slc7a-9

Overview
Nameslc7a-9 (AKN21453.1)
Smed IDSMED30012513
Length (bp)1563
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc7a-9 (SMED30012513) t-SNE clustered cells

Violin plots show distribution of expression levels for slc7a-9 (SMED30012513) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc7a-9 (SMED30012513) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc7a-9 (SMED30012513) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012513

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30012513SMESG000025359.1 dd_Smed_v4_4548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012513SMESG000025359.1 dd_Smed_v4_4548_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012513SMESG000025359.1 dd_Smed_v4_4548_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc7a-9 vs. Ensembl Human
Match: SLC7A6 (solute carrier family 7 member 6 [Source:HGNC Symbol;Acc:HGNC:11064])

HSP 1 Score: 419.468 bits (1077), Expect = 1.027e-141
Identity = 207/480 (43.12%), Postives = 322/480 (67.08%), Query Frame = 3
Query:   63 AESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLW--KRKPKPFNRMLESINIGVQKMFLVIL 1496
            ++S    DV S      +T+ LKK I+LLNGV+++VG+MIGSGIF+SP GV + T S   S+++W + G+++++GA CYAELG  I +S   YAY+ EAFG  +AFIR+W+ ++V  P   AII++TFA Y+++P +  C+ P +A +LLAAACI ++TFVNC  VK  TRVQD  TYAKV ALI II+ G+VKL  G++ +++  FEG++ + G++++A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VTLIY+L NV+Y+T+L+ S++  S+A+AV    Q +G+  W IP+ VALS FGG+N +I  +SR+F V ++   +P  L+MI+ +  TPIP++LF   ++L YL+  D+F L+NY  F  W   GL+V+  +Y R K  K  RP+++++ FPI++   +VFL+I         S++G  I +S +P Y++ V     R+P     +L +I  G Q++   +L
Sbjct:   20 SQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLSSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRGTQQLCFCVL 499          
BLAST of slc7a-9 vs. Ensembl Human
Match: SLC7A6 (solute carrier family 7 member 6 [Source:HGNC Symbol;Acc:HGNC:11064])

HSP 1 Score: 419.468 bits (1077), Expect = 1.027e-141
Identity = 207/480 (43.12%), Postives = 322/480 (67.08%), Query Frame = 3
Query:   63 AESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLW--KRKPKPFNRMLESINIGVQKMFLVIL 1496
            ++S    DV S      +T+ LKK I+LLNGV+++VG+MIGSGIF+SP GV + T S   S+++W + G+++++GA CYAELG  I +S   YAY+ EAFG  +AFIR+W+ ++V  P   AII++TFA Y+++P +  C+ P +A +LLAAACI ++TFVNC  VK  TRVQD  TYAKV ALI II+ G+VKL  G++ +++  FEG++ + G++++A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VTLIY+L NV+Y+T+L+ S++  S+A+AV    Q +G+  W IP+ VALS FGG+N +I  +SR+F V ++   +P  L+MI+ +  TPIP++LF   ++L YL+  D+F L+NY  F  W   GL+V+  +Y R K  K  RP+++++ FPI++   +VFL+I         S++G  I +S +P Y++ V     R+P     +L +I  G Q++   +L
Sbjct:   20 SQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLSSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRGTQQLCFCVL 499          
BLAST of slc7a-9 vs. Ensembl Human
Match: SLC7A7 (solute carrier family 7 member 7 [Source:HGNC Symbol;Acc:HGNC:11065])

HSP 1 Score: 407.142 bits (1045), Expect = 6.042e-137
Identity = 203/462 (43.94%), Postives = 306/462 (66.23%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKP 1436
            +    E+S  GD  S   E VK   LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S++IW + G++++ GA CYAELG  IK+S   YAY+ EAFG  +AFIR+W  +++  P + AII++TFA Y+++P++  C  P  A +LLAAACI ++TF+NC  VK  T VQDI TYAKV ALI +I+ GIV+LG G + ++E+ FEG++   GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P +I IS  +VT+IY+L NV+Y+T+L   +I  S+A+AV    Q++G+  WIIPL VALS FGG+N +I+  SR+F V ++   +P  + MI+ +  TP+PS+LF  I++L YL   DIF L+NY  F  W   GL+++  +Y R K     RP+++++ FPI++   T+FL+          S++G  I +S +P Y++ +      +P
Sbjct:   11 SQPEVETSPLGDGASPGPEQVK---LKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRP 469          
BLAST of slc7a-9 vs. Ensembl Human
Match: SLC7A7 (solute carrier family 7 member 7 [Source:HGNC Symbol;Acc:HGNC:11065])

HSP 1 Score: 407.142 bits (1045), Expect = 6.042e-137
Identity = 203/462 (43.94%), Postives = 306/462 (66.23%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKP 1436
            +    E+S  GD  S   E VK   LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S++IW + G++++ GA CYAELG  IK+S   YAY+ EAFG  +AFIR+W  +++  P + AII++TFA Y+++P++  C  P  A +LLAAACI ++TF+NC  VK  T VQDI TYAKV ALI +I+ GIV+LG G + ++E+ FEG++   GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P +I IS  +VT+IY+L NV+Y+T+L   +I  S+A+AV    Q++G+  WIIPL VALS FGG+N +I+  SR+F V ++   +P  + MI+ +  TP+PS+LF  I++L YL   DIF L+NY  F  W   GL+++  +Y R K     RP+++++ FPI++   T+FL+          S++G  I +S +P Y++ +      +P
Sbjct:   11 SQPEVETSPLGDGASPGPEQVK---LKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRP 469          
BLAST of slc7a-9 vs. Ensembl Human
Match: SLC7A7 (solute carrier family 7 member 7 [Source:HGNC Symbol;Acc:HGNC:11065])

HSP 1 Score: 407.142 bits (1045), Expect = 6.042e-137
Identity = 203/462 (43.94%), Postives = 306/462 (66.23%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKP 1436
            +    E+S  GD  S   E VK   LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S++IW + G++++ GA CYAELG  IK+S   YAY+ EAFG  +AFIR+W  +++  P + AII++TFA Y+++P++  C  P  A +LLAAACI ++TF+NC  VK  T VQDI TYAKV ALI +I+ GIV+LG G + ++E+ FEG++   GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P +I IS  +VT+IY+L NV+Y+T+L   +I  S+A+AV    Q++G+  WIIPL VALS FGG+N +I+  SR+F V ++   +P  + MI+ +  TP+PS+LF  I++L YL   DIF L+NY  F  W   GL+++  +Y R K     RP+++++ FPI++   T+FL+          S++G  I +S +P Y++ +      +P
Sbjct:   11 SQPEVETSPLGDGASPGPEQVK---LKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRP 469          
BLAST of slc7a-9 vs. Ensembl Celegans
Match: aat-1 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19834])

HSP 1 Score: 421.779 bits (1083), Expect = 2.757e-143
Identity = 224/484 (46.28%), Postives = 322/484 (66.53%), Query Frame = 3
Query:   54 HKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMG---YTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLF-PDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVI 1493
             K    S+ GD    N    K   L+K++TL NGV++IVG +IGSGIF+SPTGV  + GS   S+++WL+ GI+T IGAYCYAELG LIK+S GDYAY+ EAFGP VAFIR+WI+ IV RPC V I++LTFA Y L P +  C  P +  +LLA   I+++T +NC SV+ +T VQD  T AKV AL +II+TG+  L  G   Y  ++E+ FE T+ +   +++AFY+GLFAY+GW++LN +VEE+++P +++P AI IS    T+IYVL NV+ +T +S  E+ ES A+AV    ++YG   +I+PL VA ST G  NG I T++R+F   A+  QMP  L MIN K  TPIP+V+    +S+ YLL   D++ L+NY+    WL  G A+ +L + R       RPI+V +++P I+LA  + L++   +  P ++ +G LIM+SA+PVY I + WK KPK FN  ++S  + +QK+F+V+
Sbjct:    4 EKEPLKSREGDEAPQNETEGKGKGLEKSLTLFNGVSMIVGCIIGSGIFVSPTGVQEQAGSVGLSLIVWLISGIFTAIGAYCYAELGTLIKKSGGDYAYIMEAFGPFVAFIRLWIEAIVVRPCTVTIVALTFAIYGLRPFFPDCAPPDVVAELLAILLIVLMTAINCISVRLATIVQDWFTIAKVVALCLIILTGLGLLFFGESQYKDSFENIFENTSQDFTKVSLAFYSGLFAYSGWNFLNFIVEELQNPKRNLPLAIAISITSCTVIYVLTNVALYTAISPDEMLESPAVAVLFANKLYGKFAFIMPLCVACSTIGSANGVIFTSARLFYSGAREGQMPAVLTMINKKTKTPIPAVILTGALSIAYLLASKDVYQLINYIQISYWLAIGTAIAALFWLRRTMPDASRPIKVPLIWPAIFLAGCIALVLIPMVAAPRDTGIGLLIMLSAVPVYGIFIGWKNKPKWFNEFIDSSTVFIQKLFMVV 487          
BLAST of slc7a-9 vs. Ensembl Celegans
Match: aat-1 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19834])

HSP 1 Score: 421.779 bits (1083), Expect = 2.757e-143
Identity = 224/484 (46.28%), Postives = 322/484 (66.53%), Query Frame = 3
Query:   54 HKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMG---YTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLF-PDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVI 1493
             K    S+ GD    N    K   L+K++TL NGV++IVG +IGSGIF+SPTGV  + GS   S+++WL+ GI+T IGAYCYAELG LIK+S GDYAY+ EAFGP VAFIR+WI+ IV RPC V I++LTFA Y L P +  C  P +  +LLA   I+++T +NC SV+ +T VQD  T AKV AL +II+TG+  L  G   Y  ++E+ FE T+ +   +++AFY+GLFAY+GW++LN +VEE+++P +++P AI IS    T+IYVL NV+ +T +S  E+ ES A+AV    ++YG   +I+PL VA ST G  NG I T++R+F   A+  QMP  L MIN K  TPIP+V+    +S+ YLL   D++ L+NY+    WL  G A+ +L + R       RPI+V +++P I+LA  + L++   +  P ++ +G LIM+SA+PVY I + WK KPK FN  ++S  + +QK+F+V+
Sbjct:    4 EKEPLKSREGDEAPQNETEGKGKGLEKSLTLFNGVSMIVGCIIGSGIFVSPTGVQEQAGSVGLSLIVWLISGIFTAIGAYCYAELGTLIKKSGGDYAYIMEAFGPFVAFIRLWIEAIVVRPCTVTIVALTFAIYGLRPFFPDCAPPDVVAELLAILLIVLMTAINCISVRLATIVQDWFTIAKVVALCLIILTGLGLLFFGESQYKDSFENIFENTSQDFTKVSLAFYSGLFAYSGWNFLNFIVEELQNPKRNLPLAIAISITSCTVIYVLTNVALYTAISPDEMLESPAVAVLFANKLYGKFAFIMPLCVACSTIGSANGVIFTSARLFYSGAREGQMPAVLTMINKKTKTPIPAVILTGALSIAYLLASKDVYQLINYIQISYWLAIGTAIAALFWLRRTMPDASRPIKVPLIWPAIFLAGCIALVLIPMVAAPRDTGIGLLIMLSAVPVYGIFIGWKNKPKWFNEFIDSSTVFIQKLFMVV 487          
BLAST of slc7a-9 vs. Ensembl Celegans
Match: aat-3 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVL7])

HSP 1 Score: 394.815 bits (1013), Expect = 1.083e-132
Identity = 213/485 (43.92%), Postives = 320/485 (65.98%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYT---INWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFP-DIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVI 1493
              + +E   +      + E V    L+KT+TL NGV+IIVG +IGSGIFISPTG+  + GS   S+++W+L G++  IGA+CYAELG LI++S GDYAY+ EAFGP +AF+R+WI+ IV RPC   I++LTFA Y+L+P Y  C+ PP++ +L+AA  ++++T VNC SVK +++VQD     K +AL++II TG+  +  G      ++E+ FE T  +    ++AFY+GLFAY GW+YLN +VEE+++P +++P +I ISC L T+IY L NV+ +T ++  E+  S A+AV    + YG   + +P+FVA ST G  NG ILT+SR+F   A+  QMP  L M+N    TPIP+V+   ++SL YLL   +I++L+NY+    W+  G A+L+L YFR       R ++  IVFPII+    V L++   +G P ++ +G LIM+S +PVY I + WK KPK  + + +S+ I  QK+F+V+
Sbjct:    3 KQEQSEPLNQEPSNEHHDEEVGDKGLEKTMTLFNGVSIIVGCIIGSGIFISPTGIQAQAGSVGLSLIVWVLSGLFAGIGAFCYAELGTLIRKSGGDYAYIMEAFGPFLAFLRLWIESIVVRPCTATIVALTFAIYMLKPFYPDCDSPPLSTELIAALLLVLLTAVNCISVKWASKVQDFFFVTKTAALVLIIFTGLWNMVSGKPEAFDSFENIFENTAKDLETASLAFYSGLFAYQGWNYLNFIVEELQNPKRNLPLSIAISCSLCTIIYTLTNVALYTSITPDEMLASPAVAVLFAEKNYGWFAFCMPIFVACSTIGSANGVILTSSRLFYCGAREGQMPNVLTMVNKTTKTPIPAVILTGLLSLLYLLLSNNIYSLINYIQVSYWIAIGGAILALFYFRKTMPDAPRAVKAPIVFPIIFFIGCVLLVLVPVLGNPKDTAIGILIMLSGVPVYLIFIAWKGKPKCIDSLTDSVTIFTQKLFMVV 487          
BLAST of slc7a-9 vs. Ensembl Celegans
Match: aat-3 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVL7])

