-------------TDAQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSDASVTDVGNAYTRLAQHRCRMVRRGIPA 526          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Zebrafish
Match: hexa (hexosaminidase A (alpha polypeptide) [Source:ZFIN;Acc:ZDB-GENE-050417-283])

HSP 1 Score: 330.872 bits (847), Expect = 8.596e-102
Identity = 170/428 (39.72%), Postives = 250/428 (58.41%), Query Frame = 3
Query:  912 WPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQS-TAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWS-PNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            +P    +E+Y +SVS     + +   WGALRGLES SQ+++R   G  F+N+T++ D PRF  RG++LDT+RH++P   I+K LDAM  +K NVFHWH+ DD SFP  +    + +  GA+ P   +Y    V  +IE+AR+RGIRV+PE DSP HT SW K  P+++T C     K SG YGPV+    +TYR +  L K++  +FPD ++HLG DEV+ +C  SN ++  +M   G F  D   L  FY   + NI   L  ++       IVWQ+ ++ +  + +GT++++WK ++   E + + K   +V+ SA WY++ + YG  W N Y   P +  G +               ++ ++GGE AMW E++DA N+ PR+WP A AAAERLWS      NA+ A  RLEE RC +  R I A
Sbjct:  112 YPDEDSDESYNLSVSEGQAVLRSVTVWGALRGLESFSQLVYRDDYGAYFVNKTEIVDFPRFAFRGLLLDTSRHYLPLHAILKTLDAMAYSKFNVFHWHIVDDPSFPYQSRTFPDLSKKGAFHPFTHIYTQSDVMRVIEHARMRGIRVVPEFDSPGHTQSWGKGQPDLLTPCYK-GSKPSGTYGPVDPTVDTTYRFMERLLKEVKFVFPDSYVHLGGDEVSFACWQSNPSVGKFMEKMG-FGRDFTKLESFYMESIMNITAALNKTS-------IVWQDVFDYHERIPQGTVLEIWKGETYQTELSKMTKAGHRVLLSAPWYINHITYGQDWRNSYAVQPQNFSGTE-------------EQKKLVIGGEVAMWGEYVDATNLNPRLWPRACAAAERLWSNEEKTLNADLAFPRLEEFRCELVRRGIQA 517          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Zebrafish
Match: hexa (hexosaminidase A (alpha polypeptide) [Source:ZFIN;Acc:ZDB-GENE-050417-283])

HSP 1 Score: 310.071 bits (793), Expect = 5.647e-94
Identity = 167/428 (39.02%), Postives = 241/428 (56.31%), Query Frame = 3
Query:  912 WPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQS-TAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWS-PNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            +P    +E+Y +SVS     + +   WGALRGLES SQ+++R   G  F+N+T++ D PRF  RG++LDT+RH++P   I+K LDAM  +K NVFHWH+ DD SFP  +    + +  GA+ P   +Y    V  +IE+AR+RGIRV+PE DSP HT SW K  P+++T C     K SG YGPV+    +TYR +  L K++  +FPD ++HLG DEV+ +C  SN ++  +M   G F  D   L  FY   + NI   L  ++       IVWQ+ ++ +   +   +V++WK      E   + K  ++VI +A +YLD       W  +Y   P    G +               ++ ++GGE AMW E++DA N+ PR+WP A AAAERLWS      NA+ A  RLEE RC +  R I A
Sbjct:  112 YPDEDSDESYNLSVSEGQAVLRSVTVWGALRGLESFSQLVYRDDYGAYFVNKTEIVDFPRFAFRGLLLDTSRHYLPLHAILKTLDAMAYSKFNVFHWHIVDDPSFPYQSRTFPDLSKKGAFHPFTHIYTQSDVMRVIEHARMRGIRVVPEFDSPGHTQSWGKGQPDLLTPCYK-GSKPSGTYGPVDPTVDTTYRFMERLLKEVKFVFPDSYVHLGGDEVSFACWYSNPSVGKFMEKMG-FGRDFTKLESFYMESIMNITAALNKTS-------IVWQDVFDYHERPRSQYVVEVWKQGCYLCEMRRVTKAGLKVILAAPFYLDLPIPTQNWARYYGVRPLAFRGTE-------------EQKKLVIGGEVAMWGEYVDATNLNPRLWPRACAAAERLWSNEEKTLNADLAFPRLEEFRCELVRRGIQA 517          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Zebrafish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 279.256 bits (713), Expect = 2.061e-83
Identity = 147/367 (40.05%), Postives = 211/367 (57.49%), Query Frame = 3
Query:  867 ELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEA-ATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDY 1958
            EL +     + +   +PSL  +E+Y +SV      + A   WGALRGLE+ SQ+++    G   IN+T + D PRF HRG++LD++RHF+P  +I+ NL+AM MNK NVFHWH+ DD SFP ++    E +  GAY P   VY P  VK +IE+AR+RGIRV+ E D+P HT SW     +++T C   +   SG +GPVN    S+Y  +  L+K+I  +FPD +IHLG DEV  SC  SN  IQ +M  +G F  D   L  FY ++L +I+          ++G++VWQE ++    LK  T+V++WK     E    +       I SA WYLD + YG  W  +Y+ +P D  G  +  N +
Sbjct:  107 ELQVWITSADPECDGYPSLRTDESYSLSVDETSAVLKAANVWGALRGLETFSQLVYEDDYGVRNINKTDISDFPRFAHRGILLDSSRHFLPLKVILANLEAMAMNKFNVFHWHIVDDPSFPFMSRTFPELSQKGAYHPFTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGNGIKDLLTPCYSGSSP-SGSFGPVNPILNSSYEFMAQLFKEISTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMNQQG-FGTDYSKLESFYIQRLLDIVAA-------TKKGYMVWQEVFDNGVKLKDDTVVEVWKGNDMKEELQNVTGAGFTTILSAPWYLDYISYGQDWQRYYKVEPLDFTGQFLQSNSF 464          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Zebrafish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 188.348 bits (477), Expect = 4.113e-53
Identity = 108/285 (37.89%), Postives = 156/285 (54.74%), Query Frame = 3
Query: 1341 GIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKS--QSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            GIRV+ E D+P HT SW     +++T C   +   SG +GPVN    S+Y  +  L+K+I  +FPD +IHLG DEV  SC  SN  IQ +M  +G F  D   L  FY ++L +I+          ++G++VWQE ++    LK  T + +WK   Q   E A +       + S  WYL+R+ YG  W++ Y+ DP +  G              D  ++ ++GGEA +W E++DA N+ PR+WP ASA AERLWS   + +   A +RL + RCRM  R IPA
Sbjct:    2 GIRVVAEFDTPGHTQSWGNGIKDLLTPCYSGSSP-SGSFGPVNPILNSSYEFMAQLFKEISTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMNQQG-FGTDYSKLESFYIQRLLDIVAA-------TKKGYMVWQEVFDNGVKLKADTQIHVWKGRPQYQDEMAKVTAAGFSALLSTPWYLNRVSYGQDWVDIYKADPQNFNGT-------------DAQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSDASVTDVGNAYTRLAQHRCRMVRRGIPA 264          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Xenopus
Match: hexb (hexosaminidase B (beta polypeptide) [Source:NCBI gene;Acc:100145770])

HSP 1 Score: 376.711 bits (966), Expect = 1.325e-118
Identity = 202/548 (36.86%), Postives = 299/548 (54.56%), Query Frame = 3
Query:  558 FGQIWPHPFSVITRADIYEVCPKSDNLIF---KLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQ-STAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            FG +WP P +VI  AD + + P   +++         +  +LQ A  RY D +       +  S W+      +NA  G LL                        +L +V +  +   H++P++  +E+Y++SV      + A + WGALRGLE+ SQ+++  R G   IN++ ++D PRF HRG++LDT+RH++P   I  NLDAM  NK NVFHWH+ DD SFP  +    + +  G+Y P   VY P  V+ +IEYAR+RGIRV+PE DSP HT SW K    ++T C +  G+ SG YGPVN     TY  + + +++I N+FPDQ+IHLG DEV  SC  SN  +  +M   G F  D   L  +Y +++  I++ L       ++G++VWQE ++ N  L   TI+++WK Q    E A +     Q + S+ WYL+R+ YG  W+  Y+ +P +  G                 ++ ++GGEA MW EF+DA N+ PR+WP ASA AERLWS   + +   A +RL + RCRM  R I A
Sbjct:   49 FGSLWPLPQTVILSADSFYIPPSGFSIVHGSGSTAGTSCVLLQSAFRRYYDYM-------FGYSKWKRASAKPSNA--GQLL------------------------QLQVVILSKDHQCHRYPTVQSDESYELSVGENVAVLKANQVWGALRGLETFSQLIYEDRFGAFLINKSYIEDFPRFAHRGILLDTSRHYLPLKTIFLNLDAMAFNKFNVFHWHIVDDPSFPYQSVTFPDLSDKGSYHPYTHVYTPVDVRLVIEYARMRGIRVVPEFDSPGHTDSWGKGQQNLLTPCFN-KGQLSGAYGPVNPILNDTYNFMYTFFQEISNVFPDQYIHLGGDEVDFSCWKSNPDVTKFMTDHG-FGTDYCKLESYYIQQVLGIVSSL-------KKGYMVWQEVFDNNVKLNPDTIIEVWKEQLYQEEMAAVTAAGFQALLSSPWYLNRISYGQDWIQVYKVEPANFNGTA-------------EQKQLVIGGEACMWGEFVDATNLTPRLWPRASAVAERLWSNQNVTSVGDAYNRLVKHRCRMLRRGIAA 541          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Xenopus
Match: hexb (hexosaminidase B (beta polypeptide) [Source:NCBI gene;Acc:100145770])

HSP 1 Score: 368.622 bits (945), Expect = 1.640e-115
Identity = 200/548 (36.50%), Postives = 295/548 (53.83%), Query Frame = 3
Query:  558 FGQIWPHPFSVITRADIYEVCPKSDNLIF---KLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQST-AEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            FG +WP P +VI  AD + + P   +++         +  +LQ A  RY D +       +  S W+      +NA  G LL                        +L +V +  +   H++P++  +E+Y++SV      + A + WGALRGLE+ SQ+++  R G   IN++ ++D PRF HRG++LDT+RH++P   I  NLDAM  NK NVFHWH+ DD SFP  +    + +  G+Y P   VY P  V+ +IEYAR+RGIRV+PE DSP HT SW K    ++T C +  G+ SG YGPVN     TY  + + +++I N+FPDQ+IHLG DEV  SC  SN  +  +M   G F  D   L  +Y +++  I++ L       ++G++VWQE ++ N  +   TIV++W  Q+   E   +       I +A WYLD + YG  W  +Y+ +P    G                 ++ ++GGEA MW EF+DA N+ PR+WP ASA AERLWS   + +   A +RL + RCRM  R I A
Sbjct:   49 FGSLWPLPQTVILSADSFYIPPSGFSIVHGSGSTAGTSCVLLQSAFRRYYDYM-------FGYSKWKRASAKPSNA--GQLL------------------------QLQVVILSKDHQCHRYPTVQSDESYELSVGENVAVLKANQVWGALRGLETFSQLIYEDRFGAFLINKSYIEDFPRFAHRGILLDTSRHYLPLKTIFLNLDAMAFNKFNVFHWHIVDDPSFPYQSVTFPDLSDKGSYHPYTHVYTPVDVRLVIEYARMRGIRVVPEFDSPGHTDSWGKGQQNLLTPCFN-KGQLSGAYGPVNPILNDTYNFMYTFFQEISNVFPDQYIHLGGDEVDFSCWKSNPDVTKFMTDHG-FGTDYCKLESYYIQQVLGIVSSL-------KKGYMVWQEVFDNNVKINPDTIVEVWMGQNCYEELYKVTAAGFPAIMAAPWYLDYISYGQDWQKYYKVEPLSFNGTA-------------EQKQLVIGGEACMWGEFVDATNLTPRLWPRASAVAERLWSNQNVTSVGDAYNRLVKHRCRMLRRGIAA 541          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Xenopus
Match: hexb (hexosaminidase B (beta polypeptide) [Source:NCBI gene;Acc:100145770])