HSP 1 Score: 395.201 bits (1014), Expect = 2.312e-132
Identity = 213/485 (43.92%), Postives = 320/485 (65.98%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYT---INWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFP-DIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVI 1493
              + +E   +      + E V    L+KT+TL NGV+IIVG +IGSGIFISPTG+  + GS   S+++W+L G++  IGA+CYAELG LI++S GDYAY+ EAFGP +AF+R+WI+ IV RPC   I++LTFA Y+L+P Y  C+ PP++ +L+AA  ++++T VNC SVK +++VQD     K +AL++II TG+  +  G      ++E+ FE T  +    ++AFY+GLFAY GW+YLN +VEE+++P +++P +I ISC L T+IY L NV+ +T ++  E+  S A+AV    + YG   + +P+FVA ST G  NG ILT+SR+F   A+  QMP  L M+N    TPIP+V+   ++SL YLL   +I++L+NY+    W+  G A+L+L YFR       R ++  IVFPII+    V L++   +G P ++ +G LIM+S +PVY I + WK KPK  + + +S+ I  QK+F+V+
Sbjct:   39 KQEQSEPLNQEPSNEHHDEEVGDKGLEKTMTLFNGVSIIVGCIIGSGIFISPTGIQAQAGSVGLSLIVWVLSGLFAGIGAFCYAELGTLIRKSGGDYAYIMEAFGPFLAFLRLWIESIVVRPCTATIVALTFAIYMLKPFYPDCDSPPLSTELIAALLLVLLTAVNCISVKWASKVQDFFFVTKTAALVLIIFTGLWNMVSGKPEAFDSFENIFENTAKDLETASLAFYSGLFAYQGWNYLNFIVEELQNPKRNLPLSIAISCSLCTIIYTLTNVALYTSITPDEMLASPAVAVLFAEKNYGWFAFCMPIFVACSTIGSANGVILTSSRLFYCGAREGQMPNVLTMVNKTTKTPIPAVILTGLLSLLYLLLSNNIYSLINYIQVSYWIAIGGAILALFYFRKTMPDAPRAVKAPIVFPIIFFIGCVLLVLVPVLGNPKDTAIGILIMLSGVPVYLIFIAWKGKPKCIDSLTDSVTIFTQKLFMVV 523          
BLAST of slc7a-9 vs. Ensembl Celegans
Match: aat-2 (Amino Acid Transporter [Source:UniProtKB/TrEMBL;Acc:Q19151])

HSP 1 Score: 325.865 bits (834), Expect = 4.260e-106
Identity = 190/470 (40.43%), Postives = 303/470 (64.47%), Query Frame = 3
Query:  111 VKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESP--FEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWW--IIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKK---VERPIRVNIVFPIIYLAVTVFLIIFAFI-GGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIG----VQKMF 1484
            +  I LK  I+L NG TII+G +IGSGIF+SP GV L+ GS+  S+LIWLL G++ MIGA CY+ELG LI +S GDYAY+YEAFGPL +F+ +W+ +++  P ++AII++T A Y L+P +Y C  P +   L A   I ++TF+NCW V+ +TR  D  T  K+ AL +II  G   L +G+  N   P   EG+ T    + MAFY+G+F+++G+SYLN + EE+K+P +++PRAI+IS  +VT++Y+L N++YF++L+  EI +S+A+A+    ++ G      ++PLFV+ S  G +NG ++T SR+F   A+  Q+P+  AMI+ +  TPIPS++F+   S+  L   ++F L+NY+ F   L    +V  L+  R    +     RPI++++++PI++  + +FL+I  F    P+E + G  +++S IP+Y + V  K +P      ++S+ IG    +QK+F
Sbjct:   10 LNQIKLKPRISLFNGCTIIIGVIIGSGIFVSPKGVLLEAGSAGMSLLIWLLSGVFAMIGAVCYSELGTLIPKSGGDYAYIYEAFGPLPSFLFLWVALVIINPTSLAIIAITCATYALQP-FYSCPVPDVVVNLFAGCIIAVLTFINCWDVRMATRTNDFFTITKLIALTLIITCGGYWLSLGHIDNLVMPDVAEGSQTKLSAIAMAFYSGVFSFSGFSYLNFVTEELKNPFRNLPRAIYISIPIVTIVYMLVNIAYFSVLTVDEILDSDAVAITFADKILGTFGSKILMPLFVSFSCVGSLNGILITCSRMFFSGARNSQLPELFAMISIRQLTPIPSLIFLGGTSIVMLFIGNVFQLINYLSFAESLVVFSSVAGLLKLRFTMPENVLNARPIKISLLWPILFFLMCLFLLILPFFHSDPWELIYGVFLVLSGIPIYVLFVYNKYRPG----FIQSVWIGFTHFIQKLF 474          
BLAST of slc7a-9 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0085785)

HSP 1 Score: 478.019 bits (1229), Expect = 4.356e-165
Identity = 238/504 (47.22%), Postives = 343/504 (68.06%), Query Frame = 3
Query:   48 INHKMAESSKRGDVKSSNGEV---------------VKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEK 1514
            +N K   SS++  + + NG+                   + LK  ++LLNG T+IVGS+IGSGIF+SPTGV + TGS   ++++W++ G+++M+GAYCYAELG +I +S  DYAY+ E FGP +AFIR+WI+ ++ RPC+ AI++LTF+ YVL+P +  C  P  + +LLA  CIL++T +NCW VK +T VQDI TYAK+ AL III TG+ +L +G T  +   FE T T    + ++FY+GLFAY GW+YLN ++EE+KDPVK++PRAI ISC LVT++YV+ANVS++TILS  E+  S+A+AV    + +G++ W IP+FVALSTFG VNG +LT+SR+F   A   QMP+ L MI  +  TP P+VL +A++S+ YL   DIF L+NYVGF TWL+ G+AVL L + R     + RPIRV +VFPI+YL  T+F+ +      P E+  G L+++S+IPVY + + WK KP  F + +  +   +QK+ +V+ P    K
Sbjct:    6 LNRK--NSSRKSSIVNGNGDASAKLTNGDGDGGGDGGGEVTLKAKMSLLNGCTVIVGSIIGSGIFVSPTGVLMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVMGSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMGGLTQVLQKLMMVVRPKAASK 505          
BLAST of slc7a-9 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0085786)

HSP 1 Score: 478.019 bits (1229), Expect = 4.356e-165
Identity = 238/504 (47.22%), Postives = 343/504 (68.06%), Query Frame = 3
Query:   48 INHKMAESSKRGDVKSSNGEV---------------VKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEK 1514
            +N K   SS++  + + NG+                   + LK  ++LLNG T+IVGS+IGSGIF+SPTGV + TGS   ++++W++ G+++M+GAYCYAELG +I +S  DYAY+ E FGP +AFIR+WI+ ++ RPC+ AI++LTF+ YVL+P +  C  P  + +LLA  CIL++T +NCW VK +T VQDI TYAK+ AL III TG+ +L +G T  +   FE T T    + ++FY+GLFAY GW+YLN ++EE+KDPVK++PRAI ISC LVT++YV+ANVS++TILS  E+  S+A+AV    + +G++ W IP+FVALSTFG VNG +LT+SR+F   A   QMP+ L MI  +  TP P+VL +A++S+ YL   DIF L+NYVGF TWL+ G+AVL L + R     + RPIRV +VFPI+YL  T+F+ +      P E+  G L+++S+IPVY + + WK KP  F + +  +   +QK+ +V+ P    K
Sbjct:    6 LNRK--NSSRKSSIVNGNGDASAKLTNGDGDGGGDGGGEVTLKAKMSLLNGCTVIVGSIIGSGIFVSPTGVLMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVMGSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMGGLTQVLQKLMMVVRPKAASK 505          
BLAST of slc7a-9 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0334550)

HSP 1 Score: 477.633 bits (1228), Expect = 5.983e-165
Identity = 238/497 (47.89%), Postives = 342/497 (68.81%), Query Frame = 3
Query:   48 INHKMAESSKRGDVKSSNGEV---------------VKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVI 1493
            +N K   SS++  + + NG+                   + LK  ++LLNG T+IVGS+IGSGIF+SPTGV + TGS   ++++W++ G+++M+GAYCYAELG +I +S  DYAY+ E FGP +AFIR+WI+ ++ RPC+ AI++LTF+ YVL+P +  C  P  + +LLA  CIL++T +NCW VK +T VQDI TYAK+ AL III TG+ +L +G T  +   FE T T    + ++FY+GLFAY GW+YLN ++EE+KDPVK++PRAI ISC LVT++YV+ANVS++TILS  E+  S+A+AV    + +G++ W IP+FVALSTFG VNG +LT+SR+F   A   QMP+ L MI  +  TP P+VL +A++S+ YL   DIF L+NYVGF TWL+ G+AVL L + R     + RPIRV +VFPI+YL  T+F+ +      P E+  G L+++S+IPVY + + WK KP  F + + S+   +QKM +V+
Sbjct:    6 LNRK--NSSRKSSIVNGNGDASAKLTNGDGDGGGDGGGEVTLKAKMSLLNGCTVIVGSIIGSGIFVSPTGVLMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVMGSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMVSLTRFLQKMLMVL 498          
BLAST of slc7a-9 vs. Ensembl Fly
Match: CG1607 (gene:FBgn0039844 transcript:FBtr0334549)

HSP 1 Score: 477.633 bits (1228), Expect = 5.983e-165
Identity = 238/497 (47.89%), Postives = 342/497 (68.81%), Query Frame = 3
Query:   48 INHKMAESSKRGDVKSSNGEV---------------VKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVI 1493
            +N K   SS++  + + NG+                   + LK  ++LLNG T+IVGS+IGSGIF+SPTGV + TGS   ++++W++ G+++M+GAYCYAELG +I +S  DYAY+ E FGP +AFIR+WI+ ++ RPC+ AI++LTF+ YVL+P +  C  P  + +LLA  CIL++T +NCW VK +T VQDI TYAK+ AL III TG+ +L +G T  +   FE T T    + ++FY+GLFAY GW+YLN ++EE+KDPVK++PRAI ISC LVT++YV+ANVS++TILS  E+  S+A+AV    + +G++ W IP+FVALSTFG VNG +LT+SR+F   A   QMP+ L MI  +  TP P+VL +A++S+ YL   DIF L+NYVGF TWL+ G+AVL L + R     + RPIRV +VFPI+YL  T+F+ +      P E+  G L+++S+IPVY + + WK KP  F + + S+   +QKM +V+
Sbjct:    6 LNRK--NSSRKSSIVNGNGDASAKLTNGDGDGGGDGGGEVTLKAKMSLLNGCTVIVGSIIGSGIFVSPTGVLMYTGSVNLALIVWVISGLFSMVGAYCYAELGTMITKSGADYAYIMETFGPFMAFIRLWIECMIVRPCSQAIVALTFSTYVLKPFFPECTPPEDSARLLAVCCILVLTLINCWDVKWATAVQDIFTYAKLLALFIIIATGVYQLYLGNTQYFT--FENTDTKVTSIALSFYSGLFAYNGWNYLNFIIEELKDPVKNLPRAIAISCTLVTIVYVMANVSFYTILSPDEVMGSSAVAVTYAERAFGMLAWTIPVFVALSTFGAVNGILLTSSRLFYAGANNGQMPEILTMIQIQRFTPTPAVLAMALLSMLYLTVSDIFALINYVGFATWLSIGVAVLCLPWLRWAQPNLPRPIRVPMVFPIVYLIATIFVTVVPMYASPVETGYGILMILSSIPVYLVFIAWKNKPIWFQKTMVSLTRFLQKMLMVL 498          
BLAST of slc7a-9 vs. Ensembl Fly
Match: JhI-21 (gene:FBgn0028425 transcript:FBtr0305089)

HSP 1 Score: 408.683 bits (1049), Expect = 5.424e-138
Identity = 203/460 (44.13%), Postives = 314/460 (68.26%), Query Frame = 3
Query:   81 GDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESI 1460
            G+   ++GE  + I LK+ +TL+NGV IIVG++IGSGIFI+PTGV++ T S  SS+LIWL CGI + IGA CYAELG  I RS GDYAY+  +FGPLV F+R+WI +++ RP    I++L+FA Y ++P +  C+ P  A +LLAA C+ ++T +NC SVK S +VQD+ T  K+ ALI+II++G+  +  G   N+ +P+EG  T A ++  AFY+GLFA+ GW+YLN + EE++DP K++PRAI+I+  LVT IYVL N++YF +++K E+  S A+AV  G +++G + +++P+FVALSTFGGVNG + T++R+F   AQ   +PK   + + K  TPIPS++F  ++SL  LL  +++ L+NY   V WL+   ++  +++ R K   + RPI+V++  PI ++   V L++   +  P   ++G  I ++ IP Y+  +  K+KPK + R+  S+
Sbjct:   24 GNPNPADGE--EKIVLKRKLTLINGVAIIVGTIIGSGIFIAPTGVFIYTESVGSSLLIWLTCGILSTIGALCYAELGTCITRSGGDYAYLLVSFGPLVGFLRLWIALLIIRPTTQTIVALSFAHYAVKPFFPECDPPQNAVKLLAAICLTLLTTINCLSVKVSMKVQDVFTVGKLLALIMIILSGLYYMATGELENFRNPWEGIYT-ARNIGYAFYSGLFAFGGWNYLNFVTEELQDPYKNLPRAIWIAMPLVTSIYVLVNLAYFAVVNKPEMLSSLAVAVTFGNRVFGPLAFMVPIFVALSTFGGVNGVLFTSARLFATGAQEGHLPKFFQLFHVKQQTPIPSLIFTCLMSLLMLLTDNVYQLINYFSSVLWLSVVASIAGMLWLRHKRPDLPRPIKVHLALPITFMVSCVTLVLLPNLEEPQNLLIGIGITLAGIPFYYAFIARKKKPKCYGRLSNSV 480          
BLAST of slc7a-9 vs. Ensembl Zebrafish
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 416.772 bits (1070), Expect = 1.229e-140
Identity = 213/481 (44.28%), Postives = 329/481 (68.40%), Query Frame = 3
Query:   57 KMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINW--ESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVI 1493
             +   S   D+  ++GE  +T+ LK+TITL+NGV IIVG++IGSGIF++PTGV  + GS   S+++W +CG+++ IGA CYAELG  I +S GDYAY+ E +G L AF+++WI++++ RP +  I++  FA Y+L+PI+ +C  P    +L+A  CIL++T VNC+SVKA+TRVQD    AK+ AL +II+ G V++G G T+    E+ F+G+ T+ G++ +A Y+GLFAY GW+YLN + EEM +P K++PRAI IS  +VT++YVL N++YFT LS  ++  S A+AV  G    G M WIIP+FV LS FG VNG++ T+SR+F V ++   +P  L+MI+    TP+PS++F  I++L Y    DIF+++N+  F  WL   +A++ +++ R K  ++ERPI+VNI+ PI+++   +FLI+ +F   P E  +G  I+ + +PVY+  V W+ KPK   +++ S  +  QKM  V+
Sbjct:   41 DITPGSPSTDISPADGE--ETVVLKRTITLVNGVAIIVGTIIGSGIFVTPTGVVKEAGSVGLSLVVWTVCGVFSTIGALCYAELGTTITKSGGDYAYILEVYGSLPAFLKLWIELLIIRPSSQYIVAYVFATYILKPIFPVCPVPETGAKLVACLCILLLTAVNCYSVKAATRVQDAFAAAKLLALGLIIIIGFVEIGKGDTVELLPENSFKGSNTDFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTVVYVLTNLAYFTTLSPEKMLSSEAVAVDFGNYHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSLLSMIHPDLLTPLPSLIFTCIMTLLYAFSNDIFSVINFFSFFNWLCIAMAIVGMMWLRYKKPELERPIKVNILLPIVFVLACLFLIVVSFWKTPVECAIGFGIIATGVPVYFFGVWWQTKPKWLLQIIFSSTVMCQKMMEVV 519          
BLAST of slc7a-9 vs. Ensembl Zebrafish
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 412.149 bits (1058), Expect = 2.641e-139
Identity = 213/481 (44.28%), Postives = 327/481 (67.98%), Query Frame = 3
Query:   57 KMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINW--ESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVI 1493
            +  E  K+   K   G   +T+ LK+TITL+NGV IIVG++IGSGIF++PTGV  + GS   S+++W +CG+++ IGA CYAELG  I +S GDYAY+ E +G L AF+++WI++++ RP +  I++  FA Y+L+PI+ +C  P    +L+A  CIL++T VNC+SVKA+TRVQD    AK+ AL +II+ G V++G G T+    E+ F+G+ T+ G++ +A Y+GLFAY GW+YLN + EEM +P K++PRAI IS  +VT++YVL N++YFT LS  ++  S A+AV  G    G M WIIP+FV LS FG VNG++ T+SR+F V ++   +P  L+MI+    TP+PS++F  I++L Y    DIF+++N+  F  WL   +A++ +++ R K  ++ERPI+VNI+ PI+++   +FLI+ +F   P E  +G  I+ + +PVY+  V W+ KPK   +++ S  +  QKM  V+
Sbjct:   14 ERDEDDKQVTEKMLTGRE-ETVVLKRTITLVNGVAIIVGTIIGSGIFVTPTGVVKEAGSVGLSLVVWTVCGVFSTIGALCYAELGTTITKSGGDYAYILEVYGSLPAFLKLWIELLIIRPSSQYIVAYVFATYILKPIFPVCPVPETGAKLVACLCILLLTAVNCYSVKAATRVQDAFAAAKLLALGLIIIIGFVEIGKGDTVELLPENSFKGSNTDFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTVVYVLTNLAYFTTLSPEKMLSSEAVAVDFGNYHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSLLSMIHPDLLTPLPSLIFTCIMTLLYAFSNDIFSVINFFSFFNWLCIAMAIVGMMWLRYKKPELERPIKVNILLPIVFVLACLFLIVVSFWKTPVECAIGFGIIATGVPVYFFGVWWQTKPKWLLQIIFSSTVMCQKMMEVV 493          
BLAST of slc7a-9 vs. Ensembl Zebrafish
Match: slc7a7 (solute carrier family 7 member 7 [Source:ZFIN;Acc:ZDB-GENE-051127-5])

HSP 1 Score: 410.223 bits (1053), Expect = 2.233e-138
Identity = 205/489 (41.92%), Postives = 320/489 (65.44%), Query Frame = 3
Query:   54 HKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLW--KRKPKPFNRMLESINIGVQKMFLVILPAMPEK 1514
             + +     G++K+S+ +  +++ LKK I+LLNGV +IVG+MIGSGIF+SP GV + +GS   S+++W + GI+++ GA CYAELG  I +S   YAY+ EAFG  +AFIR+W  +++  P + A+I++TF+ Y+++PI+  C  P +A +LLAAACI ++TFVNC  VK  TRVQD  TY KV ALI +I+TG+VK+  GYT N+E  F  ++ + GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VT+IY+L N++Y+TIL    I +S+A+AV    Q++G + W IP+ VA S FGG+N +I+  SR+F V ++   +P  L MI+    TPIP++LF   ++L YL   D+F L+NY  F  W   GL++L  +Y R K     RP+++++ FPII+   TVFL++         S++G  I +S +PVY++C      R+P    + + S  + +QK+   +L  M ++
Sbjct:   10 EEASPEVSNGNLKASSSQ--ESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSGSYGLSLVVWTIGGIFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYVANRLLAAACICLLTFVNCAYVKYGTRVQDFFTYVKVVALIAVIITGLVKIFQGYTQNFEGLFSDSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAISMPIVTVIYILTNLAYYTILPIPAILDSDAVAVTFADQVFGYLNWTIPVAVAFSCFGGLNASIVAASRLFFVGSREGHLPDYLCMIHITRFTPIPALLFNGAMALVYLCVEDVFKLINYYSFSYWFFVGLSILGQLYLRWKQPDRPRPLKLSLFFPIIFCLCTVFLVVVPLYSDTINSLIGIGIALSGVPVYFLCCHLPATRRPMWLRKFIASSGVLIQKVCFCVLTEMDKE 496          
BLAST of slc7a-9 vs. Ensembl Zebrafish
Match: slc7a7 (solute carrier family 7 member 7 [Source:ZFIN;Acc:ZDB-GENE-051127-5])

HSP 1 Score: 410.223 bits (1053), Expect = 2.233e-138
Identity = 205/489 (41.92%), Postives = 320/489 (65.44%), Query Frame = 3
Query:   54 HKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLW--KRKPKPFNRMLESINIGVQKMFLVILPAMPEK 1514
             + +     G++K+S+ +  +++ LKK I+LLNGV +IVG+MIGSGIF+SP GV + +GS   S+++W + GI+++ GA CYAELG  I +S   YAY+ EAFG  +AFIR+W  +++  P + A+I++TF+ Y+++PI+  C  P +A +LLAAACI ++TFVNC  VK  TRVQD  TY KV ALI +I+TG+VK+  GYT N+E  F  ++ + GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VT+IY+L N++Y+TIL    I +S+A+AV    Q++G + W IP+ VA S FGG+N +I+  SR+F V ++   +P  L MI+    TPIP++LF   ++L YL   D+F L+NY  F  W   GL++L  +Y R K     RP+++++ FPII+   TVFL++         S++G  I +S +PVY++C      R+P    + + S  + +QK+   +L  M ++
Sbjct:   10 EEASPEVSNGNLKASSSQ--ESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSGSYGLSLVVWTIGGIFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYVANRLLAAACICLLTFVNCAYVKYGTRVQDFFTYVKVVALIAVIITGLVKIFQGYTQNFEGLFSDSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAISMPIVTVIYILTNLAYYTILPIPAILDSDAVAVTFADQVFGYLNWTIPVAVAFSCFGGLNASIVAASRLFFVGSREGHLPDYLCMIHITRFTPIPALLFNGAMALVYLCVEDVFKLINYYSFSYWFFVGLSILGQLYLRWKQPDRPRPLKLSLFFPIIFCLCTVFLVVVPLYSDTINSLIGIGIALSGVPVYFLCCHLPATRRPMWLRKFIASSGVLIQKVCFCVLTEMDKE 496          
BLAST of slc7a-9 vs. Ensembl Zebrafish
Match: slc7a6 (solute carrier family 7 member 6 [Source:NCBI gene;Acc:57957])

HSP 1 Score: 401.364 bits (1030), Expect = 4.184e-135
Identity = 203/485 (41.86%), Postives = 312/485 (64.33%), Query Frame = 3
Query:   84 DVKSSNGEVV---------KTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKP--FNRMLESINIGVQKMFLVILPAM 1505
            D K  NG+           +++ LKK I+LLNGV++IVG+MIGSGIF+SP GV + + S   S++IW + GI++++GA CYAELG  I +S   YAY+ E+FG  +AFIR+W  +++  P + A+I++TFA Y+++P++  C  P  A +L+AAACI ++TF+N   VK  TRVQD+ TYAKV ALI+II+TGIVKL  G+TIN+E  F+G++ + G + +A Y+ LF+Y+GW  LN + EE+K+P +++P +I IS  +VT+IY+L NV+Y+ +L  S I  S+A+AV       GVM W IP+ VALS +GG+N +I+  SR+F V A+   +P  L+MI+ +  TP+P++LF   ++L YL   D+F L+NY  F  W   GL++   IY R K     RP+++++V+PII+    VFL+          S++G  I +S +PVY++ +      +P    ++L +I    Q     +L  M
Sbjct:    6 DSKKMNGQPESPAALSKPRESMQLKKEISLLNGVSLIVGNMIGSGIFVSPKGVLIYSASYGLSLVIWAIGGIFSVVGALCYAELGTTITKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYSASRLIAAACICLLTFINSAYVKWGTRVQDVFTYAKVLALIVIIITGIVKLCQGFTINFEDSFQGSSRDPGGIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTIIYILTNVAYYAVLDMSAILASDAVAVTFADHTLGVMSWTIPIAVALSCYGGLNSSIIAASRLFFVGAREGHLPDALSMIHIERFTPVPALLFNCAMALIYLTVEDVFQLINYYSFSYWFFVGLSIAGQIYLRWKEPDRPRPLKLSLVYPIIFCLCVVFLVAVPLYSDTLNSLIGIAIALSGVPVYFLGIHLPESKRPPIITKLLSAITRFTQFTCFCVLTEM 490          
BLAST of slc7a-9 vs. Ensembl Xenopus
Match: dpm3 (dolichyl-phosphate mannosyltransferase polypeptide 3 [Source:Xenbase;Acc:XB-GENE-975729])

HSP 1 Score: 432.95 bits (1112), Expect = 3.919e-147
Identity = 223/491 (45.42%), Postives = 333/491 (67.82%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINW--ESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEKA 1517
            + KM   +   +   S G  V   +L++TITL+NGV IIVG++IGSGIF++PTGV  + GS   S+L+W +CG+++++GA CYAELG  I +S GDYAYV E +GPL AF+++W+++++ RP +  I++L FA Y+L+P++  C  P  A +L+A  CIL++T +NC+SVKA+TRVQD    AK+ AL +II+ G V+LG G   N   E+ FEGT+TN G   +A Y+GLFAY GW+YLN +VEEM +P K++PRAI IS  +VTL+YVL N++YFT LS  ++  S A+AV  G    GVM WIIP+FV LS FG VNG++ T+SR+F V A+   +P  LAMI+ +  TP+PS++F   ++L Y    DIF+++N+  F  WL   LA++ L++ R K  ++ERPI+VNI+ PI ++    FLI+ +F   P E  +G +I++S +PVY+  V W+ KP+     + S    +QK    ++ A+P+++
Sbjct:   24 SEKMLHQNGSAEPTDSAGGAV---ELQRTITLVNGVAIIVGTIIGSGIFVTPTGVLREAGSPGLSLLVWAVCGLFSIVGALCYAELGTTISKSGGDYAYVLEVYGPLPAFLKLWVELLIIRPSSQYIVALVFATYLLKPVFPTCPVPDDAAKLVACLCILLLTAINCYSVKAATRVQDAFAAAKLLALCLIIILGFVQLGKGGVENLKPENAFEGTSTNVGQWVLALYSGLFAYGGWNYLNFVVEEMIEPYKNLPRAIIISMPIVTLVYVLTNLAYFTTLSTEQMLNSEAVAVDFGNYHLGVMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGAREGHLPSLLAMIHPRLLTPMPSLIFTCAMTLLYAFSDDIFSVINFFSFFNWLCVALAIIGLMWLRYKKPELERPIKVNILLPIFFILACFFLIVVSFYMTPVECGIGFIIILSGVPVYFFGVWWQNKPEWLLHGIYSSTALLQK----VMEAVPQES 507          
BLAST of slc7a-9 vs. Ensembl Xenopus
Match: dpm3 (dolichyl-phosphate mannosyltransferase polypeptide 3 [Source:Xenbase;Acc:XB-GENE-975729])

HSP 1 Score: 432.95 bits (1112), Expect = 4.093e-147
Identity = 223/491 (45.42%), Postives = 333/491 (67.82%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINW--ESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEKA 1517
            + KM   +   +   S G  V   +L++TITL+NGV IIVG++IGSGIF++PTGV  + GS   S+L+W +CG+++++GA CYAELG  I +S GDYAYV E +GPL AF+++W+++++ RP +  I++L FA Y+L+P++  C  P  A +L+A  CIL++T +NC+SVKA+TRVQD    AK+ AL +II+ G V+LG G   N   E+ FEGT+TN G   +A Y+GLFAY GW+YLN +VEEM +P K++PRAI IS  +VTL+YVL N++YFT LS  ++  S A+AV  G    GVM WIIP+FV LS FG VNG++ T+SR+F V A+   +P  LAMI+ +  TP+PS++F   ++L Y    DIF+++N+  F  WL   LA++ L++ R K  ++ERPI+VNI+ PI ++    FLI+ +F   P E  +G +I++S +PVY+  V W+ KP+     + S    +QK    ++ A+P+++
Sbjct:   28 SEKMLHQNGSAEPTDSAGGAV---ELQRTITLVNGVAIIVGTIIGSGIFVTPTGVLREAGSPGLSLLVWAVCGLFSIVGALCYAELGTTISKSGGDYAYVLEVYGPLPAFLKLWVELLIIRPSSQYIVALVFATYLLKPVFPTCPVPDDAAKLVACLCILLLTAINCYSVKAATRVQDAFAAAKLLALCLIIILGFVQLGKGGVENLKPENAFEGTSTNVGQWVLALYSGLFAYGGWNYLNFVVEEMIEPYKNLPRAIIISMPIVTLVYVLTNLAYFTTLSTEQMLNSEAVAVDFGNYHLGVMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGAREGHLPSLLAMIHPRLLTPMPSLIFTCAMTLLYAFSDDIFSVINFFSFFNWLCVALAIIGLMWLRYKKPELERPIKVNILLPIFFILACFFLIVVSFYMTPVECGIGFIIILSGVPVYFFGVWWQNKPEWLLHGIYSSTALLQK----VMEAVPQES 511          
BLAST of slc7a-9 vs. Ensembl Xenopus
Match: slc7a7 (solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 [Source:NCBI gene;Acc:394818])