HSP 1 Score: 359.762 bits (922), Expect = 1.595e-113
Identity = 183/459 (39.87%), Postives = 266/459 (57.95%), Query Frame = 3
Query:  816 SKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQST-AEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            SK K  S+ P  A    +L +V +  +   H++P++  +E+Y++SV      + A + WGALRGLE+ SQ+++  R G   IN++ ++D PRF HRG++LDT+RH++P   I  NLDAM  NK NVFHWH+ DD SFP  +    + +  G+Y P   VY P  V+ +IEYAR+RGIRV+PE DSP HT SW K    ++T C +  G+ SG YGPVN     TY  + + +++I N+FPDQ+IHLG DEV  SC  SN  +  +M   G F  D   L  +Y +++  I++ L       ++G++VWQE ++ N  +   TIV++W  Q+   E   +       I +A WYLD + YG  W  +Y+ +P              N       ++ ++GGEA MW EF+DA N+ PR+WP ASA AERLWS   + +   A +RL + RCRM  R I A
Sbjct:    5 SKWKRASAKPSNAGQLLQLQVVILSKDHQCHRYPTVQSDESYELSVGENVAVLKANQVWGALRGLETFSQLIYEDRFGAFLINKSYIEDFPRFAHRGILLDTSRHYLPLKTIFLNLDAMAFNKFNVFHWHIVDDPSFPYQSVTFPDLSDKGSYHPYTHVYTPVDVRLVIEYARMRGIRVVPEFDSPGHTDSWGKGQQNLLTPCFN-KGQLSGAYGPVNPILNDTYNFMYTFFQEISNVFPDQYIHLGGDEVDFSCWKSNPDVTKFMTDHG-FGTDYCKLESYYIQQVLGIVSSL-------KKGYMVWQEVFDNNVKINPDTIVEVWMGQNCYEELYKVTAAGFPAIMAAPWYLDYISYGQDWQKYYKVEP------------LTNFNGTAEQKQLVIGGEACMWGEFVDATNLTPRLWPRASAVAERLWSNQNVTSVGDAYNRLVKHRCRMLRRGIAA 442          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Xenopus
Match: hexb (hexosaminidase B (beta polypeptide) [Source:NCBI gene;Acc:100145770])

HSP 1 Score: 353.984 bits (907), Expect = 2.130e-111
Identity = 183/457 (40.04%), Postives = 265/457 (57.99%), Query Frame = 3
Query:  816 SKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQ-STAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            SK K  S+ P  A    +L +V +  +   H++P++  +E+Y++SV      + A + WGALRGLE+ SQ+++  R G   IN++ ++D PRF HRG++LDT+RH++P   I  NLDAM  NK NVFHWH+ DD SFP  +    + +  G+Y P   VY P  V+ +IEYAR+RGIRV+PE DSP HT SW K    ++T C +  G+ SG YGPVN     TY  + + +++I N+FPDQ+IHLG DEV  SC     A   W + +  F+  SL              LG+ ++ K +G++VWQE ++ N  L   TI+++WK Q    E A +     Q + S+ WYL+R+ YG  W+  Y+ +P +  G                 ++ ++GGEA MW EF+DA N+ PR+WP ASA AERLWS   + +   A +RL + RCRM  R I A
Sbjct:    5 SKWKRASAKPSNAGQLLQLQVVILSKDHQCHRYPTVQSDESYELSVGENVAVLKANQVWGALRGLETFSQLIYEDRFGAFLINKSYIEDFPRFAHRGILLDTSRHYLPLKTIFLNLDAMAFNKFNVFHWHIVDDPSFPYQSVTFPDLSDKGSYHPYTHVYTPVDVRLVIEYARMRGIRVVPEFDSPGHTDSWGKGQQNLLTPCFN-KGQLSGAYGPVNPILNDTYNFMYTFFQEISNVFPDQYIHLGGDEVDFSCWYV--ANVQWTKHKLNFTFMSLF-------------LGIVSSLK-KGYMVWQEVFDNNVKLNPDTIIEVWKEQLYQEEMAAVTAAGFQALLSSPWYLNRISYGQDWIQVYKVEPANFNGTA-------------EQKQLVIGGEACMWGEFVDATNLTPRLWPRASAVAERLWSNQNVTSVGDAYNRLVKHRCRMLRRGIAA 431          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Xenopus
Match: hexb (hexosaminidase B (beta polypeptide) [Source:NCBI gene;Acc:100145770])

HSP 1 Score: 350.132 bits (897), Expect = 8.507e-109
Identity = 194/548 (35.40%), Postives = 287/548 (52.37%), Query Frame = 3
Query:  558 FGQIWPHPFSVITRADIYEVCPKSDNLIF---KLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQST-AEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            FG +WP P +VI  AD + + P   +++         +  +LQ A  RY D +       +  S W+      +NA  G LL                        +L +V +  +   H++P++  +E+Y++SV      + A + WGALRG   +          +  IN++ ++D PRF HRG++LDT+RH++P   I  NLDAM  NK NVFHWH+ DD SFP  +    + +  G+Y P   VY P  V+ +IEYAR+RGIRV+PE DSP HT SW K    ++T C +  G+ SG YGPVN     TY  + + +++I N+FPDQ+IHLG DEV  SC  SN  +  +M   G F  D   L  +Y +++  I++ L       ++G++VWQE ++ N  +   TIV++W  Q+   E   +       I +A WYLD + YG  W  +Y+ +P    G                 ++ ++GGEA MW EF+DA N+ PR+WP ASA AERLWS   + +   A +RL + RCRM  R I A
Sbjct:   24 FGSLWPLPQTVILSADSFYIPPSGFSIVHGSGSTAGTSCVLLQSAFRRYYDYM-------FGYSKWKRASAKPSNA--GQLL------------------------QLQVVILSKDHQCHRYPTVQSDESYELSVGENVAVLKANQVWGALRGYFFIPPKFILCSVKQFLINKSYIEDFPRFAHRGILLDTSRHYLPLKTIFLNLDAMAFNKFNVFHWHIVDDPSFPYQSVTFPDLSDKGSYHPYTHVYTPVDVRLVIEYARMRGIRVVPEFDSPGHTDSWGKGQQNLLTPCFN-KGQLSGAYGPVNPILNDTYNFMYTFFQEISNVFPDQYIHLGGDEVDFSCWKSNPDVTKFMTDHG-FGTDYCKLESYYIQQVLGIVSSL-------KKGYMVWQEVFDNNVKINPDTIVEVWMGQNCYEELYKVTAAGFPAIMAAPWYLDYISYGQDWQKYYKVEPLSFNGTA-------------EQKQLVIGGEACMWGEFVDATNLTPRLWPRASAVAERLWSNQNVTSVGDAYNRLVKHRCRMLRRGIAA 516          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Mouse
Match: Hexb (hexosaminidase B [Source:MGI Symbol;Acc:MGI:96074])

HSP 1 Score: 367.081 bits (941), Expect = 2.443e-115
Identity = 183/438 (41.78%), Postives = 261/438 (59.59%), Query Frame = 3
Query:  876 IVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFS-VDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQS-TAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            +V+I +ES+   +PSL  +ETY + V      + A   WGALRGLE+ SQ++++   G   INE+ + D PRF HRG+++DT+RHF+P   I+K LDAM  NK NV HWH+ DDQSFP  +    E +  G+Y   H VY P  V+ ++EYAR+RGIRVIPE D+P HT SW K    ++T C +   K +  +GPV+    +TY    + +K+I ++FPDQ+IHLG DEV   C +SN  IQ +M+ +G  S    L  FY +K+  II+ L       ++  IVWQE ++    L+ GT+V++WKS+  + E   +       I SA WYLD + YG  W N+Y+ +P             +N   ++  ++ ++GGEA +W EF+DA N+ PR+WP ASA  ERLWSP  + + E A  RL   RCRM SR I A
Sbjct:  107 LVSITLESECESFPSLSSDETYSLLVQEPVAVLKANSVWGALRGLETFSQLVYQDSFGTFTINESSIADSPRFPHRGILIDTSRHFLPVKTILKTLDAMAFNKFNVLHWHIVDDQSFPYQSTTFPELSNKGSYSLSH-VYTPNDVRMVLEYARLRGIRVIPEFDTPGHTQSWGKGQKNLLTPCYNQKTK-TQVFGPVDPTVNTTYAFFNTFFKEISSVFPDQFIHLGGDEVEFQCWASNPNIQGFMKRKGFGSDFRRLESFYIKKILEIISSL-------KKNSIVWQEVFDDKVELQPGTVVEVWKSEHYSYELKQVTGSGFPAILSAPWYLDLISYGQDWKNYYKVEP-------------LNFEGSEKQKQLVIGGEACLWGEFVDATNLTPRLWPRASAVGERLWSPKTVTDLENAYKRLAVHRCRMVSRGIAA 522          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Mouse
Match: Hexa (hexosaminidase A [Source:MGI Symbol;Acc:MGI:96073])

HSP 1 Score: 356.295 bits (913), Expect = 2.226e-111
Identity = 172/451 (38.14%), Postives = 267/451 (59.20%), Query Frame = 3
Query:  891 VESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTA----EAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERS 2231
            V ++ +++P+L   E Y ++++     ++++  WGALRGLE+ SQ++W++  G  FIN+TK++D PRF HRGV+LDT+RH++P   I+  LD M  NK NVFHWHL DD SFP  +    E    G+++P   +Y  + VKE+IEYAR+RGIRV+ E D+P HTLSW    P ++T C       SG +GPVN +  STY  +++L+ +I ++FPD ++HLG DEV  +C  SN  IQ++M+ +G      L  FY + L +I++       +  +G++VWQE ++    ++  TI+Q+W+ +       E   + +   + + SA WYL+R++YG  W + Y+ +P   +G                 +  ++GGEA MW E++D+ N++PR+WP A A AERLWS N   N + A  RL   RC +  R I A   S  G C Q  E++
Sbjct:  100 VTAECNEFPNLESVENYTLTINDDQCLLASETVWGALRGLETFSQLVWKSAEGTFFINKTKIKDFPRFPHRGVLLDTSRHYLPLSSILDTLDVMAYNKFNVFHWHLVDDSSFPYESFTFPELTRKGSFNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGAPGLLTPCYS-GSHLSGTFGPVNPSLNSTYDFMSTLFLEISSVFPDFYLHLGGDEVDFTCWKSNPNIQAFMKKKGFTDFKQLESFYIQTLLDIVS-------DYDKGYVVWQEVFDNKVKVRPDTIIQVWREEMPVEYMLEMQDITRAGFRALLSAPWYLNRVKYGPDWKDMYKVEPLAFHGTP-------------EQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLWSSNLTTNIDFAFKRLSHFRCELVRRGIQAQPIS-VGYCEQEFEQT 528          
BLAST of Beta-hexosaminidase subunit beta vs. UniProt/SwissProt
Match: sp|P20060|HEXB_MOUSE (Beta-hexosaminidase subunit beta OS=Mus musculus OX=10090 GN=Hexb PE=1 SV=2)