HSP 1 Score: 417.542 bits (1072), Expect = 2.202e-141
Identity = 213/477 (44.65%), Postives = 312/477 (65.41%), Query Frame = 3
Query:   66 ESSKRGDVKSSNGEV--VKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVL--WKRKPKPFNRMLESINIGVQKMF 1484
            E   R   K S  +    +++ LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S+++W + GI+++ GA CYAELG  I +S   YAY+ EAFG  VAFIR+W  +++  P + A+I++TF+ Y+L+PI+  C  P  A +L+AA CI ++TFVNC  VK  TRVQDI TYAKV ALI +I+ GIVK+  G++ N+E+ F G++ + GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VT+IY+L NV+Y+T+L   EI  S+A+AV    Q++G+  W IPL VALS FGG+N +IL  SR+F V ++   +P  L+MI+ +  TPIP++LF   ++L YL   DIF L+NY  F  WL  GL++   +Y R K     RP+++++VFPII+   TVFL+          S++G  I +S +PVY++ V    KRKP+   R    I+ G    F
Sbjct:   10 EEPNRNGTKDSTADSGSQESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVLWAVGGIFSIFGALCYAELGTTITKSGASYAYILEAFGGFVAFIRLWTSLLIIEPTSQAVIAITFSNYMLQPIFPSCGSPYAANRLIAAGCIALLTFVNCAYVKWGTRVQDIFTYAKVLALIAVIIAGIVKICQGHSENFENSFAGSSYDVGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTVIYILTNVAYYTVLDIREILASDAVAVTFADQIFGIFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDALSMIHVERFTPIPALLFNGAMALVYLCVEDIFQLINYYSFSYWLFVGLSIAGQLYLRWKQPDRPRPLKLSLVFPIIFCLCTVFLVAVPLYSDLINSLIGVGIALSGVPVYFLLVRVSEKRKPQCLQRAAGMISDGHHTCF 486          
BLAST of slc7a-9 vs. Ensembl Xenopus
Match: slc7a7 (solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 [Source:NCBI gene;Acc:394818])

HSP 1 Score: 417.542 bits (1072), Expect = 7.117e-141
Identity = 216/488 (44.26%), Postives = 320/488 (65.57%), Query Frame = 3
Query:   66 ESSKRGDVKSSNGEV--VKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVL--WKRKPKPFNRMLESINIGVQKMFLVILPAMPEKA 1517
            E   R   K S  +    +++ LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S+++W + GI+++ GA CYAELG  I +S   YAY+ EAFG  VAFIR+W  +++  P + A+I++TF+ Y+L+PI+  C  P  A +L+AA CI ++TFVNC  VK  TRVQDI TYAKV ALI +I+ GIVK+  G++ N+E+ F G++ + GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VT+IY+L NV+Y+T+L   EI  S+A+AV    Q++G+  W IPL VALS FGG+N +IL  SR+F V ++   +P  L+MI+ +  TPIP++LF   ++L YL   DIF L+NY  F  WL  GL++   +Y R K     RP+++++VFPII+   TVFL+          S++G  I +S +PVY++ V    KRKP+   R+ + +  G  ++ L + P  PEK 
Sbjct:   13 EEPNRNGTKDSTADSGSQESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVLWAVGGIFSIFGALCYAELGTTITKSGASYAYILEAFGGFVAFIRLWTSLLIIEPTSQAVIAITFSNYMLQPIFPSCGSPYAANRLIAAGCIALLTFVNCAYVKWGTRVQDIFTYAKVLALIAVIIAGIVKICQGHSENFENSFAGSSYDVGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTVIYILTNVAYYTVLDIREILASDAVAVTFADQIFGIFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDALSMIHVERFTPIPALLFNGAMALVYLCVEDIFQLINYYSFSYWLFVGLSIAGQLYLRWKQPDRPRPLKLSLVFPIIFCLCTVFLVAVPLYSDLINSLIGVGIALSGVPVYFLLVRVSEKRKPQCLQRVSDLVQPGA-RICLNLNP--PEKG 497          
BLAST of slc7a-9 vs. Ensembl Xenopus
Match: slc7a7 (solute carrier family 7 (amino acid transporter light chain, y+L system), member 7 [Source:NCBI gene;Acc:394818])

HSP 1 Score: 416.001 bits (1068), Expect = 1.634e-140
Identity = 213/487 (43.74%), Postives = 316/487 (64.89%), Query Frame = 3
Query:   66 ESSKRGDVKSSNGEV--VKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVL--WKRKPKPFNRMLESINIGVQKMFLVILPAMPEK 1514
            E   R   K S  +    +++ LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S+++W + GI+++ GA CYAELG  I +S   YAY+ EAFG  VAFIR+W  +++  P + A+I++TF+ Y+L+PI+  C  P  A +L+AA CI ++TFVNC  VK  TRVQDI TYAKV ALI +I+ GIVK+  G++ N+E+ F G++ + GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VT+IY+L NV+Y+T+L   EI  S+A+AV    Q++G+  W IPL VALS FGG+N +IL  SR+F V ++   +P  L+MI+ +  TPIP++LF   ++L YL   DIF L+NY  F  WL  GL++   +Y R K     RP+++++VFPII+   TVFL+          S++G  I +S +PVY++ V    KRKP+   R   ++    Q +   +L  M  +
Sbjct:   13 EEPNRNGTKDSTADSGSQESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVLWAVGGIFSIFGALCYAELGTTITKSGASYAYILEAFGGFVAFIRLWTSLLIIEPTSQAVIAITFSNYMLQPIFPSCGSPYAANRLIAAGCIALLTFVNCAYVKWGTRVQDIFTYAKVLALIAVIIAGIVKICQGHSENFENSFAGSSYDVGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTVIYILTNVAYYTVLDIREILASDAVAVTFADQIFGIFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDALSMIHVERFTPIPALLFNGAMALVYLCVEDIFQLINYYSFSYWLFVGLSIAGQLYLRWKQPDRPRPLKLSLVFPIIFCLCTVFLVAVPLYSDLINSLIGVGIALSGVPVYFLLVRVSEKRKPQCLQRAAGALTRYTQILCYSVLTEMDTE 499          
BLAST of slc7a-9 vs. Ensembl Mouse
Match: Slc7a8 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 8 [Source:MGI Symbol;Acc:MGI:1355323])

HSP 1 Score: 410.609 bits (1054), Expect = 3.896e-138
Identity = 222/486 (45.68%), Postives = 324/486 (66.67%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMG--YTINWESPFEG-TTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILP 1499
            NH  +++S   +  S  G V     LKK I L++   IIVG++IGSGIF+SP GV    GS   ++++W++ GI T +GA CYAELG  I +S GDY+YV + FG L  F+R+WI V+V  P N A+I+LTF+ YVL+P++  C  P    +LLAA C+L++T+VNC SV+ +TRVQDI T  K+ AL +II+ GIV++  G  + +  ++ FE     + G + +AF  G FAY GW++LN + EE+ DP K++PRAIFIS  LVT +YV AN++Y T +S  E+  SNA+AV  G ++ GVM WI+P+ VALSTFGGVNG++ T+SR+F   A+   +P  LAMI+ K  TPIP++LF  + +L  L+  D++TL+NYVGF+ +L +G+ V   I  R K   + RPI+V+++FPIIYL    FL+IF+    P    +G  IM++ +PVY++ V W+ KPK FN  ++S+ +  QKM +V+ P
Sbjct:   14 NHPGSDTSPEAEASSGGGGVA----LKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAGSVGLALIVWIVTGIITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEFFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKVSLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIKSLTLVSQKMCVVVYP 495          
BLAST of slc7a-9 vs. Ensembl Mouse
Match: Slc7a6 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 6 [Source:MGI Symbol;Acc:MGI:2142598])

HSP 1 Score: 409.453 bits (1051), Expect = 7.470e-138
Identity = 201/482 (41.70%), Postives = 321/482 (66.60%), Query Frame = 3
Query:   57 KMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLW--KRKPKPFNRMLESINIGVQKMFLVIL 1496
            K  + + + D  S +    +T+ LKK I+LLNGV+++VG+MIGSGIF+SP GV   T S   S+++W + G+++++GA CYAELG  I +S   YAY+ EAFG  +AFIR+W+ +++  P + AII++TFA Y+++P +  C+ P +A +LLAAAC+ ++TFVNC  VK  TRVQD  TYAKV ALI II+ G+VKL  G+T +++  F+G++ N GD+++A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VTLIY+L NV+Y+T+L+  ++ +S+A+AV    Q +G+  W IP+ VALS FGG+N +I  +SR+F V ++   +P  L+MI+ +  TP+P++LF   ++L YL+  D+F L+NY  F  W   GL+V+  +Y R K     RP+++++ FPI++   ++FL+          S++G  I +S +PVY++ V     R+P     +L ++    QK+   +L
Sbjct:   18 KANQHTVKEDAGSPSQGSPETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLKYTASYGLSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLIVEPTSQAIIAITFANYIIKPSFPTCDPPYVACRLLAAACVCLLTFVNCAYVKWGTRVQDTFTYAKVLALIAIIIMGLVKLCQGHTEHFQDAFKGSSWNVGDLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNIQDVHKSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPNLLSMIHIERFTPVPALLFNCTMTLIYLVVKDVFLLINYFSFSYWFFVGLSVVGQLYLRWKEPDWPRPLKLSLFFPIVFCVCSLFLVAVPLFSDTINSLIGIGIALSGVPVYFLGVYLPESRRPLFIRNVLATVTRVTQKLCFCVL 499          
BLAST of slc7a-9 vs. Ensembl Mouse
Match: Slc7a7 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 [Source:MGI Symbol;Acc:MGI:1337120])

HSP 1 Score: 408.297 bits (1048), Expect = 1.451e-137
Identity = 209/487 (42.92%), Postives = 316/487 (64.89%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYW--ICVLWKRKPKPFNRMLESINIGVQKMFLVILPAM 1505
             H+  + S  GD  S   E VK   LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S++IW + GI+++ GA CYAELG  IK+S   YAY+ EAFG  +AFIR+W  +++  P + A+I++TFA Y+++P++  C  P  A +LLAAACI ++TF+NC  VK  T VQDI TYAKV ALI +I+ GIV+LG G T N+E+ FEG++   GD+ +A Y+ LF+Y+GW  LN + EE+++P +++P +I IS  +VT+IY+L NV+Y+++L   EI  S+A+AV    Q++GV  WIIP+ VA S FGG+N +I+  SR+  V ++   +P  + M++ +  TP+PS+LF  ++SL YL   DIF L+NY  F  W   GL+++  +Y R K     RP+++++ FPII+   T+FL+          S++G  I +S +P Y+  I V   ++P    R++ SI   +Q + + +   M
Sbjct:   12 QHEADDGSALGDGASPVAEQVK---LKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASFGLSLVIWAVGGIFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFANYMVQPLFPSCGAPYAAGRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATANFENSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKEILASDAVAVTFADQIFGVFNWIIPVAVAFSCFGGLNASIVAASRLLFVGSREGHLPDAICMVHVERFTPVPSLLFNGVLSLVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKDPDRPRPLKLSLFFPIIFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFFIIRVPEHKRPLFLRRIVASITRYLQILCMSVAAEM 495          
BLAST of slc7a-9 vs. Ensembl Mouse
Match: Slc7a7 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 [Source:MGI Symbol;Acc:MGI:1337120])

HSP 1 Score: 408.297 bits (1048), Expect = 1.451e-137
Identity = 209/487 (42.92%), Postives = 316/487 (64.89%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYW--ICVLWKRKPKPFNRMLESINIGVQKMFLVILPAM 1505
             H+  + S  GD  S   E VK   LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S++IW + GI+++ GA CYAELG  IK+S   YAY+ EAFG  +AFIR+W  +++  P + A+I++TFA Y+++P++  C  P  A +LLAAACI ++TF+NC  VK  T VQDI TYAKV ALI +I+ GIV+LG G T N+E+ FEG++   GD+ +A Y+ LF+Y+GW  LN + EE+++P +++P +I IS  +VT+IY+L NV+Y+++L   EI  S+A+AV    Q++GV  WIIP+ VA S FGG+N +I+  SR+  V ++   +P  + M++ +  TP+PS+LF  ++SL YL   DIF L+NY  F  W   GL+++  +Y R K     RP+++++ FPII+   T+FL+          S++G  I +S +P Y+  I V   ++P    R++ SI   +Q + + +   M
Sbjct:   12 QHEADDGSALGDGASPVAEQVK---LKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASFGLSLVIWAVGGIFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFANYMVQPLFPSCGAPYAAGRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATANFENSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKEILASDAVAVTFADQIFGVFNWIIPVAVAFSCFGGLNASIVAASRLLFVGSREGHLPDAICMVHVERFTPVPSLLFNGVLSLVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKDPDRPRPLKLSLFFPIIFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFFIIRVPEHKRPLFLRRIVASITRYLQILCMSVAAEM 495          
BLAST of slc7a-9 vs. Ensembl Mouse
Match: Slc7a7 (solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 [Source:MGI Symbol;Acc:MGI:1337120])

HSP 1 Score: 408.297 bits (1048), Expect = 1.451e-137
Identity = 209/487 (42.92%), Postives = 316/487 (64.89%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYW--ICVLWKRKPKPFNRMLESINIGVQKMFLVILPAM 1505
             H+  + S  GD  S   E VK   LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S++IW + GI+++ GA CYAELG  IK+S   YAY+ EAFG  +AFIR+W  +++  P + A+I++TFA Y+++P++  C  P  A +LLAAACI ++TF+NC  VK  T VQDI TYAKV ALI +I+ GIV+LG G T N+E+ FEG++   GD+ +A Y+ LF+Y+GW  LN + EE+++P +++P +I IS  +VT+IY+L NV+Y+++L   EI  S+A+AV    Q++GV  WIIP+ VA S FGG+N +I+  SR+  V ++   +P  + M++ +  TP+PS+LF  ++SL YL   DIF L+NY  F  W   GL+++  +Y R K     RP+++++ FPII+   T+FL+          S++G  I +S +P Y+  I V   ++P    R++ SI   +Q + + +   M
Sbjct:   12 QHEADDGSALGDGASPVAEQVK---LKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASFGLSLVIWAVGGIFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFANYMVQPLFPSCGAPYAAGRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATANFENSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKEILASDAVAVTFADQIFGVFNWIIPVAVAFSCFGGLNASIVAASRLLFVGSREGHLPDAICMVHVERFTPVPSLLFNGVLSLVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKDPDRPRPLKLSLFFPIIFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFFIIRVPEHKRPLFLRRIVASITRYLQILCMSVAAEM 495          
BLAST of slc7a-9 vs. UniProt/SwissProt
Match: sp|Q92536|YLAT2_HUMAN (Y+L amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A6 PE=1 SV=3)

HSP 1 Score: 419.468 bits (1077), Expect = 4.932e-141
Identity = 207/480 (43.12%), Postives = 322/480 (67.08%), Query Frame = 3
Query:   63 AESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLW--KRKPKPFNRMLESINIGVQKMFLVIL 1496
            ++S    DV S      +T+ LKK I+LLNGV+++VG+MIGSGIF+SP GV + T S   S+++W + G+++++GA CYAELG  I +S   YAY+ EAFG  +AFIR+W+ ++V  P   AII++TFA Y+++P +  C+ P +A +LLAAACI ++TFVNC  VK  TRVQD  TYAKV ALI II+ G+VKL  G++ +++  FEG++ + G++++A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VTLIY+L NV+Y+T+L+ S++  S+A+AV    Q +G+  W IP+ VALS FGG+N +I  +SR+F V ++   +P  L+MI+ +  TPIP++LF   ++L YL+  D+F L+NY  F  W   GL+V+  +Y R K  K  RP+++++ FPI++   +VFL+I         S++G  I +S +P Y++ V     R+P     +L +I  G Q++   +L
Sbjct:   20 SQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFVNCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLSSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIHIERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPRPLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFIRNVLAAITRGTQQLCFCVL 499          
BLAST of slc7a-9 vs. UniProt/SwissProt
Match: sp|Q9QXW9|LAT2_MOUSE (Large neutral amino acids transporter small subunit 2 OS=Mus musculus OX=10090 GN=Slc7a8 PE=1 SV=1)

HSP 1 Score: 410.609 bits (1054), Expect = 2.725e-137
Identity = 222/486 (45.68%), Postives = 324/486 (66.67%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMG--YTINWESPFEG-TTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILP 1499
            NH  +++S   +  S  G V     LKK I L++   IIVG++IGSGIF+SP GV    GS   ++++W++ GI T +GA CYAELG  I +S GDY+YV + FG L  F+R+WI V+V  P N A+I+LTF+ YVL+P++  C  P    +LLAA C+L++T+VNC SV+ +TRVQDI T  K+ AL +II+ GIV++  G  + +  ++ FE     + G + +AF  G FAY GW++LN + EE+ DP K++PRAIFIS  LVT +YV AN++Y T +S  E+  SNA+AV  G ++ GVM WI+P+ VALSTFGGVNG++ T+SR+F   A+   +P  LAMI+ K  TPIP++LF  + +L  L+  D++TL+NYVGF+ +L +G+ V   I  R K   + RPI+V+++FPIIYL    FL+IF+    P    +G  IM++ +PVY++ V W+ KPK FN  ++S+ +  QKM +V+ P
Sbjct:   14 NHPGSDTSPEAEASSGGGGVA----LKKEIGLVSACGIIVGNIIGSGIFVSPKGVLENAGSVGLALIVWIVTGIITAVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEFFWLEPKNAFENFQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANIAYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVKRCTPIPALLFTCLSTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPIKVSLLFPIIYLLFWAFLLIFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFNDFIKSLTLVSQKMCVVVYP 495          
BLAST of slc7a-9 vs. UniProt/SwissProt
Match: sp|Q8BGK6|YLAT2_MOUSE (Y+L amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc7a6 PE=1 SV=1)

HSP 1 Score: 409.453 bits (1051), Expect = 5.225e-137
Identity = 201/482 (41.70%), Postives = 321/482 (66.60%), Query Frame = 3
Query:   57 KMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLW--KRKPKPFNRMLESINIGVQKMFLVIL 1496
            K  + + + D  S +    +T+ LKK I+LLNGV+++VG+MIGSGIF+SP GV   T S   S+++W + G+++++GA CYAELG  I +S   YAY+ EAFG  +AFIR+W+ +++  P + AII++TFA Y+++P +  C+ P +A +LLAAAC+ ++TFVNC  VK  TRVQD  TYAKV ALI II+ G+VKL  G+T +++  F+G++ N GD+++A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VTLIY+L NV+Y+T+L+  ++ +S+A+AV    Q +G+  W IP+ VALS FGG+N +I  +SR+F V ++   +P  L+MI+ +  TP+P++LF   ++L YL+  D+F L+NY  F  W   GL+V+  +Y R K     RP+++++ FPI++   ++FL+          S++G  I +S +PVY++ V     R+P     +L ++    QK+   +L
Sbjct:   18 KANQHTVKEDAGSPSQGSPETMQLKKEISLLNGVSLVVGNMIGSGIFVSPKGVLKYTASYGLSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFGGFIAFIRLWVSLLIVEPTSQAIIAITFANYIIKPSFPTCDPPYVACRLLAAACVCLLTFVNCAYVKWGTRVQDTFTYAKVLALIAIIIMGLVKLCQGHTEHFQDAFKGSSWNVGDLSLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNIQDVHKSDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPNLLSMIHIERFTPVPALLFNCTMTLIYLVVKDVFLLINYFSFSYWFFVGLSVVGQLYLRWKEPDWPRPLKLSLFFPIVFCVCSLFLVAVPLFSDTINSLIGIGIALSGVPVYFLGVYLPESRRPLFIRNVLATVTRVTQKLCFCVL 499          
BLAST of slc7a-9 vs. UniProt/SwissProt
Match: sp|Q9Z1K8|YLAT1_MOUSE (Y+L amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc7a7 PE=1 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 1.015e-136
Identity = 209/487 (42.92%), Postives = 316/487 (64.89%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYW--ICVLWKRKPKPFNRMLESINIGVQKMFLVILPAM 1505
             H+  + S  GD  S   E VK   LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S++IW + GI+++ GA CYAELG  IK+S   YAY+ EAFG  +AFIR+W  +++  P + A+I++TFA Y+++P++  C  P  A +LLAAACI ++TF+NC  VK  T VQDI TYAKV ALI +I+ GIV+LG G T N+E+ FEG++   GD+ +A Y+ LF+Y+GW  LN + EE+++P +++P +I IS  +VT+IY+L NV+Y+++L   EI  S+A+AV    Q++GV  WIIP+ VA S FGG+N +I+  SR+  V ++   +P  + M++ +  TP+PS+LF  ++SL YL   DIF L+NY  F  W   GL+++  +Y R K     RP+++++ FPII+   T+FL+          S++G  I +S +P Y+  I V   ++P    R++ SI   +Q + + +   M
Sbjct:   12 QHEADDGSALGDGASPVAEQVK---LKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASFGLSLVIWAVGGIFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFANYMVQPLFPSCGAPYAAGRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATANFENSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKEILASDAVAVTFADQIFGVFNWIIPVAVAFSCFGGLNASIVAASRLLFVGSREGHLPDAICMVHVERFTPVPSLLFNGVLSLVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKDPDRPRPLKLSLFFPIIFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFFIIRVPEHKRPLFLRRIVASITRYLQILCMSVAAEM 495          
BLAST of slc7a-9 vs. UniProt/SwissProt
Match: sp|Q9UM01|YLAT1_HUMAN (Y+L amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC7A7 PE=1 SV=2)

HSP 1 Score: 407.142 bits (1045), Expect = 2.902e-136
Identity = 203/462 (43.94%), Postives = 306/462 (66.23%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKP 1436
            +    E+S  GD  S   E VK   LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S++IW + G++++ GA CYAELG  IK+S   YAY+ EAFG  +AFIR+W  +++  P + AII++TFA Y+++P++  C  P  A +LLAAACI ++TF+NC  VK  T VQDI TYAKV ALI +I+ GIV+LG G + ++E+ FEG++   GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P +I IS  +VT+IY+L NV+Y+T+L   +I  S+A+AV    Q++G+  WIIPL VALS FGG+N +I+  SR+F V ++   +P  + MI+ +  TP+PS+LF  I++L YL   DIF L+NY  F  W   GL+++  +Y R K     RP+++++ FPI++   T+FL+          S++G  I +S +P Y++ +      +P
Sbjct:   11 SQPEVETSPLGDGASPGPEQVK---LKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRP 469          
BLAST of slc7a-9 vs. TrEMBL
Match: A0A0H3YK32 (Slc7a-9 OS=Schmidtea mediterranea OX=79327 GN=slc7a-9 PE=2 SV=1)

HSP 1 Score: 981.089 bits (2535), Expect = 0.000e+0
Identity = 487/487 (100.00%), Postives = 487/487 (100.00%), Query Frame = 3
Query:   60 MAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEKAM 1520
            MAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEKAM
Sbjct:    1 MAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEKAM 487          
BLAST of slc7a-9 vs. TrEMBL
Match: A0A0H3YJ06 (Slc7a-10 OS=Schmidtea mediterranea OX=79327 GN=slc7a-10 PE=2 SV=1)

HSP 1 Score: 877.856 bits (2267), Expect = 0.000e+0
Identity = 432/476 (90.76%), Postives = 460/476 (96.64%), Query Frame = 3
Query:   93 SSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEKAM 1520
            S N +  + ++LKKTI LLNGVT+IVGSMIGSGIFISP+GV+LKTGS  S+++IW LCGIY++IGAYCYAELGC+IKRS+GDYAYVYEAFGP++ FIR+W+DV+VTRPC++AI+SLTFAQY LEP YY+C+QP +A+QLLAA CILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVR+GYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPK FNRMLESINI VQKMF+VILPAMPEKAM
Sbjct:   16 SGNQKKSEKLELKKTIGLLNGVTLIVGSMIGSGIFISPSGVFLKTGSIGSALIIWFLCGIYSLIGAYCYAELGCMIKRSSGDYAYVYEAFGPIMGFIRLWVDVLVTRPCSIAIVSLTFAQYFLEPFYYLCDQPLLAKQLLAAGCILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRIGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKRFNRMLESINISVQKMFMVILPAMPEKAM 491          
BLAST of slc7a-9 vs. TrEMBL
Match: A0A0H3YIW3 (Slc7a-7 OS=Schmidtea mediterranea OX=79327 GN=slc7a-7 PE=2 SV=1)

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 309/489 (63.19%), Postives = 407/489 (83.23%), Query Frame = 3
Query:   60 MAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRI--KWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEKAM 1520
            M ++S   + K SN        LKK ITL+NG+ I++GSMIGSGIFISPTGVYLK GSS ++++IW+LCG+++MIGAYCY ELGC+IKRS+GDYAY+Y+AFGP +AF+R+WIDVIVTRPC +AI+SLTFA+Y+LEP++  C QP +AR+ LAA+CIL++TF+NCWSVKASTRVQDI T+AK+ AL+I+I+TG+VKL MG+T NWESPF  T T+ G +TM FY GLFAY GW+YLNCM+EEMK+PVKD+P+A+ ISC +VT++Y+LANVSYFTILS  EI  +NA+AVR+G   + VMWW+IP+FV++STFGGVNG I+TTSR+FLVAAQ DQMP  LAMI+T  STPIPSV+FV++VS+ YL++PD++ LMNYVGFVTWLTF  A+L+L+YFR   K++K+ERP  V+++FPI+YL V+ F+I+FAF+GG +ESMMGT+IM++A+PVY I V WK KPK FNR L      VQK+F+V+    P++++
Sbjct:    1 MKKNSLNENDKKSNDSNEDKCQLKKEITLINGIGIVIGSMIGSGIFISPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVV-ATEPDESL 487          
BLAST of slc7a-9 vs. TrEMBL
Match: A0A0H3YEY5 (Slc7a-6 OS=Schmidtea mediterranea OX=79327 GN=slc7a-6 PE=2 SV=1)

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 281/477 (58.91%), Postives = 367/477 (76.94%), Query Frame = 3
Query:   69 SSKRGD--VKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVI 1493
            S+ + D  VK S+ +    ++LKK I LLNG+ IIVGS+IGSGIF+SPT V++K+GS  S+++IW LCGI+++IGAYCY ELG +I RS GDYAYV +AFGP +AF+R+W+DVIV RP + AII+L FA+Y LE +Y  C  P +A++LLAA CI I+TF+NC+SV+ ST VQDI +YAKV AL+IIIMTGIVKL  G T NWE+ F  ++TN GD  MAFY GLFAY GW+YLNC++EEMK+P +D+P +I IS  L+  IYVL N++YFTIL  SEI  + A+AV V  ++YGVMWWI+P+FVA+STFGGVNG +L TSRIF VAAQ +QMP  L  IN K+ TP+PSVLFV++VSL YL F DI  L+NY+GFV WL  G+AV ++I+FR K     RPIRV++ FPIIY   TV L+I +F+GGP+ES+MG +I+++A PVYWI VLWK KPK F   L++I + +QK+F V+
Sbjct:    2 STDKTDEVVKESSND---KVELKKEINLLNGIGIIVGSIIGSGIFVSPTEVFIKSGSPGSALIIWFLCGIFSLIGAYCYMELGTMITRSGGDYAYVLDAFGPFIAFLRLWVDVIVARPVSQAIIALVFAEYTLEALYIGCVSPIMAKRLLAAGCIGILTFINCYSVRWSTLVQDILSYAKVFALLIIIMTGIVKLAQGDTGNWENAFADSSTNPGDYAMAFYAGLFAYNGWNYLNCLIEEMKNPRRDLPLSILISMILIIFIYVLTNMAYFTILLPSEILNTKAVAVTVAIRLYGVMWWIMPIFVAMSTFGGVNGNLLATSRIFFVAAQENQMPMILETINVKYYTPVPSVLFVSLVSLVYLCFSDINILINYMGFVNWLAIGVAVFTVIWFRYKDPSKPRPIRVHLAFPIIYCVATVILLILSFVGGPYESLMGIVIILTAAPVYWIFVLWK-KPKSFQDKLDNITVVLQKLFYVV 474          
BLAST of slc7a-9 vs. TrEMBL
Match: A0A1S3IH31 (large neutral amino acids transporter small subunit 2 OS=Lingula unguis OX=7574 GN=LOC106163974 PE=4 SV=1)