HSP 1 Score: 367.081 bits (941), Expect = 1.709e-114
Identity = 183/438 (41.78%), Postives = 261/438 (59.59%), Query Frame = 3
Query:  876 IVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFS-VDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQS-TAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            +V+I +ES+   +PSL  +ETY + V      + A   WGALRGLE+ SQ++++   G   INE+ + D PRF HRG+++DT+RHF+P   I+K LDAM  NK NV HWH+ DDQSFP  +    E +  G+Y   H VY P  V+ ++EYAR+RGIRVIPE D+P HT SW K    ++T C +   K +  +GPV+    +TY    + +K+I ++FPDQ+IHLG DEV   C +SN  IQ +M+ +G  S    L  FY +K+  II+ L       ++  IVWQE ++    L+ GT+V++WKS+  + E   +       I SA WYLD + YG  W N+Y+ +P             +N   ++  ++ ++GGEA +W EF+DA N+ PR+WP ASA  ERLWSP  + + E A  RL   RCRM SR I A
Sbjct:  107 LVSITLESECESFPSLSSDETYSLLVQEPVAVLKANSVWGALRGLETFSQLVYQDSFGTFTINESSIADSPRFPHRGILIDTSRHFLPVKTILKTLDAMAFNKFNVLHWHIVDDQSFPYQSTTFPELSNKGSYSLSH-VYTPNDVRMVLEYARLRGIRVIPEFDTPGHTQSWGKGQKNLLTPCYNQKTK-TQVFGPVDPTVNTTYAFFNTFFKEISSVFPDQFIHLGGDEVEFQCWASNPNIQGFMKRKGFGSDFRRLESFYIKKILEIISSL-------KKNSIVWQEVFDDKVELQPGTVVEVWKSEHYSYELKQVTGSGFPAILSAPWYLDLISYGQDWKNYYKVEP-------------LNFEGSEKQKQLVIGGEACLWGEFVDATNLTPRLWPRASAVGERLWSPKTVTDLENAYKRLAVHRCRMVSRGIAA 522          
BLAST of Beta-hexosaminidase subunit beta vs. UniProt/SwissProt
Match: sp|P49614|HEXB_FELCA (Beta-hexosaminidase subunit beta OS=Felis catus OX=9685 GN=HEXB PE=2 SV=2)

HSP 1 Score: 362.073 bits (928), Expect = 1.184e-112
Identity = 187/439 (42.60%), Postives = 261/439 (59.45%), Query Frame = 3
Query:  876 IVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQS-TAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            +V + ++S+   +P++  +E+Y + V     F+ A   WG LRGLE+ SQ++++   G   +NE+ + D PRF HRG+++DTARHF+P   I+K LDAM  NK NV HWH+ DDQSFP  +    E +  G+Y   H VY P  V  +IEYAR+RGIRVIPE DSP HT SW K   +++T C + + K SG +GP+N    STY  L+  +K++  +FPD ++HLG DEV   C  SN  IQ +M+ +G F  D   L  FY +KL  I++ +       ++G IVWQE ++ +  L  GTIVQ+WK+Q  T E   +      VI SA WYLD + YG  W N+Y+ DP    G+Q               ++ ++GGEA +W EF+DA N+ PR+WP ASA  ERLWSP  I +   A +RL   RCRM  R I A
Sbjct:  102 LVTVVLDSECDLFPNITSDESYTLLVKEPVAFLKANRVWGVLRGLETFSQLIYQDSYGTFTVNESDIIDSPRFPHRGILIDTARHFLPVKSILKTLDAMAFNKFNVLHWHIVDDQSFPYQSVTFPELSNKGSYSLSH-VYTPNDVHTVIEYARLRGIRVIPEFDSPGHTQSWGKGQKDLLTPCYNEH-KQSGTFGPINPILNSTYNFLSQFFKEVSMVFPDHFVHLGGDEVEFQCWESNPEIQGFMKQKG-FGKDFRRLESFYLQKLLGIVSTV-------KKGSIVWQEVFDDHVKLLPGTIVQVWKNQVYTEELREVTAAGFPVILSAPWYLDWISYGQDWRNYYKVDPLHFDGSQ-------------EQKKLVIGGEACLWGEFVDATNLTPRLWPRASAVGERLWSPEDITSVGNAYNRLTVHRCRMVRRGISA 517          
BLAST of Beta-hexosaminidase subunit beta vs. UniProt/SwissProt
Match: sp|P07686|HEXB_HUMAN (Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3)

HSP 1 Score: 362.459 bits (929), Expect = 1.697e-112
Identity = 185/449 (41.20%), Postives = 263/449 (58.57%), Query Frame = 3
Query:  846 YAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWK-SQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            + AK + +  +V+I ++S+   +P++  +E+Y + V      + A   WGALRGLE+ SQ++++   G   INE+ + D PRF HRG+++DT+RH++P  II+K LDAM  NK NV HWH+ DDQSFP  +    E +  G+Y   H VY P  V+ +IEYAR+RGIRV+PE D+P HTLSW K   +++T C     K    +GP+N    +TY  LT+ +K+I  +FPDQ+IHLG DEV   C  SN  IQ +MR +G F  D   L  FY +K+ +II  +        +G IVWQE ++  + L  GTIV++WK S    E + +      VI SA WYLD + YG  W  +Y+ +P D  G Q               ++  +GGEA +W E++DA N+ PR+WP ASA  ERLWS   + + + A  RL   RCRM  R I A
Sbjct:  118 FQAKTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVYQDSYGTFTINESTIIDSPRFSHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSYSLSH-VYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGKGQKDLLTPCYSRQNKLDS-FGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCWESNPKIQDFMRQKG-FGTDFKKLESFYIQKVLDIIATI-------NKGSIVWQEVFDDKAKLAPGTIVEVWKDSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQ-------------KQKQLFIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRMVERGIAA 543          
BLAST of Beta-hexosaminidase subunit beta vs. UniProt/SwissProt
Match: sp|Q6AXR4|HEXB_RAT (Beta-hexosaminidase subunit beta OS=Rattus norvegicus OX=10116 GN=Hexb PE=2 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 6.400e-112
Identity = 212/578 (36.68%), Postives = 303/578 (52.42%), Query Frame = 3
Query:  465 APDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKS---DNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMF-SVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTA-EAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            AP ++++   AM  L           APF     +WP P SV     +  + P++   DN        +  +L EA  RY + I        +  + RH  P                     KF    P   KL     +V I +E     +PS+  +E+Y + V      + A E WGALRGLE+ SQ++++   G   INE+ + D PRF HRG+++DT+RH++P   I K LDAM  NK NV HWH+ DDQSFP  +    E +  G+Y   H VY P  +  ++EYAR+RGIRVIPE DSP HT SW K    ++T C     + +   GPV+ +  +TY    + +K+I  +FPDQ+IHLG DEV   C +SN  IQ++M+ +G   +   L  FY +K+ +IIT L  S+       IVWQ+ ++    L+ GT+V++WKS++   E A +       I SA WYLD + YG  W N+Y+ +P             +N   ++  ++ ++GGEA +W E++DA N+IPR+WP ASA  ERLWSP  I N E A  RL   RCRM SR I A
Sbjct:    8 APGLLLQALVAMVSL--------ALVAPFGLQPALWPMPRSVQVFPRLLYISPENFQIDNSPNSTAGPSCSLLLEAFRRYYNYI--------FGFYKRHHGP--------------------AKFQDK-PQLEKL-----LVFINLEPQCDAFPSMSSDESYSLLVQEPVALLKANEVWGALRGLETFSQLVYQDAYGTFTINESTIADSPRFPHRGILIDTSRHYLPVKTIFKTLDAMAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSYSLSH-VYTPNDIHMVLEYARLRGIRVIPEFDSPGHTQSWGKGQKNLLTPCFIQKIR-TQKVGPVDPSLNTTYVFFDTFFKEISRVFPDQFIHLGGDEVEFECWASNPNIQNFMKKKGFGNNFRRLESFYIKKILDIITSLKKSS-------IVWQDVFDDQVELQPGTVVEVWKSENYLNELAQVTASGFPAILSAPWYLDLISYGQDWRNYYKAEP-------------LNFEGSEKQKQLVIGGEACLWGEYVDATNLIPRLWPRASAVGERLWSPRIITNLENAYRRLAVHRCRMVSRGIAA 521          
BLAST of Beta-hexosaminidase subunit beta vs. UniProt/SwissProt
Match: sp|P29416|HEXA_MOUSE (Beta-hexosaminidase subunit alpha OS=Mus musculus OX=10090 GN=Hexa PE=1 SV=2)

HSP 1 Score: 356.295 bits (913), Expect = 1.557e-110
Identity = 172/451 (38.14%), Postives = 267/451 (59.20%), Query Frame = 3
Query:  891 VESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTA----EAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERS 2231
            V ++ +++P+L   E Y ++++     ++++  WGALRGLE+ SQ++W++  G  FIN+TK++D PRF HRGV+LDT+RH++P   I+  LD M  NK NVFHWHL DD SFP  +    E    G+++P   +Y  + VKE+IEYAR+RGIRV+ E D+P HTLSW    P ++T C       SG +GPVN +  STY  +++L+ +I ++FPD ++HLG DEV  +C  SN  IQ++M+ +G      L  FY + L +I++       +  +G++VWQE ++    ++  TI+Q+W+ +       E   + +   + + SA WYL+R++YG  W + Y+ +P   +G                 +  ++GGEA MW E++D+ N++PR+WP A A AERLWS N   N + A  RL   RC +  R I A   S  G C Q  E++
Sbjct:  100 VTAECNEFPNLESVENYTLTINDDQCLLASETVWGALRGLETFSQLVWKSAEGTFFINKTKIKDFPRFPHRGVLLDTSRHYLPLSSILDTLDVMAYNKFNVFHWHLVDDSSFPYESFTFPELTRKGSFNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGAPGLLTPCYS-GSHLSGTFGPVNPSLNSTYDFMSTLFLEISSVFPDFYLHLGGDEVDFTCWKSNPNIQAFMKKKGFTDFKQLESFYIQTLLDIVS-------DYDKGYVVWQEVFDNKVKVRPDTIIQVWREEMPVEYMLEMQDITRAGFRALLSAPWYLNRVKYGPDWKDMYKVEPLAFHGTP-------------EQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLWSSNLTTNIDFAFKRLSHFRCELVRRGIQAQPIS-VGYCEQEFEQT 528          
BLAST of Beta-hexosaminidase subunit beta vs. TrEMBL
Match: A0A267E3Z4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013942g3 PE=4 SV=1)

HSP 1 Score: 462.225 bits (1188), Expect = 3.102e-144
Identity = 255/632 (40.35%), Postives = 354/632 (56.01%), Query Frame = 3
Query:  444 VIDTDKPAPDIIVKYDTAMFGLIDS-DSTLHVWRAPFMTFGQIWPHP---FSVITRADIY---EVCPKSDNLIFKLTNVNNY--------ILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHI----VNIYVESDSHQW------PSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQL--GLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDY---------------VNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLW-SPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDC 2210
             + T +P PD +       F L+D  D+  HVWRAPF + G+ WP P   ++  +R  I    ++   +    F LT+            +L+ A  RY+ +I  Q+AVS                                         A    + HI    V + ++S   +W      PSL M+E+Y + +S     +SA E WG LRGL++ SQ++W+T+   +++N T + D+PRFKHRG+++DT+RH++  + +  NLDAM MNK+NVFHWH+ DDQSFP  +    + +  GAYD  + +Y    ++EIIEYARVRGIRVIPE D+P+HT SW   +PE+ T+C +   +W+G YGP+N A  +T+  L  LY +I ++F D +IHLG+DEV TSC  +N  +       G    D LID+Y R+LQNIIT L  G SN+NK RGFIVWQEAY+   +LK+GTIVQ+WK +++ + A +A+   +V+YS CWYLDRLEYG QW   Y CDP   Y        +                  P   +W  N+LGGEA MW E+ D + V+ RIWPLASA AERLW SP    +   A  R+EE RCRM +R IP GVASG G C
Sbjct:   64 AVPTQRPIPDDVGLAGENNFALLDPPDTEFHVWRAPFPSLGEAWPRPTRQYTSRSRGRITAPEQLSLAAKEFQFVLTSPTESDCPIAVVELLKMAFQRYRRVIVDQRAVSVA-------------------------------------AGAAADADGHIWQLSVRLTIQSSDEKWRTAPLMPSLDMDESYTLKISKTEAVLSAPEPWGVLRGLQTFSQLVWQTQDAALYVNSTTIFDKPRFKHRGLLVDTSRHYLSMETLKTNLDAMEMNKLNVFHWHIVDDQSFPYQSVVFPKLSEKGAYD-SNSIYSLSNIREIIEYARVRGIRVIPEFDTPAHTHSWSLGYPEIFTQCFNYANRWTGFYGPMNPALNATFDFLKKLYAEISSVFKDNYIHLGADEVGTSCWDNNPIVNRMRADFGFSRSDQLIDYYFRRLQNIITSLSAGKSNSNK-RGFIVWQEAYDHGVMLKRGTIVQVWKGEAS-DVAMVAQAGYRVLYSTCWYLDRLEYGPQWTKMYLCDPIANYAGTYNGGPFQQQMPQQQPPPQQQQQQQPPPPSWMANVLGGEACMWNEYQDDNTVLQRIWPLASAVAERLWSSPEATRDLLAAGRRIEEQRCRMRARGIPVGVASGPGSC 655          
BLAST of Beta-hexosaminidase subunit beta vs. TrEMBL
Match: A0A267E9J5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006253g2 PE=4 SV=1)