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 255/488 (52.25%), Postives = 357/488 (73.16%), Query Frame = 3
Query:   66 ESSKRGDVKS-----SNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEK 1514
            ++    DV S     S+GE    I+LK  I+L+N  TIIVGS+IGSGIF+SP GV  + GS   S++IW LCGI+++IGAYCYAELG +IK+S  DYAY++EAFGP +AF+R+W++ ++ RPC+ AI+SLTFA Y++EP++  C QP  A +LLAA CIL +TF+NC+ VK +TRVQD+ TYAKV ALI+II+TG V++G GY  N+ +PFE TT + G  ++AFY+GLFAY GW+Y NC+ EE+K+P K++PRAI+ISC LV  +YVLANV+YFT ++  E+ ES+A+AV    ++YGVMWWI+P+FVALSTFGGVNG + TT+R+F V ++   MP  L+ +     TP P+VLFVA+ +L YL+  D++ L+NYVGFVTWL  GL+V++L+YFR  W    RPI+V++V+PIIY A +VFL++      P E+  G LI+ + IPVY I + WK KPK     +++  + +QK+ LV+    PE+
Sbjct:   13 QAEPSADVASTSEAASSGESNNKIELKPKISLVNACTIIVGSIIGSGIFVSPKGVLAEAGSVGLSLIIWALCGIFSLIGAYCYAELGTMIKKSGADYAYIFEAFGPFLAFLRLWVECLIIRPCSAAIVSLTFANYIIEPLFPDCEQPASAVRLLAAFCILTLTFINCFDVKWATRVQDVFTYAKVLALILIIITGFVQIGRGYYENFLAPFENTTNDVGAASLAFYSGLFAYNGWNYANCVTEELKNPEKNLPRAIWISCILVMFVYVLANVAYFTTVTPKELLESSAVAVTFSQRLYGVMWWIMPVFVALSTFGGVNGIMFTTARLFYVGSREGHMPMILSTVQINRLTPAPAVLFVALTTLCYLVSTDMYALINYVGFVTWLAIGLSVVALLYFRYSWPDANRPIKVSLVWPIIYTAASVFLVVVPLYASPVETGFGCLIIATGIPVYLIFIGWKTKPKAIQSKIDACTLTLQKLLLVV----PEE 496          
BLAST of slc7a-9 vs. Ensembl Cavefish
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:103035629])

HSP 1 Score: 413.69 bits (1062), Expect = 8.425e-140
Identity = 209/478 (43.72%), Postives = 316/478 (66.11%), Query Frame = 3
Query:   78 RGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVL--WKRKPKPFNRMLESINIGVQKMFLVILPAM 1505
             G +KSS+    +++ LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S+++W + G++++ GA CYAELG  I +S   YAY+ EAFG  +AFIR+W  +++  P + A+I++TF+ Y+++PI+  C  P  A +LLAAACI ++TFVNC  VK  TRVQD  TYAKV ALI +I+TG+VK+  G+T N+E  F+ ++ + GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P +I IS  +VT+IY+L NV+Y+TIL    I +S+A+AV    +++GV  W IPL VALS FGG+N +IL  SR+F V ++   +P  L MI+    TPIP++LF   ++L YL   DIF L+NY  F  W   GL++L  +Y R K     RP++++I+FPI++   T+FL++         S++G  I +S IPVY++C      R+P    R + S  + +QK+   +L  M
Sbjct:   18 NGHLKSSSSN--ESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASYGLSLVVWTIGGVFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYAANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIFQGHTQNFEGLFDNSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTVIYILTNVAYYTILPIPAILDSDAVAVTFADKVFGVFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDYLCMIHVSRYTPIPALLFNGAMALVYLCVEDIFKLINYYSFSYWFFVGLSILGQLYLRWKQPDRPRPLKLSIIFPIVFCLCTIFLVVVPLYSDTINSLIGIGIALSGIPVYFLCCYTPASRRPMWLRRFIASSGVLIQKVCFSVLTEM 493          
BLAST of slc7a-9 vs. Ensembl Cavefish
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:103035629])

HSP 1 Score: 413.69 bits (1062), Expect = 8.425e-140
Identity = 209/478 (43.72%), Postives = 316/478 (66.11%), Query Frame = 3
Query:   78 RGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVL--WKRKPKPFNRMLESINIGVQKMFLVILPAM 1505
             G +KSS+    +++ LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S+++W + G++++ GA CYAELG  I +S   YAY+ EAFG  +AFIR+W  +++  P + A+I++TF+ Y+++PI+  C  P  A +LLAAACI ++TFVNC  VK  TRVQD  TYAKV ALI +I+TG+VK+  G+T N+E  F+ ++ + GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P +I IS  +VT+IY+L NV+Y+TIL    I +S+A+AV    +++GV  W IPL VALS FGG+N +IL  SR+F V ++   +P  L MI+    TPIP++LF   ++L YL   DIF L+NY  F  W   GL++L  +Y R K     RP++++I+FPI++   T+FL++         S++G  I +S IPVY++C      R+P    R + S  + +QK+   +L  M
Sbjct:   18 NGHLKSSSSN--ESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASYGLSLVVWTIGGVFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYAANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIFQGHTQNFEGLFDNSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTVIYILTNVAYYTILPIPAILDSDAVAVTFADKVFGVFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDYLCMIHVSRYTPIPALLFNGAMALVYLCVEDIFKLINYYSFSYWFFVGLSILGQLYLRWKQPDRPRPLKLSIIFPIVFCLCTIFLVVVPLYSDTINSLIGIGIALSGIPVYFLCCYTPASRRPMWLRRFIASSGVLIQKVCFSVLTEM 493          
BLAST of slc7a-9 vs. Ensembl Cavefish
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:103035629])

HSP 1 Score: 412.535 bits (1059), Expect = 2.539e-139
Identity = 209/478 (43.72%), Postives = 316/478 (66.11%), Query Frame = 3
Query:   78 RGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVL--WKRKPKPFNRMLESINIGVQKMFLVILPAM 1505
             G +KSS+    +++ LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S+++W + G++++ GA CYAELG  I +S   YAY+ EAFG  +AFIR+W  +++  P + A+I++TF+ Y+++PI+  C  P  A +LLAAACI ++TFVNC  VK  TRVQD  TYAKV ALI +I+TG+VK+  G+T N+E  F+ ++ + GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P +I IS  +VT+IY+L NV+Y+TIL    I +S+A+AV    +++GV  W IPL VALS FGG+N +IL  SR+F V ++   +P  L MI+    TPIP++LF   ++L YL   DIF L+NY  F  W   GL++L  +Y R K     RP++++I+FPI++   T+FL++         S++G  I +S IPVY++C      R+P    R + S  + +QK+   +L  M
Sbjct:   18 NGHLKSSSSN--ESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASYGLSLVVWTIGGVFSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYAANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVIALIAVIITGLVKIFQGHTQNFEGLFDNSSHDPGDVALALYSALFSYSGWDTLNFVTEEIKNPERNLPLSIAISMPIVTVIYILTNVAYYTILPIPAILDSDAVAVTFADKVFGVFNWTIPLAVALSCFGGLNASILAASRLFFVGSREGHLPDYLCMIHVSRYTPIPALLFNGAMALVYLCVEDIFKLINYYSFSYWFFVGLSILGQLYLRWKQPDRPRPLKLSIIFPIVFCLCTIFLVVVPLYSDTINSLIGIGIALSGIPVYFLCCYTPASRRPMWLRRFIASSGVLIQKVCFSVLTEM 493          
BLAST of slc7a-9 vs. Ensembl Cavefish
Match: slc7a8b (large neutral amino acids transporter small subunit 2 [Source:NCBI gene;Acc:103044995])

HSP 1 Score: 396.356 bits (1017), Expect = 6.639e-133
Identity = 219/488 (44.88%), Postives = 317/488 (64.96%), Query Frame = 3
Query:   75 KRGDVKSSNGEVVKT-----IDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMG--YTINWESPFEG-TTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEK 1514
            +RG   SS     K      + LKK I LL+   IIVG++IGSGIF+SP GV     S   +++IW+  G+ T IGA CYAELG  I +S GDY+YV + FG L  F+R+WI ++V  P N A+ISLTF+ YVL+P++  C       +LLAA C+L++T+VNC+SV+ +TRVQDI T  K+ AL +II+ GIV++  G  Y +     FE     + G + +AF  G FAY GW++LN + EE+ DP +++PRAIFIS  LVT +YV ANV+Y T +S +E+  SNA+AV  G ++ GVM WI+P+ VALSTFGG+NG++ T+SR+F   A+   +P+ LAMI+    TPIP++LF  I +L  L   D++TL+NYVGF+ +L +G+ V   I  RI+   + RPI+V++V+P+IYL    FL++F+    P    +G  IM++ +PVY++ V W+ KPK F   +  +    QK+ LV+ PA  E+
Sbjct:    7 QRGSSGSSTATNSKQPESSGVALKKEIGLLSACGIIVGNIIGSGIFVSPKGVLENASSVGLALIIWISTGVITAIGALCYAELGVTIPKSGGDYSYVKDIFGGLAGFLRLWIALLVIYPTNQAVISLTFSNYVLQPLFPTCFATESGLRLLAAVCLLLLTWVNCFSVRWATRVQDIFTAGKLLALGLIIIMGIVQMCKGNYYWLEPAHAFEPFQDYDVGRIALAFLQGSFAYGGWNFLNYVTEELIDPYRNLPRAIFISIPLVTFVYVFANVAYITAMSPTELLASNAVAVTFGEKLLGVMSWIMPISVALSTFGGINGSLFTSSRMFFAGAREGHLPRLLAMIHVNRFTPIPALLFTCISTLLMLCTSDMYTLINYVGFINYLFYGVTVAGQIVLRIRQPDLSRPIKVSLVWPVIYLLFWAFLLVFSLYSQPMVCCIGLAIMLTGVPVYYLGVYWENKPKKFTHFVGKMTGLGQKLCLVVYPAEDER 494          
BLAST of slc7a-9 vs. Ensembl Cavefish
Match: si:dkeyp-120h9.1 (Y+L amino acid transporter 2 [Source:NCBI gene;Acc:103044827])

HSP 1 Score: 387.882 bits (995), Expect = 6.526e-130
Identity = 193/466 (41.42%), Postives = 303/466 (65.02%), Query Frame = 3
Query:   90 KSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKP--FNRMLESINIGVQKM 1481
            KS +     ++ LK+ I+LL+GV +IVG+MIGSGIF+SP GV L TGS   S++IW + G++++ GA CYAELG  I++S   YAY+ E+FG  +AFIR+W  +I+  P   A+I+LTF+ Y+++P Y  C  P IA +++AA  I ++TFVNC  VK    +Q I T AKV ALI+II+ G++ L  G T  +E+ F+ +  N GDM +A Y  L++Y+GW  LN + EE+K+P +++P +I IS  +VT+IY+L N++Y+ ++    +  S A+AV     + G   W+IPL VA+S +GG+N +I+  SR+F V ++   +P  L+MI+ K  TPIP++LF   +SL +L   D+F L+NY  F  WL  GL++ S IY R+K  ++ RP+++++ FPI+Y   T+FL++         S++G ++ +S  PVY+ICV   +  +P     ML+ I++  QK+
Sbjct:    3 KSVDTASTNSMHLKQEISLLHGVCLIVGNMIGSGIFVSPKGVLLYTGSFGLSLVIWAIGGVFSVFGALCYAELGTTIRKSGASYAYILESFGGFLAFIRLWTSLIIVEPACQAVIALTFSNYLVQPFYPTCIAPYIAVRIIAALIIGLLTFVNCMKVKWGAILQVISTVAKVLALIVIIIAGLIVLAKGETQPFENSFQNSKLNPGDMALALYAALYSYSGWDTLNFITEEIKNPERNLPLSIAISMPIVTVIYLLTNIAYYAVMDIDTVLHSEAVAVTFADSVLGYARWLIPLSVAISCYGGLNSSIIAASRLFFVGSREGHLPNVLSMIHVKRYTPIPALLFNGGMSLLFLFEKDVFRLINYFSFNYWLFIGLSIGSQIYLRVKAPEMPRPVKLSLFFPIVYCLCTLFLVVVPLYSDTLNSLVGIVVALSGAPVYFICVYLPQSSRPAFLGEMLDKISLYTQKL 468          
BLAST of slc7a-9 vs. Ensembl Sea Lamprey
Match: SLC7A11 (solute carrier family 7 member 11 [Source:HGNC Symbol;Acc:HGNC:11059])

HSP 1 Score: 325.479 bits (833), Expect = 4.473e-106
Identity = 177/482 (36.72%), Postives = 294/482 (61.00%), Query Frame = 3
Query:   69 SSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEK 1514
            S   GD    N      + LKK ITL+ G++IIVG++IG GIFISP G+   TGS   S+++W  CG+ ++ GA  YAELG  IK+S G Y Y+ EAFGPL AF+R+W+++I+ RP   A+I+LTF QY+L+P++  C+ P +A +++ A  I ++ F+N  SV  + R+Q   T++K++A+ III+ GI+ L  G T +++  F G       + +AFY+G++AY+GW Y+N + EE+ +P +++P AI IS G+VT+ Y   N++YF ++S +E+  S A+AV    ++ G     +P+FVALS  G +NG +   +R+F VA++   +P  L+MI+ +  TP+P+V+ +  +++  L   DI++L+N+  F  WL   +AV  L+Y R     + RP +V +  P+ +    + ++  +    P  S +G  I +S +PVY++ V+W  KP    R  +     V ++  +IL   P++
Sbjct:   29 SGGDGDPLGKNDS--DRVHLKKKITLVRGISIIVGTIIGGGIFISPKGILTNTGSVGMSLVVWAACGVLSLFGALSYAELGTCIKKSGGHYTYILEAFGPLPAFVRLWVELIIIRPAATAVIALTFGQYILQPMFPQCHVPQLAVKIVTALAISLVMFINSSSVSWTARLQTFLTFSKLAAVGIIIIPGIIHLAKGNTEHFQDSFVGKEVGLMGLPLAFYSGMYAYSGWFYMNFVTEEVDNPERNIPLAICISMGIVTVAYTFMNMAYFAVMSGAELLASKAVAVTFAERLLGNFSITVPVFVALSCLGSLNGGVFAIARMFFVASREGHLPHILSMIHIRKHTPLPAVIILYPLTMLMLFVGDIYSLLNFFSFARWLFIAMAVSGLVYMRFTRPHMHRPFKVPLFIPVFFSLSCLLVVALSLYSDPVNSGIGCAITLSGVPVYYLTVVWDGKPTAVKRATDR----VTRVLQLILQVAPQE 504          
BLAST of slc7a-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002665.1 (pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1 gene:ENSPMAG00000002414.1 transcript:ENSPMAT00000002665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.064 bits (780), Expect = 2.276e-99
Identity = 166/412 (40.29%), Postives = 244/412 (59.22%), Query Frame = 3
Query:   57 KMAESSKR---GDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGV-YLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVN 1280
            K A+SS +   GD   ++G V     L +TI    GV ++VGSM+GSGIF+SP GV     G  +S++L+W  CG+ +++GA CYAELG  +  + G+YAYV  AFG  +AF+  W  V + RP   + ++LTFA+YVL P+++ C  PP   + LA A +L++  +NC S+K + R  D+ T  K+ AL I+ + G+V L  G T N    F G   +   +  +FY GL+AY GW+ LN   EE+KD  K++ R I ++  LVT  YVL N+SY T+L+  EI  S A+AV  G ++ G   WI+PL VA+STFG +N +     R+   AA+       LAM++ +  TP P+V F  ++S+ ++L  D+  L NY GFVTWL  GL    L+  R +   + RP RV+
Sbjct:   14 KSADSSPKEEGGDGHDASGGV----RLARTIGFATGVNVLVGSMVGSGIFVSPGGVLRFVGGDPSSALLVWAGCGLLSLLGALCYAELGAAVPTTGGEYAYVRRAFGAPLAFLFAWTSVALLRPAMNSAVALTFAEYVLRPLFHGCPAPPAIVKCLAIASLLVVGILNCVSMKWAMRALDVLTLLKMLALAIVSVGGLVLLASGRTHNPLGSFAGAPPSPAQIGESFYQGLWAYGGWNALNYATEELKDVHKNITRCIVVAVPLVTAFYVLVNISYMTVLTPKEIISSAAVAVTWGDRVLGSFSWIVPLSVAVSTFGSLNCSAFVMGRLNYAAAREGHALPLLAMLSVRHQTPTPAVAFSTLLSVAFVLPTDLIMLTNYFGFVTWLLVGLNCAGLLVLRYREPDLRRPYRVS 421          
BLAST of slc7a-9 vs. Ensembl Sea Lamprey
Match: slc7a7 (solute carrier family 7 member 7 [Source:ZFIN;Acc:ZDB-GENE-051127-5])

HSP 1 Score: 246.128 bits (627), Expect = 1.529e-78
Identity = 119/241 (49.38%), Postives = 168/241 (69.71%), Query Frame = 3
Query:   78 RGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVK 800
             GDV +   E   ++ LKK I+L++GV +IVG+MIGSGIF+SP GV + + S   S+++W L GI+++ GA CYAELG  I +S   YAY+ EAFG   AFIR+W  +++  P + A+I++TFA Y+++PI+  C  P  A +L+AAACI ++TFVNC  VK   RVQD+ TYAKV ALI +I+ GIV LG G T N ES FEG+  + G+M +A Y+ LF+Y+GW  LN + EE+K+P +
Sbjct:   28 NGDVPAQ--EAQDSMQLKKEISLVSGVCLIVGNMIGSGIFVSPKGVLMYSASYGLSLVVWALGGIFSVFGALCYAELGTTITKSGASYAYILEAFGKFPAFIRLWTSLLIIEPTSQAVIAITFANYLVQPIFSTCEPPYAASRLIAAACICLLTFVNCAYVKHGIRVQDLSTYAKVIALIAVIIAGIVFLGKGKTENLESSFEGSNWDVGNMALALYSALFSYSGWDTLNFVTEEIKNPER 266          
BLAST of slc7a-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000258.1 (pep scaffold:Pmarinus_7.0:GL477686:30307:38152:1 gene:ENSPMAG00000000231.1 transcript:ENSPMAT00000000258.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.422 bits (472), Expect = 3.179e-56
Identity = 93/225 (41.33%), Postives = 139/225 (61.78%), Query Frame = 3
Query:  126 LKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVK 800
            L +TI  L G+ + VG +IGSGIFISP+GV    GS   ++++WL CG  +++GA  YAELG  I++S   Y Y+ E  G L AF+ +W++ I+ RP  +A++ L+  QY LE +Y  C  P IA +LLA   I  + +VN WS   S RVQ   + +K++AL  II  GI  +  G T  +E+ F+   +    + +AFY+G+FAY+GW+ LN + EE+K P +
Sbjct:    3 LDRTIGFLYGIFMQVGMIIGSGIFISPSGVLRHAGSVGWALMVWLACGFLSLLGALSYAELGTTIRQSGSHYIYLRETLGTLPAFLFLWVEFIIVRPSVMAVVFLSMGQYSLEALYSPCAVPRIAVKLLAMVSISFVVWVNTWSSTLSLRVQSCLSVSKLAALASIIGVGIAHVARGRTEYFENAFDTADSRPEGLPLAFYSGMFAYSGWASLNSVTEEVKRPER 227          
BLAST of slc7a-9 vs. Ensembl Sea Lamprey
Match: slc7a5 (solute carrier family 7 member 5 [Source:ZFIN;Acc:ZDB-GENE-080818-4])

HSP 1 Score: 145.976 bits (367), Expect = 2.401e-41
Identity = 75/192 (39.06%), Postives = 122/192 (63.54%), Query Frame = 3
Query:  918 AVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVI 1493
            A   G    GVM WIIP+FV+LS FG VNG++ T+SR+F V A+   +P  L+MI+ +  TP+PS+LF  +++L Y +  DIF+++N+  F  WL   +A+  +++ R K  + +RPI+VNI+ PI ++   +FLI+ + +  P E  +G  I+++ IPVY++ V W+ KP     ++ S+ I  QK+  VI
Sbjct:    1 AQDFGNYHLGVMSWIIPVFVSLSCFGSVNGSLFTSSRLFFVGAREGHLPNLLSMIHRRLFTPVPSLLFTCLMTLLYAISDDIFSVINFFSFFNWLCIAMAICGMMWLRYKEPQRDRPIKVNILLPISFVLACIFLIVVSVVVTPVECGIGLGIILTGIPVYFVGVRWQNKPPSLLNLISSMTILSQKVLEVI 192          
BLAST of slc7a-9 vs. Ensembl Yeast
Match: MUP1 (High affinity methionine permease; integral membrane protein with 13 putative membrane-spanning regions; also involved in cysteine uptake [Source:SGD;Acc:S000003287])

HSP 1 Score: 90.5077 bits (223), Expect = 1.008e-19
Identity = 118/499 (23.65%), Postives = 216/499 (43.29%), Query Frame = 3
Query:   51 NHKMAESSKRGDVKSS-----NG--------EVVKTIDL-KKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIR-------MWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMG-----YTINWESPFEGT-TTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMY--GVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTK-FSTPIPSVLFVAIV----------SLGYLLFPDIFTL-MNYVGFVTWLTFGLAVLSLIYFRIKWKKVE--RPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWI-CVL 1415
            N++ + S+ + +V +S     NG        +    +D  +K + +L+ + +I   M+G+G+F   + +Y   GS   ++++W +  I  + G Y Y E G  I ++ G+  Y+   F     FI         ++        N AI+ LT A   +       NQ  I       A +     +N  +VK    +Q+I    K+  ++ I +TG V LG G      + N+ + FEGT T  A  +  A Y+ ++++ G+S +N  + E+K+PV+ +  A   S   + +IY+  N++YF ++ K ++  S  +     + +   G         V LS  G V   I +  RI     +   +P      ++K F++P+  +    IV             YLL  ++ +  MN + F        A L  IY++ +  K+E   PI+  +     +    ++LII      P+        + S++P YWI CV+
Sbjct:   18 NYQFSSSTTKKEVSNSTVDADNGASDFEAGQQFATELDQGEKQLGILSCIGLICNRMLGTGVFAVSSTIYTLCGSVGLALIMWAVGAIIAISGLYVYMEFGTAIPKNGGEKNYLEAIFRKPKFFITCMYAAYIFFLGWAAGNSINTAIMFLTAADTEVTK----WNQRGI-----GVAVVFFAFLINSLNVKIGLYLQNILGIFKIGIVLFISITGWVALGGGLKDGYQSHNFRNAFEGTETATAYGIVNALYSVIWSFVGYSNVNYALGEVKNPVRTLKIAGPTSMVFLAIIYIFVNIAYFAVVPKDKLISSKLILAADFFDIVFGGQAKRAAAALVGLSALGNVLSVIFSQGRIIQQLGREGVLPFSNFFASSKPFNSPMVGLFQHFIVCTVTILAPPPGDAYLLVQNLISYPMNIINFAI-----SAGLLWIYWQRRQGKIEWNPPIKAGVFVTGFFTLSNLYLII-----APYVPPSNGESVYSSMP-YWIHCVI 496          
BLAST of slc7a-9 vs. Ensembl Yeast
Match: MUP3 (Low affinity methionine permease; similar to Mup1p [Source:SGD;Acc:S000001028])

HSP 1 Score: 75.0998 bits (183), Expect = 8.138e-15
Identity = 90/437 (20.59%), Postives = 188/437 (43.02%), Query Frame = 3
Query:  132 KTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSAS-SILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAII------SLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYT---INWESPFEGTTTNA----GDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGY-QMYG--VMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAM-INTKFSTPIPSVLFVAIVSLGY-LLFPDIFTLMNYV----GFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTL 1373
            + + + + V + V  ++GSGIF  P+ + L TG +      IW+        G Y + E G  I +S G   ++  +F       R+ I V+ +  C   +       S+ F +YVL       +      + ++ + I+    ++  SV+    +Q+     K+  ++++   G+  L    +   + W+ P      ++      +  AF +  F ++GW  ++ +  E+K+PVK +  +  +S  +  + Y + NV+Y  +L+  EI  +  L   V + +++G  V    I   +A+S    +   I + SR+     +   +P  + M  N  F  P+PS+     +++ + L+ P      NY+    G+       L  + L  +R K K     IR +    +  + +++++++  F   P  + +G L
Sbjct:   63 RHLGVFSTVVLFVSRIMGSGIFAVPSVILLNTGGNKLIYFAIWVFSAAIAFAGLYLFLEFGSWIPKSGGRKNFLERSF----ERPRLLISVVFS--CYSVLTGYALTGSIVFGKYVLSAFGVTDDS---WSKYVSISFIIFAVLIHGVSVRHGVFIQNALGGLKLIMIVLMCFAGLYTLFFYKSTGQVAWDLPVTQVEKDSLLSVSSIATAFISSFFCFSGWDTVHTVTSEIKNPVKTLKVSGPLSLIICFVCYTMMNVAYLKVLTYEEIVSAGPLVGSVLFTKLFGPRVGGKFIAFSIAISAASNILVVIYSISRVNQEIFKEGYLPFSIHMSKNWPFDAPLPSISLCGFITIAWILILPKEGESFNYLVSMDGYGNQFFLLLVAIGLFIWRFKHKNEVPEIRASTFGVLAIITLSLYMLMAPFFADPSLNRVGFL 490          
BLAST of slc7a-9 vs. Ensembl Yeast
Match: GAP1 (General amino acid permease; Gap1p senses the presence of amino acid substrates to regulate localization to the plasma membrane when needed; essential for invasive growth [Source:SGD;Acc:S000001747])

HSP 1 Score: 50.447 bits (119), Expect = 5.364e-7
Identity = 68/262 (25.95%), Postives = 109/262 (41.60%), Query Frame = 3
Query:  126 LKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCG--IYTMIGAYCYAELGCLIKRSAG--DYA--YVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIV-------KLGMGYTINWESP--FEGTTTNAG--DMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLA 860
            LK  +   +   I +G  IG+G+ +  +G  L+TG  AS ++ W   G  IY M+ A    EL  +   S G   YA  ++ E+FG    F  M +  +V  P  +   S+T   +  +P Y         R    A   L I  +N + VK     + + ++ KV  ++  I+ GI+         G      W  P  F G T  A    +   F T  F++ G   +     E  +P K +P+A       +TL Y+L+
Sbjct:   86 LKHHLKNRHLQMIAIGGAIGTGLLVG-SGTALRTGGPASLLIGWGSTGTMIYAMVMAL--GELAVIFPISGGFTTYATRFIDESFGYANNFNYM-LQWLVVLPLEIVSASITVNFWGTDPKY---------RDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILS 334          
BLAST of slc7a-9 vs. Ensembl Nematostella
Match: EDO41545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T4])