HSP 1 Score: 461.455 bits (1186), Expect = 4.684e-144
Identity = 256/632 (40.51%), Postives = 354/632 (56.01%), Query Frame = 3
Query:  444 VIDTDKPAPDIIVKYDTAMFGLIDS-DSTLHVWRAPFMTFGQIWPHP---FSVITRADIY---EVCPKSDNLIFKLTNVNNY--------ILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHI----VNIYVESDSHQW------PSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQL--GLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDY---------------VNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLW-SPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDC 2210
             + T +P PD +       F L+D  D+  HVWRAPF + G+ WP P   ++  +R  I    ++   +    F LT+            +L+ A  RY+ +I  Q+AVS                                         A    + HI    V + ++S   +W      PSL M+E+Y + +S     +SA E WG LRGL++ SQ++W+T+   ++IN T + D+PRFKHRG+++DT+RH++  + +  NLDAM MNK+NVFHWH+ DDQSFP  +    + +  GAYD  + +Y    ++EIIEYARVRGIRVIPE D+P+HT SW   +PE+ T+C +   +W+G YGP+N A  +T+  L  LY +I ++F D +IHLG+DEV TSC  +N  +       G    D LID+Y R+LQNIIT L  G SN+NK RGFIVWQEAY+   +LK+GTIVQ+WK +++ + A +A+   +V+YS CWYLDRLEYG QW   Y CDP   Y        +                  P   +W  N+LGGEA MW E+ D + V+ RIWPLASA AERLW SP    +   A  R+EE RCRM +R IP GVASG G C
Sbjct:   64 AVPTQRPIPDDVGLAGENNFALLDPPDTEFHVWRAPFPSLGEAWPRPTRQYTSRSRGRITAPEQLSLAAKEFQFVLTSPTESDCPIAVVELLKMAFQRYRRVIVDQRAVSVA-------------------------------------AGAAADADGHIRQLSVRLTIQSSDEKWRTAPLMPSLDMDESYTLKISKTEAQLSAPEPWGVLRGLQTFSQLVWQTQDAALYINSTTIFDKPRFKHRGLLVDTSRHYLSMETLKTNLDAMEMNKLNVFHWHIVDDQSFPYQSVVFPKLSEKGAYD-SNSIYSLSNIREIIEYARVRGIRVIPEFDTPAHTHSWSLGYPEIFTQCFNYANRWTGFYGPMNPALNATFDFLKKLYAEISSVFKDNYIHLGADEVGTSCWDNNPIVNRMRADFGFSRSDQLIDYYFRRLQNIITSLSAGKSNSNK-RGFIVWQEAYDHGVMLKRGTIVQVWKGEAS-DVAMVAQAGYRVLYSTCWYLDRLEYGPQWTKMYLCDPIANYAGTYNGGPFQQQMPQQQPPPQQQQQQQPPPPSWMANVLGGEACMWNEYQDDNTVLQRIWPLASAVAERLWSSPEATRDLLAAGRRIEEQRCRMRARGIPVGVASGPGSC 655          
BLAST of Beta-hexosaminidase subunit beta vs. TrEMBL
Match: A0A267DHF5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005042g2 PE=4 SV=1)

HSP 1 Score: 461.07 bits (1185), Expect = 7.534e-144
Identity = 256/632 (40.51%), Postives = 353/632 (55.85%), Query Frame = 3
Query:  444 VIDTDKPAPDIIVKYDTAMFGLIDS-DSTLHVWRAPFMTFGQIWPHP---FSVITRADIY---EVCPKSDNLIFKLTNVNNY--------ILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHI----VNIYVESDSHQW------PSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQL--GLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDY---------------VNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLW-SPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDC 2210
             + T +P PD +       F L+D  D+  HVWRAPF + G+ WP P   ++  +R  I     +   +    F LT+            +L+ A  RY+ +I  Q+AVS                                         A    + HI    V + ++S   +W      PSL M+E+Y + +S     +SA E WG LRGL++ SQ++W+T+   ++IN T + D+PRFKHRG+++DT+RH++  + +  NLDAM MNK+NVFHWH+ DDQSFP  +    + +  GAYD  + +Y    ++EIIEYARVRGIRVIPE D+P+HT SW   +PE+ T+C +   +W+G YGP+N A  +T+  L  LY +I ++F D +IHLG+DEV TSC  +N  +       G    D LID+Y R+LQNIIT L  G SN+NK RGFIVWQEAY+   +LK+GTIVQ+WK +++ + A +A+   +V+YS CWYLDRLEYG QW   Y CDP   Y        +                  P   +W  N+LGGEA MW E+ D + V+ RIWPLASA AERLW SP    +   A  R+EE RCRM +R IP GVASG G C
Sbjct:   64 AVPTQRPIPDDVGLAGENNFALLDPPDTEFHVWRAPFPSVGEAWPRPTRQYASRSRGRITAPEHLSLAAKEFQFVLTSPTESDCPIAVVELLKMAFQRYRRVIVDQRAVSVA-------------------------------------AGAAADADGHIRQLSVRLTIQSSDEKWRTAPLMPSLDMDESYTLKISKTEAVLSAPEPWGVLRGLQTFSQLVWQTQDAALYINSTTIFDKPRFKHRGLLVDTSRHYLSMETLKTNLDAMEMNKLNVFHWHIVDDQSFPYQSVVFPKLSEKGAYD-SNSIYSLSNIREIIEYARVRGIRVIPEFDTPAHTHSWSLGYPEIFTQCFNYANRWTGFYGPMNPALNATFDFLKKLYAEISSVFKDNYIHLGADEVGTSCWDNNPIVNRMRADFGFSRSDQLIDYYFRRLQNIITSLSAGKSNSNK-RGFIVWQEAYDHGVMLKRGTIVQVWKGEAS-DVAMVAQAGYRVLYSTCWYLDRLEYGPQWTKMYLCDPIANYAGTYNGGPFQQQMPQQQPPPQQQQQQQPPPPSWMANVLGGEACMWNEYQDDNTVLQRIWPLASAVAERLWSSPEATRDLLAAGRRIEEQRCRMRARGIPVGVASGPGSC 655          
BLAST of Beta-hexosaminidase subunit beta vs. TrEMBL
Match: A0A419QD00 (Beta-hexosaminidase subunit beta (Fragment) OS=Clonorchis sinensis OX=79923 GN=Hexb PE=4 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 2.599e-130
Identity = 234/646 (36.22%), Postives = 353/646 (54.64%), Query Frame = 3
Query:  417 EDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDST-LHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKL-------------------------KGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTR-AGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDS--LIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDC---GQISERSGIAPDESFD 2258
            +D++ KN  + D     P   + Y+ + +   +  S  + V RAPF TFG + P P+        Y V    + L F+L  V+NYIL+ A+ R K +I ++  +S YP+ W HQEP+L +  +         T+     G+    A +                             LH + IYV S    WPSL M+E+Y + V  + IF+ A ETWGALRGLESLSQ+MWRT    +++IN+T + D+PRF HRG+++DT+RHFI K I++ NL+AM  NK+NV HWH+ DD SFP  ++     +  GA+  + +VY    +KEI+E+AR+RGIRVIPE D P HT S   S PE++ +C       + ++GP+N     TY+ + +   ++ NLFPD++IHLG DEV  +C  ++  +   +R++   ++     +D++ +++QNIIT+LG      +R  +VWQE   +   LK   + Q+WK     E A    +N+  ++S+CWYLD L +   W+ +Y CDP  +   Q           + +    +LGGEA MW E+   D ++ +IWP+ S  AERLWSP+++NN      R+EE RCRM SR IP  V  G G C   G I+   G +  E+ D
Sbjct:   16 KDDQKKNPYIWDRHTVTPYDKLVYENSYWAFTNLPSVRIPVLRAPFPTFGMVMPLPYWWSGTERFYPV--DVNGLEFQLVGVDNYILRSAISRCKQVITSRSGLSVYPNRWTHQEPLLADWTKEYQTNKRTSTRVAGTAGADLDIAERPTFWWSEKRVQWFYQIFKSPQQQHQPSTPLHRIRIYVRSSGKDWPSLQMDESYAVLVDGEQIFLVANETWGALRGLESLSQLMWRTSDMTQVYINQTYIFDKPRFPHRGLLVDTSRHFISKSILLVNLEAMAYNKLNVLHWHIVDDNSFPYQSQKFPSLSQKGAWH-KRQVYTQHDIKEIVEFARLRGIRVIPEFDIPGHTRSLAYSKPELLAQCQGYEDN-TVYFGPLNPFINETYQFIENFLIEMFNLFPDEYIHLGGDEVQPACWDADLEM---VRTQAKLNLQGALTLDYFWKRVQNIITELGNRKPANRRKIVVWQEVAAQVLELKNSVVSQVWKPDIPGEFA--LSENL--LFSSCWYLDNLHFIRDWVPYYLCDPLRQLDLQ-----------SSSGPTTLLGGEACMWGEYQADDTILQKIWPVTSGIAERLWSPHWVNNITTVGPRIEEQRCRMISRGIPQAVLLGPGACEFPGAITAMLGASSFETTD 639          
BLAST of Beta-hexosaminidase subunit beta vs. TrEMBL
Match: C7TXU0 (Beta-hexosaminidase alpha chain OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 419.853 bits (1078), Expect = 2.258e-128
Identity = 247/627 (39.39%), Postives = 336/627 (53.59%), Query Frame = 3
Query:  540 RAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDL-LTNGKQT------------KSKTKFGSSYPYA----------------AKLKGEL---------HIVNIY--------------------VESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRA-GRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAP 2243
            R+P  TFG  WP P S  T +  Y V     +  F   N NN ILQ A+ RY  I+  +   S YP  W+H E  L + +  D  L  GK              KS + F + + Y+                AK + +L         H++++Y                    V SDS + P   M+E+Y + VS  GI I A ETWGALR LE+LSQ+MW TR    +FIN+T ++D PRFKHRG+M+DT+RHF+ K +I+ NL+AM  NK+NV HWH+ DDQSFP  +  + E +  GAY  E  VY P  +KEI+E+AR RGIRVIPE D P HT S   SHPE+M++C + + K  G+YGP+N A   TY  L +L  ++  LF D +IHLG DEV T C   +  IQ  + + G FS     +++ R++QN++T +G SN   +R  I+WQ+  +  + LKK  +V +W SQ      +   Q   +IYS+CWYLD L    +W   YQCDP +              P+N      I+GGEA MW E+     V+ RIWP  SA AERLWS   + + + A  R+EE RCR+ +R IPAGV  G G C    E S + P
Sbjct:  103 RSPHPTFGSPWPLPRSWSTTSCYYNVDITDFHFKFHRKNSNN-ILQSAINRYMYIVQNKLGFSMYPKVWQHDEDRLLSYSFDDYQLKCGKSVVKSSQDTHNNIHKSHSSFRADHSYSRGTNNHFSYNTAIDIDAKTENDLSHSVSQKISHLIHMYELSPHGVLRNEIQKYTLLHVVNSDS-KLPHANMDESYILGVSENGILIVANETWGALRALETLSQLMWTTRGQSHVFINKTYIEDFPRFKHRGLMIDTSRHFMSKSVILLNLEAMSYNKLNVLHWHIVDDQSFPYQSSVYPELSAMGAYR-EDLVYTPSDIKEILEFARFRGIRVIPEFDIPGHTRSISLSHPEIMSQC-ERSSKSYGYYGPLNPATNKTYTFLKNLLSEVFKLFLDDYIHLGGDEVETGCWERDPEIQQSVENPGYFSPAFWNNYFWRRVQNLVTHIGQSNPKLKRSLILWQDVLQHVTELKKSLLVHVWNSQ----PESYLSQGYNIIYSSCWYLDSLNDIKRWTEFYQCDPAN------------TAPLNT--ERQIIGGEACMWSEYQSDYTVLTRIWPATSAVAERLWSSKEVTDLKYAGPRIEEQRCRLLNRGIPAGVLLGPGYC----ESSSLIP 703          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Cavefish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 343.969 bits (881), Expect = 3.385e-106
Identity = 175/443 (39.50%), Postives = 255/443 (57.56%), Query Frame = 3
Query:  867 ELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALH-GAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQST-AEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            EL ++    + +   +P+L  +E+YQ+ V      + A   WGALRGLE+ SQ+++    G   IN+T + D PRF HRG++LDT+RH++P   I+ NL+AM MNK NVFHWH+ DD SFP ++    + +   GA+ P   VY P  VK +IE+AR+RGIRV+ E D+P HT SW K  P+++T C   +   +G +GPVN    STY  +T  +K++  +FPD +IHLG DEV  SC  SN  IQ +M  +G F  D   L  +Y ++L +I+     S  NK  G++VWQE ++    LK  T+V++W + +   E   +       I SA WYLD + YG  W  +Y+ +P    G                 ++ ++GGEA +W E++D  N+ PR+WP ASA  ERLWS   + +   A +RL + RCRM  R IPA
Sbjct:  136 ELQVLLTAKDPECDGYPNLKTDESYQLEVDQPTSVLKAANVWGALRGLETFSQLVYEDDYGAHKINKTSISDFPRFAHRGILLDTSRHYLPLKAILTNLEAMAMNKFNVFHWHIVDDHSFPFLSRTFPDLSQRKGAFHPYTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGKGQPDLLTPCFSGSSP-TGTFGPVNPILNSTYDFMTRFFKEVSTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMDQQG-FGQDYKKLESYYIQRLLDIV-----SATNK--GYMVWQEVFDNGVKLKGDTVVEVWMNNNVDGELQKVTGSGFTTILSAPWYLDYISYGQDWQKYYKVEPLSFQGTA-------------EQKKLVIGGEACLWGEYVDGTNLTPRLWPRASAVGERLWSDENVKDINSAYNRLAKHRCRMVQRGIPA 556          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Cavefish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 343.969 bits (881), Expect = 5.754e-106
Identity = 175/443 (39.50%), Postives = 255/443 (57.56%), Query Frame = 3
Query:  867 ELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALH-GAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQST-AEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            EL ++    + +   +P+L  +E+YQ+ V      + A   WGALRGLE+ SQ+++    G   IN+T + D PRF HRG++LDT+RH++P   I+ NL+AM MNK NVFHWH+ DD SFP ++    + +   GA+ P   VY P  VK +IE+AR+RGIRV+ E D+P HT SW K  P+++T C   +   +G +GPVN    STY  +T  +K++  +FPD +IHLG DEV  SC  SN  IQ +M  +G F  D   L  +Y ++L +I+     S  NK  G++VWQE ++    LK  T+V++W + +   E   +       I SA WYLD + YG  W  +Y+ +P    G                 ++ ++GGEA +W E++D  N+ PR+WP ASA  ERLWS   + +   A +RL + RCRM  R IPA
Sbjct:  154 ELQVLLTAKDPECDGYPNLKTDESYQLEVDQPTSVLKAANVWGALRGLETFSQLVYEDDYGAHKINKTSISDFPRFAHRGILLDTSRHYLPLKAILTNLEAMAMNKFNVFHWHIVDDHSFPFLSRTFPDLSQRKGAFHPYTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGKGQPDLLTPCFSGSSP-TGTFGPVNPILNSTYDFMTRFFKEVSTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMDQQG-FGQDYKKLESYYIQRLLDIV-----SATNK--GYMVWQEVFDNGVKLKGDTVVEVWMNNNVDGELQKVTGSGFTTILSAPWYLDYISYGQDWQKYYKVEPLSFQGTA-------------EQKKLVIGGEACLWGEYVDGTNLTPRLWPRASAVGERLWSDENVKDINSAYNRLAKHRCRMVQRGIPA 574          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Cavefish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 342.043 bits (876), Expect = 2.403e-105
Identity = 176/444 (39.64%), Postives = 255/444 (57.43%), Query Frame = 3
Query:  867 ELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALH-GAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKS--QSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            EL ++    + +   +P+L  +E+YQ+ V      + A   WGALRGLE+ SQ+++    G   IN+T + D PRF HRG++LDT+RH++P   I+ NL+AM MNK NVFHWH+ DD SFP ++    + +   GA+ P   VY P  VK +IE+AR+RGIRV+ E D+P HT SW K  P+++T C   +   +G +GPVN    STY  +T  +K++  +FPD +IHLG DEV  SC  SN  IQ +M  +G F  D   L  +Y ++L +I+     S  NK  G++VWQE ++    LK  T + +WK   Q   E A +       + S+ WYL+R+ YG  W   Y+ DP +  G                 ++ ++GGEA +W E++D  N+ PR+WP ASA  ERLWS   + +   A +RL + RCRM  R IPA
Sbjct:  154 ELQVLLTAKDPECDGYPNLKTDESYQLEVDQPTSVLKAANVWGALRGLETFSQLVYEDDYGAHKINKTSISDFPRFAHRGILLDTSRHYLPLKAILTNLEAMAMNKFNVFHWHIVDDHSFPFLSRTFPDLSQRKGAFHPYTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGKGQPDLLTPCFSGSSP-TGTFGPVNPILNSTYDFMTRFFKEVSTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMDQQG-FGQDYKKLESYYIQRLLDIV-----SATNK--GYMVWQEVFDNGVKLKADTQLHVWKENPQYQDEMARITAAGFYTLLSSPWYLNRISYGQDWQAVYKADPQNFNGTA-------------EQKKLVIGGEACLWGEYVDGTNLTPRLWPRASAVGERLWSDENVKDINSAYNRLAKHRCRMVQRGIPA 575          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Cavefish
Match: hexa (beta-hexosaminidase subunit alpha-like [Source:NCBI gene;Acc:103046771])

HSP 1 Score: 323.168 bits (827), Expect = 6.082e-99
Identity = 168/441 (38.10%), Postives = 259/441 (58.73%), Query Frame = 3
Query:  879 VNIYVES-DSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGM-FSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWK---SQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWS-PNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            V++ V+S +   +P    +E+Y +SV+     + A+  WGALRGLES SQ++++ +    F+N+T++QD PRF+ RG++LDT+RH++P + I+K LDAM  +K NVFHWH+ DD SFP  + ++ + +  GA+ P   +Y    VK +I +AR+RGIRVIPE D+P HT SW K  P ++T C   +   SG +GPVN    STY+ ++ L+K++ ++FPD ++HLG DEV  +C  SN  ++++M   G       L  +Y   + NI + L     NK    IVWQ+ ++    + K T++++WK   +    E A +     +V+ SA WY++ + YG  W N Y   P +  G              D  +  ++GGE  MW E++DA N+ PR+WP A AAAERLWS     +N ++A  RLE+ RC +  R I A
Sbjct:   99 VSVSVKSGECDGYPDEGSDESYNLSVAAGAAALKAQSVWGALRGLESFSQLVYQDKYNMYFVNKTEIQDFPRFEFRGLLLDTSRHYLPLNAILKTLDAMAYSKFNVFHWHIVDDPSFPYQSYSYPDLSSKGAFHPMTHIYTQSDVKRVISHARMRGIRVIPEFDTPGHTQSWGKGQPNLLTPCYKGDVP-SGTFGPVNPILDSTYQFMSGLFKEMKSVFPDSYVHLGGDEVNFACWKSNPNVRAFMTKMGFGHDYTKLESYYIENIVNISSAL-----NKTP--IVWQDVFDYRERIPKDTVLEIWKGVPADYRTELAKITHAGYRVLLSAPWYINHISYGQDWRNSYTVQPQNFSG-------------TDQQKALVIGGEVCMWGEYVDATNLHPRLWPRACAAAERLWSNEEMTSNVDQAFPRLEKFRCSLIRRGIQA 518          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Cavefish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 285.419 bits (729), Expect = 8.516e-85
Identity = 157/443 (35.44%), Postives = 228/443 (51.47%), Query Frame = 3
Query:  867 ELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKS--QSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            EL ++    + +   +P+L  +E+YQ+ V      + A   WGALRGLE+ SQ+++    G                                      +AM MNK NVFHWH+ DD SFP ++    + +  GA+ P   VY P  VK +IE+AR+RGIRV+ E D+P HT SW K  P+++T C   +   +G +GPVN    STY  +T  +K++  +FPD +IHLG DEV  SC  SN  IQ +M  +G F  D   L  +Y ++L +I+     S  NK  G++VWQE ++    LK  T + +WK   Q   E A +       + S+ WYL+R+ YG  W   Y+ DP +  G                 ++ ++GGEA +W E++D  N+ PR+WP ASA  ERLWS   + +   A +RL + RCRM  R IPA
Sbjct:  154 ELQVLLTAKDPECDGYPNLKTDESYQLEVDQPTSVLKAANVWGALRGLETFSQLVYEDDYG-------------------------------------AEAMAMNKFNVFHWHIVDDHSFPFLSRTFPDLSQRGAFHPYTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGKGQPDLLTPCFSGSSP-TGTFGPVNPILNSTYDFMTRFFKEVSTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMDQQG-FGQDYKKLESYYIQRLLDIV-----SATNK--GYMVWQEVFDNGVKLKADTQLHVWKENPQYQDEMARITAAGFYTLLSSPWYLNRISYGQDWQAVYKADPQNFNGTA-------------EQKKLVIGGEACLWGEYVDGTNLTPRLWPRASAVGERLWSDENVKDINSAYNRLAKHRCRMVQRGIPA 537          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Sea Lamprey
Match: hexa (hexosaminidase A (alpha polypeptide) [Source:ZFIN;Acc:ZDB-GENE-050417-283])

HSP 1 Score: 338.191 bits (866), Expect = 1.007e-105
Identity = 186/475 (39.16%), Postives = 269/475 (56.63%), Query Frame = 3
Query:  831 GSSYPYAA-----------KLKGELHIVNIYVES---DSHQWPSLYMNE--TYQISVSLKGIFISAKETWGALRGLESLSQMMWR--TRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKW-SGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQS---TAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            GS YP A+           +  GE+ ++++ V+S   D + +P L      T ++SV      + A   WGALRGLE+ SQ+ +R      +I +N+T+V D PRF+HRG++LDT+RH++P  +I++ LDAM  NK+NVFHWH+ DDQSFP  ++   E +  GAY+P   +Y    V  +I YAR RGIRVIPE D+P HT SW K  P ++T C   NGK  SG +GPV+    STY  +  L+ +I N FPD +IHLG DEV+ SC  SN  I S+M  +  F  D   L  +Y +++ +I+          ++G++VWQE ++    LK  T+V +WK  +     E A +       + SA WY++ + YG  W  +Y  +P D +G              D  +E ++GGEA +W E++D  N+ PR+WP ASA AERLWS   + +   A SRL + RCRM  R I A
Sbjct:   41 GSPYPGASSKLHRKPTTKTRAVGEVSLLSVLVQSSHNDCNDFPGLKCLSVLTDELSVQAGESLLQAPSVWGALRGLETFSQLAYRDDNDGNKILMNKTEVVDFPRFRHRGLLLDTSRHYLPLIVILETLDAMAYNKLNVFHWHIVDDQSFPYQSQTFPELSEKGAYNPSRAIYTETDVGAVIWYARERGIRVIPEFDTPGHTQSWGKGEPNLLTPC--YNGKEPSGLFGPVHPVTNSTYDFMKKLFNEISNAFPDHYIHLGGDEVSFSCWQSNPDITSFME-KMSFGKDYKKLESYYIQQILDIVASY-------KKGYMVWQEVFDNGVKLKPDTVVHVWKFMAEHYKQEMADVTAAGFSTLLSAPWYINSIAYGQDWTKYYAVEPLDFHG-------------TDKQKELVVGGEACLWGEYVDGTNLTPRLWPRASAVAERLWSDKSVTDVNDAYSRLAKHRCRMV-RGIAA 491          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Nematostella
Match: EDO49845 (Beta-hexosaminidase [Source:UniProtKB/TrEMBL;Acc:A7RET7])

HSP 1 Score: 333.183 bits (853), Expect = 5.188e-103
Identity = 191/552 (34.60%), Postives = 279/552 (50.54%), Query Frame = 3
Query:  561 GQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWM-RSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATL-AKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDC 2210
            G IWP+P +      ++ + P  +   F +    + +L+ AV RY ++      V                                TK     P+      E+ +V+ Y   D      L  +E+Y ++V+     I A   WGALRGLE+ SQ++ ++  G  +    K++D PRF HR  M+DT+RH++   II K LDAM   K NV HWH+ DDQSFP  ++     +  G+++ +  VY P  V +II+YAR+RGIRVIPE D+P HT SWR S P ++T+C D  GK +G  GP++    S Y  L + + ++   FPDQ+IHLG DEV   C  SN  I +WM + R   +   L ++Y  KL NII  LG       + +I+WQE  + +  +   T+V +WK    AE A +   + ++ I S+ WYL+ + YG  W N+Y+ +P D  G              D  +E ++GG   MW EF+D  N++ R WP A A AERLWS     +   A +R+ E RCR   R IPA  A  A  C
Sbjct:   48 GSIWPNPQAQKPDGKVFSLLP--NKFSFSINGKTSDVLKAAVNRYMNLTFPDFTV--------------------------------TKKDDKLPFMEG--AEVIVVDDYKPMD------LTTDESYTLTVTAPQSSIYAYTVWGALRGLETFSQIVHQSEDGMYYAKGNKIEDYPRFHHRAFMIDTSRHYLKLSIIKKFLDAMSYAKFNVLHWHVVDDQSFPFQSQTFPSLSDQGSFNNKTHVYSPADVADIIDYARMRGIRVIPEFDTPGHTYSWR-SIPNLLTKCCDAKGKPTGSLGPIDPTIDSNYDFLKAFFGEVAKRFPDQYIHLGGDEVGFGCWQSNPNITAWMEKMRFGTNYSKLEEYYETKLLNIIGGLG-------KQYIIWQEVVDNDVKVLPDTVVNVWKGGWPAELAKVTGAKKLKAILSSPWYLNYISYGIDWPNYYKVEPTDFEG-------------TDQEKELVIGGTGCMWGEFVDGTNILARTWPRALAIAERLWSSKSTTDMTSAYARIWEHRCRYLLRGIPAEPAVEAKFC 536          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Nematostella
Match: EDO26761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB56])

HSP 1 Score: 196.438 bits (498), Expect = 9.298e-56
Identity = 117/365 (32.05%), Postives = 191/365 (52.33%), Query Frame = 3
Query: 1068 TKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHA---EFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEV-----MTRCIDMNGKWSGHYGP-VNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTA-EAATL---AKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAE 2123
            TK+ D PRF  RG+++D ARHF P D+I +NL+A+   KMNVFHWHLTDDQ F + ++ +    E A  G Y  +H+      +K++++YA   GIRVIPEID P H  +   ++PE+      T  +  N   +G + P +N     TY  L +L+ ++ +LFPD++ H+G DE      S N+ + ++ +   + +   L  ++  KL+ I+++ G       +  + W E   +N  +    ++  W+  +   + +TL   AK+  Q + S  +Y+DR++     ++HY+ DP              N  +    R  +LGGEA MW E +    +  RIWP  +A AER WSP  I + +
Sbjct:    1 TKISDTPRFLWRGLLIDAARHFQPVDVIKRNLEALAAVKMNVFHWHLTDDQGFRIESKVYPKLHELASDGLYYTQHQ------IKDVVKYAARLGIRVIPEIDVPGHATAILTAYPELGSKDKYTYTLQRN---AGIFDPTLNPTIDKTYEFLENLFAEVTSLFPDEYFHIGGDENEGKHWSENKKMTAFKKKHNLKTNHDLQTYFNIKLEKILSKFG-------KKLMGWDEIMTKN--MPTTAVIHSWRGTTEGLKESTLIEAAKKGYQSVLSNGYYIDRMQ---SVVHHYKVDP------------IGNAKLTPAQRARVLGGEATMWGELVTPLTIDSRIWPRTAAIAERFWSPKNITDID 332          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Nematostella
Match: EDO29436 (Beta-hexosaminidase [Source:UniProtKB/TrEMBL;Acc:A7T3N0])

HSP 1 Score: 142.124 bits (357), Expect = 1.615e-35
Identity = 106/388 (27.32%), Postives = 178/388 (45.88%), Query Frame = 3
Query:  867 ELHIVNIYVESDSHQWPSLYMNETYQISVSLKG---IFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMW 2021
            EL ++ I V+SD     SL    +Y+ S+S        ++A   +GAL G+E+ SQ++     G +      + D+P F HRG+MLDT R F P D++   LDAM   K+NV H+HL+D   F + ++   +       + E ++Y  + V+ ++ YAR RGIRV+PE++  +H         + +  C       SG+    N    +T + + ++  +++ LFP+Q  HLG DEV T    + Q++QS                +   LQ  + QLG       +    W+EA      +   T++Q WK++       L +  I  + S             +LN+    P   + +       + V +N+   + +LGGE AMW
Sbjct:   93 ELEVLRISVKSDDE---SLNEGTSYEYSLSFDSGPQATLTALTPYGALYGMETFSQLVVD---GSLVYTSVSISDKPSFVHRGLMLDTGRRFFPMDLLYNTLDAMSYVKLNVLHFHLSDLCRFSVESKLFPDLR-----NNESEIYTQDDVRNLVAYARDRGIRVMPEVEGAAHANGLLGLKNKGLQFC-----NHSGYTQLYNDPQGNTLKTMKAILSEMVPLFPEQIFHLGLDEVFTDKNCTLQSLQS----------------FELALQEHLLQLG-------KIPAAWEEALSSTKSVTNRTVIQAWKAEGIKTIVDLKQFAINSLSSHF-----------YLNYMGVTPLQLWTD-------IAVGLNETEVQYLLGGEMAMW 423          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Nematostella
Match: EDO46502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ54])

HSP 1 Score: 106.686 bits (265), Expect = 1.872e-23
Identity = 117/469 (24.95%), Postives = 195/469 (41.58%), Query Frame = 3
Query:  933 ETYQISVSLK-GIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGA---YD-PEHKVYRPEV-----------------VKEIIEYARVRGIRVIPEIDSPSHTLSW-----------------RKSHPEVMTRCIDMNGKWSGHY---GPVNMAAASTYRLLTSLYKDIINLFPD----QWIHLGSDEVATSCLSSNQAIQSWMRSRGM-FS----VDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEA-YERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYL--------DRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVND--------------------NWRENILGGEAAMWLEFL-DADNVIPRIWPLASAAAERLW 2096
            E Y++ V+    + I  K   G   G+++L  ++    +    +    ++D PR+++RG+ LD  R+F  K+ + + LDAM   K+N FH+HLT+D+ + L      E    G+   +D  E +   P++                  KEI+EYA  R I VIPEID P+H+ +                   K+   ++T   D +   S  +     +N    STY  +  + K+I+ +       +  H G DEVA    +++ A +++ R  G+ FS    VD L +++ +++ NI     L     + G +  +   Y+R S+         W+      A  LA    +VI S   +L        +  E G  W   +  D    +G  +  + Y NV V                      N  ENILG   A+W E +  AD +   ++P   A AER W
Sbjct:   32 EAYKLDVNEDPSVVIIGKGNAGVFYGIQTLLGIIDTNNSIPSILT---IRDSPRYEYRGMHLDVGRNFKTKETVKRLLDAMATYKLNKFHFHLTEDEGWRLEIPGLEELTSVGSKRCHDLKEQECLLPQLGSDPNGSKVKQFYSVLDYKEILEYAEKRHIEVIPEIDMPAHSRAAIKAMEARYQRFKKIGDDNKAQKYLLTEPGDPSRYISVQWFTDNAINPCMESTYTFVKHVVKEIVRMHQHFQKLKMFHFGGDEVAHGAWTNSTACKNFARRLGLKFSSADIVDKLKEYFVQRVANITKDESLDLGGWEDGMLGPKFVPYDRESIKSSQVFAYAWRG-GGQRAYNLANAGYKVILSQATHLYFDHPYEPEPEERGYYWAARFT-DTRKTFG-YLPEDLYANVKVTKWGEPLDRTALCKEPNSCPPLNKTENILGMTGALWTETVRTADQMDSMVFPRLLALAERAW 494          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Nematostella
Match: EDO42823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E8])

HSP 1 Score: 103.219 bits (256), Expect = 2.647e-22
Identity = 126/490 (25.71%), Postives = 190/490 (38.78%), Query Frame = 3
Query:  891 VESDSHQWPSLYMNETY--QISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGA---YD------------------PEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHY-------------------GPVNMAAASTY----RLLT---SLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFS-----VDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEA-YERNSVLKKGTIV----QLWKSQSTAEAATLAKQNIQVIYSACWYL--------DRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVP--------------------VNDNWRENILGGEAAMWLEFL-DADNVIPRIWPLASAAAERLW 2096
            V+ D +    +  +E Y  +I V+ K I ++     G   G+++L  +  +       +    ++D PR+ +RG+ LD  R+F+ K  ++K LDAM   KMN FH+HLTDD+ + L      E    G+   YD                     + Y     KEI++ A    I+VIPE D P H  +  KS      R  D N   +  Y                     +N    STY    ++LT   S++KDI    P    H G DEVA    + + A +   +  G        VD L  ++  ++ NI    GLS    + G +   E  Y R S      +      +W+  S   A  LA    +V+ +   +L        D  E G  W   +  D    +G  M  N + NV                     V    +ENI+G   A+W E +  AD +   I+P   A AER W
Sbjct:  235 VKGDPNVTRGVASSEAYSLEIKVAEKEIKLTGSHASGVFYGVQTLIALADKENT----VPMVTIKDAPRYGYRGMHLDVGRNFMEKAAVLKLLDAMATYKMNKFHFHLTDDEGWRLEIPGLEELTTVGSKRCYDINTTRCILSQLGSGPSPSTSAQYYSVSDYKEILKRANDLHIQVIPEFDMPGHGYAAIKSMEARFKRLKDSNPSEASKYILSDFNDTSKYLSIQYFTDNAINPCIESTYAFIEKVLTEVKSMHKDIQ---PLTVYHFGGDEVAHGAWTKSSACEQLAQRMGYNLTGSDIVDKLKGYFVERVANITVNDGLSLAGWEDGLLGHGEVPYNRKSFRNSNVMAYAWNNIWEWGSGKRAYLLANAGYKVVMTQATHLYFDFPYEPDPQERGYYWATRF-TDTRKTFGF-MPDNLFNNVEQKVTGEPLTREELCKTEGMCVELVKKENIIGMAGALWTETVRTADQMDSMIFPRLLAVAERAW 715          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Medaka
Match: hexb (hexosaminidase subunit beta [Source:NCBI gene;Acc:101158618])

HSP 1 Score: 365.925 bits (938), Expect = 8.466e-115
Identity = 204/571 (35.73%), Postives = 297/571 (52.01%), Query Frame = 3
Query:  507 LIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNY-------ILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKS---QSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            L+D D    V +A    +G +WP P     +  I EV  K     F+ T+           +LQ A  RY D I               ++ +  N   G L                         EL +     +S    +PS+  +E+Y++SV +    + A   WGAL GLE+ SQ+++    G   IN TKV D PRF HRG++LD++RHF+P  +++ NL+ M MNK NVFHWH+ DDQSFP ++    + +  GAY P   VY P  VK +IE+AR+RGIRVIPE D+P HT SW K   +++T C       SG +GPVN    +TY  ++  +K++ ++FPD ++HLG DEV  +C  SN  I+ +M  +G F  D   L  FY +KL +I+T         ++G+I+WQE ++    LK  T++ +WK    Q   E A +     Q + S+ WYL+R+ YG  W + Y+ DP D  G +               ++ ++GGEA +W E++DA N+ PR+WP ASA AERLWS   + +   A +RL   RCRM  R IPA
Sbjct:   24 LLDEDVIEPVVQA--SKYGSLWPLP----QKVQISEVPLKLSGATFEFTDAKGSTAGPSCSLLQSAYRRYYDYIFGGP----------KKQKMSRNRRAGPLELT----------------------ELQVSITSPDSQCDGYPSVTSDESYELSVDVPVAVLKAPTVWGALHGLETFSQLVYEDDYGAKTINSTKVSDFPRFAHRGILLDSSRHFLPIKVLLANLETMAMNKFNVFHWHIVDDQSFPYLSRTFPQLSQQGAYHPYSHVYTPSDVKMVIEFARLRGIRVIPEFDTPGHTQSWGKGQMDLLTPCFS-GATPSGSFGPVNPILNTTYDFMSRFFKEVSDVFPDGYVHLGGDEVDFTCWKSNPDIKKFMDRQG-FGQDYSKLESFYIQKLLDIVT-------TTKKGYIIWQEVFDNGVKLKPDTLIHVWKGNQEQYQNEMAKITSAGYQTLLSSPWYLNRISYGQDWQSTYKADPQDFKGTE-------------EQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSAKDVTDINDAYNRLSAHRCRMVERGIPA 534          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Medaka
Match: hexb (hexosaminidase subunit beta [Source:NCBI gene;Acc:101158618])

HSP 1 Score: 360.533 bits (924), Expect = 9.326e-113
Identity = 203/569 (35.68%), Postives = 294/569 (51.67%), Query Frame = 3
Query:  507 LIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNY-------ILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLW-KSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPA 2183
            L+D D    V +A    +G +WP P     +  I EV  K     F+ T+           +LQ A  RY D I               ++ +  N   G L                         EL +     +S    +PS+  +E+Y++SV +    + A   WGAL GLE+ SQ+++    G   IN TKV D PRF HRG++LD++RHF+P  +++ NL+ M MNK NVFHWH+ DDQSFP ++    + +  GAY P   VY P  VK +IE+AR+RGIRVIPE D+P HT SW K   +++T C       SG +GPVN    +TY  ++  +K++ ++FPD ++HLG DEV  +C  SN  I+ +M  +G F  D   L  FY +KL +I+T         ++G+I+WQE ++    LK  T+V +W  S S AE   +       I SA WYLD + Y   W  +Y+ +P             +N    +  ++ ++GGEA +W E++DA N+ PR+WP ASA AERLWS   + +   A +RL   RCRM  R IPA
Sbjct:   24 LLDEDVIEPVVQA--SKYGSLWPLP----QKVQISEVPLKLSGATFEFTDAKGSTAGPSCSLLQSAYRRYYDYIFGGP----------KKQKMSRNRRAGPLELT----------------------ELQVSITSPDSQCDGYPSVTSDESYELSVDVPVAVLKAPTVWGALHGLETFSQLVYEDDYGAKTINSTKVSDFPRFAHRGILLDSSRHFLPIKVLLANLETMAMNKFNVFHWHIVDDQSFPYLSRTFPQLSQQGAYHPYSHVYTPSDVKMVIEFARLRGIRVIPEFDTPGHTQSWGKGQMDLLTPCFS-GATPSGSFGPVNPILNTTYDFMSRFFKEVSDVFPDGYVHLGGDEVDFTCWKSNPDIKKFMDRQG-FGQDYSKLESFYIQKLLDIVT-------TTKKGYIIWQEVFDNGVKLKPDTVVHVWMGSGSDAEMNKVTTAGYTTILSAPWYLDYISYAQDWQKYYKVEP-------------LNFNGTEEQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSAKDVTDINDAYNRLSAHRCRMVERGIPA 532          
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Medaka
Match: hexa (beta-hexosaminidase subunit alpha [Source:NCBI gene;Acc:101172329])

HSP 1 Score: 318.161 bits (814), Expect = 1.999e-96
Identity = 168/425 (39.53%), Postives = 247/425 (58.12%), Query Frame = 3
Query:  900 DSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQS-TAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWS-PNFINNAEKAASRLEEMRCRM 2162
            D   +P+   +E Y +SVS     ++A   WG LRGLE+ SQ++++   G  F+NET ++D PRF+ RGV+LDT+RH++P   I+K LDAM  +K NVFHWH+ DD SFP  + +  E +  GA+ P   +Y    V+ +I YAR+RGIRV+PE DSP HT SW K    ++T C    G  SG +GPVN A  STY+ + S +K++ ++FPD +IHLG DEV  SC  SN  ++++M+  G F  D   L  FY   + NI      S NNK    IVWQ+ ++ +      ++V++WK      +   + K  ++VI ++ WYLD       W  +Y   P             +  P ++  +  ++GGE  MW E++DA N+ P++WP ASAAAERLWS     ++ EKA  RLE+ RC++
Sbjct:  113 DCENYPNDDSSERYNLSVSAGQASLNAATVWGILRGLETFSQLVYQDDLGSYFVNETFIEDFPRFQFRGVLLDTSRHYLPVHAILKTLDAMSYSKFNVFHWHIVDDPSFPYQSRSFPELSKKGAFHPATHIYTQSDVRRVISYARMRGIRVLPEFDSPGHTGSWGKGQSHLLTPCYK-GGAPSGTFGPVNPALQSTYQFMASFFKEVTSVFPDSYIHLGGDEVDFSCWRSNPHVRAFMQKMG-FGGDFPKLEAFYIENIVNIT-----SANNKTS--IVWQDVFDYHERRSALSVVEVWKHGCYLCKVRQVTKAGLRVILASPWYLDLPGPTHNWARYYTVWP-------------LAFPGSEKQKRLVIGGEVCMWGEYVDATNLFPKLWPRASAAAERLWSDEKQTSSVEKAFPRLEDFRCKL 515          
BLAST of Beta-hexosaminidase subunit beta vs. Planmine SMEST
Match: SMESG000002681.1 (SMESG000002681.1)

HSP 1 Score: 1583.16 bits (4098), Expect = 0.000e+0
Identity = 775/792 (97.85%), Postives = 775/792 (97.85%), Query Frame = 3
Query:  126 MLYCRRSFLTMTTVMIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDXXXXXXXXXXXXXCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR 2501
            MLYCRRSFLTMTTVMIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTN                 AKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDVLILFLMLMAVLLCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR
Sbjct:    1 MLYCRRSFLTMTTVMIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTN-----------------AKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDVLILFLMLMAVLLCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR 775          
BLAST of Beta-hexosaminidase subunit beta vs. Planmine SMEST
Match: SMESG000002681.1 (SMESG000002681.1)

HSP 1 Score: 1574.68 bits (4076), Expect = 0.000e+0
Identity = 773/792 (97.60%), Postives = 773/792 (97.60%), Query Frame = 3
Query:  126 MLYCRRSFLTMTTVMIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDXXXXXXXXXXXXXCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR 2501
            MLYCRRSFLTMTTVMIFVCFFILFQSTHLVSNDSIGEKS  AKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTN                 AKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDVLILFLMLMAVLLCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR
Sbjct:    1 MLYCRRSFLTMTTVMIFVCFFILFQSTHLVSNDSIGEKS--AKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTN-----------------AKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDVLILFLMLMAVLLCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR 773          
BLAST of Beta-hexosaminidase subunit beta vs. Planmine SMEST
Match: SMESG000002681.1 (SMESG000002681.1)

HSP 1 Score: 1561.97 bits (4043), Expect = 0.000e+0
Identity = 765/782 (97.83%), Postives = 765/782 (97.83%), Query Frame = 3
Query:  156 MTTVMIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDXXXXXXXXXXXXXCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR 2501
            MTTVMIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTN                 AKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDVLILFLMLMAVLLCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR
Sbjct:    1 MTTVMIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTN-----------------AKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDVLILFLMLMAVLLCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR 765          
BLAST of Beta-hexosaminidase subunit beta vs. Planmine SMEST
Match: SMESG000002681.1 (SMESG000002681.1)

HSP 1 Score: 1553.11 bits (4020), Expect = 0.000e+0
Identity = 761/778 (97.81%), Postives = 761/778 (97.81%), Query Frame = 3
Query:  168 MIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDXXXXXXXXXXXXXCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR 2501
            MIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTN                 AKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDVLILFLMLMAVLLCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR
Sbjct:    1 MIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTN-----------------AKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDVLILFLMLMAVLLCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR 761          
BLAST of Beta-hexosaminidase subunit beta vs. Planmine SMEST
Match: SMESG000002681.1 (SMESG000002681.1)

HSP 1 Score: 1552.73 bits (4019), Expect = 0.000e+0
Identity = 763/782 (97.57%), Postives = 763/782 (97.57%), Query Frame = 3
Query:  156 MTTVMIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDXXXXXXXXXXXXXCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR 2501
            MTTVMIFVCFFILFQSTHLVSNDSIGEKS  AKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTN                 AKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDVLILFLMLMAVLLCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR
Sbjct:    1 MTTVMIFVCFFILFQSTHLVSNDSIGEKS--AKHSLERFNEIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDNELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWPHPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAVSYYPSHWRHQEPILNNANEGDLLTN-----------------AKLKGELHIVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGTIVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISERSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDVLILFLMLMAVLLCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR 763          
The following BLAST results are available for this feature:
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HEXB4.133e-11341.20hexosaminidase subunit beta [Source:HGNC Symbol;Ac... [more]
HEXA1.302e-10636.06hexosaminidase subunit alpha [Source:HGNC Symbol;A... [more]
HEXA8.570e-10633.75hexosaminidase subunit alpha [Source:HGNC Symbol;A... [more]
HEXA6.877e-10536.46hexosaminidase subunit alpha [Source:HGNC Symbol;A... [more]
HEXB4.321e-8241.94hexosaminidase subunit beta [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hex-11.853e-8435.03Beta-hexosaminidase A [Source:UniProtKB/Swiss-Pro... [more]
hex-11.853e-8435.03Beta-hexosaminidase A [Source:UniProtKB/Swiss-Pro... [more]
hex-11.853e-8435.03Beta-hexosaminidase A [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fdl2.407e-5229.40gene:FBgn0045063 transcript:FBtr0346633[more]
fdl2.407e-5229.40gene:FBgn0045063 transcript:FBtr0087946[more]
fdl2.456e-5229.40gene:FBgn0045063 transcript:FBtr0087947[more]
fdl2.724e-5229.40gene:FBgn0045063 transcript:FBtr0474148[more]
fdl3.143e-5229.40gene:FBgn0045063 transcript:FBtr0339637[more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hexb5.006e-10640.72hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
hexa8.596e-10239.72hexosaminidase A (alpha polypeptide) [Source:ZFIN;... [more]
hexa5.647e-9439.02hexosaminidase A (alpha polypeptide) [Source:ZFIN;... [more]
hexb2.061e-8340.05hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
hexb4.113e-5337.89hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hexb1.325e-11836.86hexosaminidase B (beta polypeptide) [Source:NCBI g... [more]
hexb1.640e-11536.50hexosaminidase B (beta polypeptide) [Source:NCBI g... [more]
hexb1.595e-11339.87hexosaminidase B (beta polypeptide) [Source:NCBI g... [more]
hexb2.130e-11140.04hexosaminidase B (beta polypeptide) [Source:NCBI g... [more]
hexb8.507e-10935.40hexosaminidase B (beta polypeptide) [Source:NCBI g... [more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hexb2.443e-11541.78hexosaminidase B [Source:MGI Symbol;Acc:MGI:96074][more]
Hexa2.226e-11138.14hexosaminidase A [Source:MGI Symbol;Acc:MGI:96073][more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20060|HEXB_MOUSE1.709e-11441.78Beta-hexosaminidase subunit beta OS=Mus musculus O... [more]
sp|P49614|HEXB_FELCA1.184e-11242.60Beta-hexosaminidase subunit beta OS=Felis catus OX... [more]
sp|P07686|HEXB_HUMAN1.697e-11241.20Beta-hexosaminidase subunit beta OS=Homo sapiens O... [more]
sp|Q6AXR4|HEXB_RAT6.400e-11236.68Beta-hexosaminidase subunit beta OS=Rattus norvegi... [more]
sp|P29416|HEXA_MOUSE1.557e-11038.14Beta-hexosaminidase subunit alpha OS=Mus musculus ... [more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E3Z43.102e-14440.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E9J54.684e-14440.51Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DHF57.534e-14440.51Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A419QD002.599e-13036.22Beta-hexosaminidase subunit beta (Fragment) OS=Clo... [more]
C7TXU02.258e-12839.39Beta-hexosaminidase alpha chain OS=Schistosoma jap... [more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hexb3.385e-10639.50hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
hexb5.754e-10639.50hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
hexb2.403e-10539.64hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
hexa6.082e-9938.10beta-hexosaminidase subunit alpha-like [Source:NCB... [more]
hexb8.516e-8535.44hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hexa1.007e-10539.16hexosaminidase A (alpha polypeptide) [Source:ZFIN;... [more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498455.188e-10334.60Beta-hexosaminidase [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO267619.298e-5632.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO294361.615e-3527.32Beta-hexosaminidase [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO465021.872e-2324.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428232.647e-2225.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hexb8.466e-11535.73hexosaminidase subunit beta [Source:NCBI gene;Acc:... [more]
hexb9.326e-11335.68hexosaminidase subunit beta [Source:NCBI gene;Acc:... [more]
hexa1.999e-9639.53beta-hexosaminidase subunit alpha [Source:NCBI gen... [more]
back to top
BLAST of Beta-hexosaminidase subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002681.10.000e+097.85SMESG000002681.1[more]
SMESG000002681.10.000e+097.60SMESG000002681.1[more]
SMESG000002681.10.000e+097.83SMESG000002681.1[more]
SMESG000002681.10.000e+097.81SMESG000002681.1[more]
SMESG000002681.10.000e+097.57SMESG000002681.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012514 ID=SMED30012514|Name=Beta-hexosaminidase subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=3096bp
CCAATTGAATTGGTTGGAAATTTCAATTATTGTTTGTATATCTGAAATTT
ACTATTCTTATTCCCCACCAATATCGGTTTGATTCATCTCAAAGCGGTAT
AATATTCTCGACTGATATTTATAATATGCTCTACTGTCGCCGTTCATTTC
TCACAATGACTACTGTAATGATATTTGTTTGTTTTTTCATTTTATTTCAA
TCTACTCATCTGGTATCGAATGATAGCATTGGGGAGAAATCAGTAACAGC
GAAACACTCATTAGAACGATTCAATGAAATTAAAAATGTAAAAAACATAT
TGAAAATTCCGTGGAACGACAATGTGAATAAAACAACTCCTAAATCCGGT
AGTTACAAATTGAACGAATCAAGAGAAAAAATAGCTTGGAACCACAAACT
AAATATAAATCTTCTTGAAGACAATGAATTGAAAAATGGAGAAGTTATTG
ATACCGACAAACCTGCACCCGATATTATCGTTAAGTACGACACGGCAATG
TTCGGCTTGATCGATTCAGACAGCACATTACACGTATGGCGAGCACCGTT
TATGACATTTGGACAAATATGGCCACATCCGTTTTCTGTCATCACCAGAG
CAGATATTTATGAAGTTTGTCCCAAGTCTGACAACTTAATATTTAAATTA
ACAAATGTTAACAATTATATTTTACAGGAGGCTGTGATGAGATACAAAGA
CATTATTTGCACACAGAAAGCTGTATCTTATTACCCATCTCATTGGCGTC
ATCAAGAACCAATACTTAACAATGCCAACGAAGGAGATCTACTAACTAAT
GGTAAGCAAACGAAATCTAAAACAAAGTTTGGATCCTCATATCCTTATGC
AGCTAAACTGAAAGGTGAACTCCACATCGTCAATATATATGTCGAATCAG
ATAGCCATCAATGGCCTAGCTTGTACATGAATGAAACTTATCAAATTAGT
GTTTCATTGAAAGGGATATTTATTTCGGCAAAAGAAACTTGGGGAGCTTT
AAGAGGTCTCGAAAGTTTATCACAAATGATGTGGCGAACACGAGCTGGAA
GAATATTTATTAATGAAACAAAAGTACAAGATCAACCTAGATTTAAACAT
CGCGGTGTTATGCTTGATACTGCTAGACATTTCATACCTAAAGATATCAT
TATGAAAAATCTTGATGCCATGGTCATGAACAAGATGAACGTTTTCCATT
GGCATTTAACTGATGACCAATCGTTTCCTCTGATTACTGAAAATCATGCG
GAATTCGCGTTGCATGGTGCATATGACCCAGAACACAAAGTGTATAGGCC
AGAAGTGGTGAAAGAGATAATCGAATATGCTCGAGTTAGAGGTATCCGTG
TGATCCCTGAAATTGATTCTCCAAGCCATACACTGAGCTGGAGAAAAAGT
CATCCAGAAGTCATGACGAGATGCATTGATATGAATGGGAAATGGTCGGG
TCATTATGGCCCGGTTAACATGGCAGCTGCCTCAACTTATCGACTGCTTA
CCAGTTTGTATAAAGATATCATTAATTTATTCCCAGATCAGTGGATTCAT
CTTGGATCGGATGAAGTAGCAACCTCGTGTTTGTCTAGCAATCAAGCCAT
TCAAAGTTGGATGCGATCAAGAGGCATGTTTTCCGTGGATTCATTGATAG
ATTTCTATACTCGTAAACTTCAAAATATAATTACACAACTCGGTCTTTCT
AATAATAACAAGCAGCGTGGCTTTATCGTTTGGCAGGAAGCCTACGAACG
CAATTCTGTTCTCAAGAAAGGCACGATTGTGCAATTATGGAAAAGTCAAT
CAACCGCCGAAGCAGCTACTCTAGCTAAACAAAACATTCAAGTTATTTAT
TCGGCTTGTTGGTATTTGGATCGACTGGAATATGGCGCACAGTGGCTCAA
TCATTATCAATGCGACCCAGGAGACGAGTATGGTAATCAAATGGTGATGA
ATGACTACGTCAATGTTCCTGTAAATGATAATTGGCGGGAGAATATTCTT
GGTGGAGAAGCAGCGATGTGGCTGGAGTTCCTTGACGCTGATAATGTGAT
ACCTCGAATTTGGCCATTAGCAAGTGCCGCCGCTGAACGGTTGTGGAGCC
CAAATTTTATAAACAATGCTGAAAAGGCTGCGTCGCGTCTGGAAGAAATG
AGATGTCGAATGTTCAGTCGATCAATTCCTGCCGGGGTAGCTAGTGGTGC
TGGAGATTGCGGTCAGATCAGTGAGCGCAGTGGTATAGCTCCAGATGAAT
CTTTTGATGGAGACAAGTCATCGAATGACATATCGAATACCAGTTCAGCA
AGATTGATTCTCCAAGTGATTGTGAACCTATTCCACAAAGACGTTCTTAT
ATTGTTTCTAATGTTGATGGCTGTATTGCTTTGCATTTATTTGAGGTTAC
ATATACACTTCTCAACCCGTAAACTTATGATGGTTGTCATGTCAACGATG
AGCTTGTACATGTTCGTGTGGATATTGTCTCAGAATATGTTGACCAGTCG
CTAATCATTTTAATAAATTGGTTTGATCATCTGTTCATTCTCTCAATTAT
CAGTGTCTCAATTTCTGGACCCCCCTAGCTTGTGAAAATTTTCTATCATC
GTACAATATCGTGATCTATTATTCGGTTCCTACATTATTGTTCTTATTAT
TCACATTAGTCTTTCTCAAATTCAAAAAACAATTATTTGTCGGTTTCGTT
TGTTAACCTTTGTTAATACCGATTGTTATTTTATCATTTTATTAATATCG
TTACTATTATAATTTTTATTATAATAATTATTATTATTATTTCGTTGGAG
TATGGAAATAGTGAAAATTAATTTTTGATTTGTCTGTTTTTATTAGAATT
TTATTGATTTTCTGATCTGTTGTTTGTGATCCTTATTAAATTTGATTGAT
ATCAATGATAATAATAATTAACATTATTATTATTAATAATTTCACGCTGA
TAACTTACCGTTGCTTGGCTGGACATGTAATAATGGAGAATAAATCGCCT
TGTGATTATTTCCCTTCGGTTTCATGAAGCTTTAATTGAAATTTGCAAGA
ATACGTTCACATTTCATGTTCAGCAATATTCAATTTATATTTGTCG
back to top

protein sequence of SMED30012514-orf-1

>SMED30012514-orf-1 ID=SMED30012514-orf-1|Name=SMED30012514-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=793bp
MLYCRRSFLTMTTVMIFVCFFILFQSTHLVSNDSIGEKSVTAKHSLERFN
EIKNVKNILKIPWNDNVNKTTPKSGSYKLNESREKIAWNHKLNINLLEDN
ELKNGEVIDTDKPAPDIIVKYDTAMFGLIDSDSTLHVWRAPFMTFGQIWP
HPFSVITRADIYEVCPKSDNLIFKLTNVNNYILQEAVMRYKDIICTQKAV
SYYPSHWRHQEPILNNANEGDLLTNGKQTKSKTKFGSSYPYAAKLKGELH
IVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQ
MMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMV
MNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIE
YARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMA
AASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRG
MFSVDSLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYERNSVLKKGT
IVQLWKSQSTAEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGD
EYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLAS
AAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAGDCGQISE
RSGIAPDESFDGDKSSNDISNTSSARLILQVIVNLFHKDVLILFLMLMAV
LLCIYLRLHIHFSTRKLMMVVMSTMSLYMFVWILSQNMLTSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR025705Beta_hexosaminidase_sua/sub
IPR029019HEX_eukaryotic_N
IPR013781Glyco_hydro_catalytic_dom
IPR029018Hex-like_dom2
IPR015883Glyco_hydro_20_cat
IPR017853Glycoside_hydrolase_SF
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
Vocabulary: molecular function
TermDefinition
GO:0004563beta-N-acetylhexosaminidase activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025705Beta-hexosaminidasePRINTSPR00738GLHYDRLASE20coord: 346..367
score: 58.47
coord: 641..658
score: 50.0
coord: 281..301
score: 41.56
coord: 317..334
score: 55.05
coord: 401..418
score: 63.89
coord: 469..482
score: 49.68
coord: 447..465
score: 21.77
coord: 624..640
score: 46.26
IPR029019Beta-hexosaminidase, eukaryotic type, N-terminalPFAMPF14845Glycohydro_20b2coord: 148..301
e-value: 5.4E-12
score: 46.5
NoneNo IPR availableGENE3DG3DSA:3.20.20.80coord: 321..697
e-value: 1.3E-110
score: 372.0
NoneNo IPR availablePANTHERPTHR22600BETA-HEXOSAMINIDASEcoord: 146..691
NoneNo IPR availablePANTHERPTHR22600:SF20BETA-HEXOSAMINIDASE Acoord: 146..691
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 741..760
NoneNo IPR availableTMHMMTMhelixcoord: 767..784
IPR015883Glycoside hydrolase family 20, catalytic domainPFAMPF00728Glyco_hydro_20coord: 323..659
e-value: 2.1E-81
score: 274.1
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 323..687
IPR029018Beta-hexosaminidase-like, domain 2SUPERFAMILYSSF55545beta-N-acetylhexosaminidase-like domaincoord: 148..322