HSP 1 Score: 382.874 bits (982), Expect = 4.040e-128
Identity = 207/449 (46.10%), Postives = 297/449 (66.15%), Query Frame = 3
Query:  120 IDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPD---IFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLES 1457
            I LKK IT++NG+ II G++IGSGIFISPTG+  + GS   ++LIWL CGI  M+G  CYAELG L+ +S  +YAY+ EAFG + A++  W  +++ RP + AII+L F +YV +P +  C  PP   ++LA  C++++T VNCWSVK +TRVQD+ TYAK+  + ++ + GIV+L  G T ++++ F G+TTN G + +AFY GL+A+ GW+ LN   EEMK P +DMPRAI I   L+T+ Y+L NV+Y T+L  S I ES A+AV VG    G + WI+PLFVA STFG VNG +LT  R+  VAA+ + MP  LAMI+ K  TP+PS+LF  +VS+  +L P+     TL+++  F  WL +G   LSL++ R K     RP RV +V PII    +++LI+    G PF S++   ++ + +P Y++ V     PK F RM++S
Sbjct:   39 ITLKKNITMVNGIGIIAGTVIGSGIFISPTGIQKEAGSIGLALLIWLGCGILAMLGCLCYAELGALVTKSGAEYAYLMEAFGRIPAYLFAWTSILIIRPASGAIIALIFGEYVAKPFFPDCPPPPEVVKILACVCLVVVTGVNCWSVKWATRVQDVFTYAKLLCIAMLTIIGIVELCRGKTEHFQNGFSGSTTNIGQIGLAFYIGLWAFDGWNNLNYCTEEMKHPERDMPRAIIIGISLITVCYLLINVAYITVLGASGILESEAVAVSVGNMYLGPVKWIVPLFVAASTFGAVNGMVLTNGRLLYVAARDNLMPSLLAMIHVKRFTPLPSLLFTTLVSV-IMLIPETSSFTTLVDFFSFAAWLFYGGTFLSLLWLRYKRPNQHRPYRVWVVVPIIMSISSIYLIVAPITGDPFGSLIALAVIAAGLPFYFLFVYSNLTPKWFLRMVDS 486          
BLAST of slc7a-9 vs. Ensembl Nematostella
Match: EDO40551 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S703])

HSP 1 Score: 375.941 bits (964), Expect = 2.342e-125
Identity = 195/480 (40.62%), Postives = 300/480 (62.50%), Query Frame = 3
Query:   96 SNGEV----VKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIA-RQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPD---IFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPE 1511
             NG++    +K I LKK ++L+NGV ++VG MIGSGIFISP GV  +TGS   S+++W  CG+  + G+ CY E+G +I +S  +Y+Y+ +AFGPL AF+  W   ++ RP ++AI+SLTFA+YV +P +  C   P++ R++LAA C+ +  F+NC SV+ +TR+QD  T  K+ A+ I+++ GI+ +  G     E PFE +T N   + +AFY+GL+AY GW+ LN + EEMK+P +D+PRA+ I   LVT+ Y+L N++Y  ++ +  I  S A+A+ VG    G M WIIP+FVA STFG VNG + + +R+  V+A+   MP+ LAMI+ K  TP+PS++F+  ++L  +L PD     TL+NY  F  WL++   + +L+Y R K     RP +V +V P+I     ++L+I  F   P ES M  + ++  IPVY++   W    K     ++     VQK F + L   P+
Sbjct:   21 ENGDIPPVEIKEIHLKKEVSLINGVALVVGVMIGSGIFISPKGVLQQTGSVGLSLVVWAGCGLLALFGSLCYCEMGTMIPKSGAEYSYLKDAFGPLPAFLYSWTLALIIRPSSLAIVSLTFARYVTQPFFPNCEISPLSVRKILAACCLALTLFINCASVRWATRIQDSFTLGKLIAIAILVILGIITIAKGQVEYLEDPFEKSTPNPAAIGLAFYSGLWAYDGWNALNFVTEEMKNPARDLPRALIIGIPLVTICYLLTNIAYIAVVGREGILSSGAVAMTVGDMYLGPMSWIIPIFVACSTFGCVNGLLFSGARLVYVSARNGHMPRLLAMIHNKCQTPMPSIIFMNTIAL-IMLIPDASEFGTLVNYFSFAAWLSYFAVICALLYLRWKRPNAHRPYKVWLVIPVIAACAALYLLITPFAKEPVESSMALIFIVLGIPVYFLFCKWDILGKMCGPSVDKFLWNVQKWFDLSLEERPD 499          
BLAST of slc7a-9 vs. Ensembl Nematostella
Match: EDO37074 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGV3])

HSP 1 Score: 374.4 bits (960), Expect = 5.032e-125
Identity = 197/481 (40.96%), Postives = 298/481 (61.95%), Query Frame = 3
Query:   66 ESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFP--DIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRK--PKPFNRMLESINIGVQKMFLVIL 1496
            + S+  D ++   ++   + L+K +TLL+G++ IVG++IGSGIFISPTG+   T S   S+++W  CG   ++   CY ELG  +++S  +YAY+ EAFGP+ AF+  W  +I+ RP   AI+SL FA+YV +P +  C  PP   +LL  ACI+ +T +NCWSV+ +TRVQ I TYAK+  + ++++ G+V+L  G T N ++ FEG+ T+   +  AFY GL+AY GW+ LN   EEMKDP +DMP+AI I   ++T  Y++ N++Y T+L  + I  S A+AV +G    G M WIIP+FVA STFG VNG   T+ R+   AA+   +P  LAMI  K  TP+PS+L  + +++  LL P  +  +L+ +  F  WL +G +  +L++ R K  ++ RP RV IV PI  L  +++L I  F+  P  S +  LI+++ +P Y+    +K    PK F R  ES   G QK+F + L
Sbjct:   18 KPSEEADPEAPKVQIQSKVGLEKRVTLLSGISFIVGTVIGSGIFISPTGILGTTQSIGLSLMVWFGCGFLALLACLCYTELGTAVQKSGAEYAYLMEAFGPIPAFLFAWTGIIINRPAITAIVSLIFAEYVAKPFFPECAPPPAVVKLLGLACIVTVTGINCWSVRWATRVQRIFTYAKLLCIAMLVIIGVVELCKGKTENLQNAFEGSETDPAKIGFAFYIGLWAYDGWNSLNYCTEEMKDPARDMPKAIIIGISIITGCYLMVNIAYITVLGGAGILASEAVAVSIGDVYLGPMKWIIPVFVAASTFGTVNGVAFTSGRLTYTAARDGLLPSMLAMIQVKRLTPLPSMLLTSTIAICMLLPPGSNFMSLVGFFSFAAWLFYGGSFAALLWLRYKKPEMPRPYRVPIVIPIFMLLASMYLCIAPFVAKPIGSTIACLIILAGLPFYF---FFKSPYVPKWFRRYFESFTYGSQKLFNIAL 495          
BLAST of slc7a-9 vs. Ensembl Nematostella
Match: EDO41594 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3U0])

HSP 1 Score: 371.318 bits (952), Expect = 2.421e-124
Identity = 196/456 (42.98%), Postives = 296/456 (64.91%), Query Frame = 3
Query:  177 MIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCN--QPP-----IARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPD---IFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEK 1514
            MIGSGIF S +GV++ TGS+   I +W LCG+  M+G+ CYAELG +I +S  +YAY+  AFG  VAF+  W   I+ +P  +AI+SL F QYV+EP +  C+   P      I  +LLAA CI +IT+VNC+SVK +TRVQ + T AK+ A+ ++I+TG+V+LG G+T +++  F+GTTT+ G +  AFY GL+AY GW+ LN + EE+K+P +D+PR+I     L T+ YVL N++Y T+L+  E+  S A+AV +  ++YGVM W IP+FVA STFG  NG+  +  R+  VAA+   +P+ LAM++TK  TP+P++LF +I++   +L PD     TL+NY  F  W+ +G  V +L++ R +  ++ERP +V ++ PI+ L  +++LII  F   P ES    L +++ IP Y + V +K  PK F   ++SI   +Q +    LP   E+
Sbjct:    1 MIGSGIFASASGVFMYTGSAGLGIAVWALCGVIAMMGSLCYAELGTMIVKSGAEYAYLNAAFGERVAFLFSWTSTILLKPSQIAIVSLAFGQYVVEPFFPTCSGFDPDRLDLKILEKLLAAVCIGVITYVNCFSVKLATRVQVVFTAAKLIAIAMLIITGLVRLGQGFTGSFDDAFKGTTTSIGMVGFAFYNGLWAYDGWNNLNYVTEELKNPYRDLPRSILFGIPLGTVCYVLVNIAYLTVLTPVEVMASGAVAVTLSNRLYGVMAWTIPIFVACSTFGAANGSAFSGGRLVYVAAREGHLPEFLAMVHTKRHTPLPAMLFNSIIAW-LMLLPDSSSFETLINYFSFAAWVFYGSTVSALLWLRYRKPEMERPYKVPLLVPIMVLLASLYLIIAPFYEAPLESFYCLLFILAGIPFYLVFVYFKVAPKWFLNGVDSITYKLQVLCDCALPESEEE 455          
BLAST of slc7a-9 vs. Ensembl Nematostella
Match: EDO41148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S561])

HSP 1 Score: 348.591 bits (893), Expect = 6.879e-115
Identity = 186/472 (39.41%), Postives = 288/472 (61.02%), Query Frame = 3
Query:  120 IDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQP----PIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPD---IFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEK 1514
            I L++ + L   V  +VG++IGSGIF +P  V L TGS   S+L+W LCG+  + G+  Y EL  +I R  G+YAY+ +AFGP  AF+  WI V   +P  V I+ L F  YV+EP +  C+      P+ + +LAA+ + +IT VNC SVK S+R+Q   T  K+ A++++++TGIV++  G+  + +  F+GT T+ G +  AFY GLF+Y GW+ LN  VEE+K+P + +PRAI+I+  LVT  YVL N+ Y ++L+  E+  SNA+AV +  +MYGVM W IP+ VA STFG  NG   +  R+   AA+   +P+ LAM++TK  TPIP++LF + +S   +L PD     TL+N+  F+ WL +G+ + S+I+ R++ K   RP +V I+ P +   ++++L++  F   P  S    L ++S IPVY   V +K  P+        I + +Q +  V LP   ++
Sbjct:   32 IGLRRNVGLSGAVAFLVGTIIGSGIFATPRWVLLYTGSVGLSLLVWALCGMIALFGSLSYVELALMIPRCGGEYAYLMQAFGPFAAFLYSWISVCFLKPATVLIL-LAFGAYVIEPFFPHCSHREDLVPVIK-ILAASALGVITIVNCASVKWSSRIQIAFTVGKMIAILMLVLTGIVRIAQGHVSSLKDSFQGTATSLGMVGFAFYNGLFSYDGWNQLNFFVEEIKEPNRTVPRAIWIAIPLVTASYVLVNIGYLSVLTPDELRTSNAVAVTLASRMYGVMAWTIPILVAFSTFGSANGNFFSGGRLAYAAAREGHLPELLAMVHTKRHTPIPAILFSSTISC-IMLIPDSSKFETLLNFGAFIVWLFYGVTMFSIIWMRVRQKDKTRPYKVPIILPCLMTLLSIYLVVAPFYQAPLPSFYALLAVLSGIPVYLFFVRYKVLPQCIMDRYARITVRIQLVLGVALPKSEKE 500          
BLAST of slc7a-9 vs. Ensembl Medaka
Match: slc7a7 (solute carrier family 7 member 7 [Source:NCBI gene;Acc:101169978])

HSP 1 Score: 417.157 bits (1071), Expect = 2.495e-141
Identity = 209/486 (43.00%), Postives = 319/486 (65.64%), Query Frame = 3
Query:   66 ESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKP--FNRMLESINIGVQKMFLVILPAMPEKA 1517
            E +  G     +G   +++ LKK I+LLNGV +IVG+MIGSGIF+SP GV + + S   S+++W + GI+++ GA CYAELG  I +S   YAY+ EAFG  +AFIR+W  +++  P + A+I++TF+ Y+++PI+  C  P +A +LLAAACI ++TFVNC  VK  TRVQD  TYAKV ALI +I+TG+VK+G GYT N++  F+G++ + G + +A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VT+IY+L NV+Y+TIL  + I +S+A+AV    Q++GVM W IPL VALS FGG+N +I+  SR+F V ++   +P  L MI+    TPIP++LF   ++L YL   D+F L+NY  F  W   GL++L  +Y R K     RP+++++++PII+  +TVFL++         S++G  I +S +PVY++C       +P      +    + +QK+   +L  M  KA
Sbjct:   11 EGTNGGPPSLKSGSSDESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIHSASYGLSLVVWTIGGIFSIFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYVANRLLAAACICLLTFVNCAYVKWGTRVQDFFTYAKVLALIAVIITGLVKIGQGYTQNFDGMFDGSSRDPGHLALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAISMPIVTVIYILTNVAYYTILPINAILDSDAVAVTFADQVFGVMNWTIPLAVALSCFGGLNASIVAASRLFFVGSREGHLPDFLCMIHVSRYTPIPALLFNGFMALIYLCVEDVFRLINYYSFSYWFFVGLSILGQLYLRWKEPDRVRPLKLSLIYPIIFCILTVFLVVVPLYSDTINSLIGIGIALSGVPVYFLCCYTPAYKRPLWLRNFIAKSGLIIQKVCFSVLTEMDVKA 496          
BLAST of slc7a-9 vs. Ensembl Medaka
Match: slc7a5 (solute carrier family 7 member 5 [Source:NCBI gene;Acc:101163489])

HSP 1 Score: 412.535 bits (1059), Expect = 3.835e-139
Identity = 211/457 (46.17%), Postives = 316/457 (69.15%), Query Frame = 3
Query:   69 SSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINW--ESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPK 1433
            S  +G+  ++ GE    + LK+TITLLNGV IIVG++IGSGIF++PTGV  + GS   S+++W +CG+++ +GA CYAELG  I +S GDYAY+ E +G L AF+++WI++++ RP +  I++  FA Y+L+P++ +C  P    +L+A  CIL++TFVNC+SVKA+TRVQD    AK+ ALI+II+ G VK+G G T +   E+ F+G+    G++ +A Y+GLFAY GW+YLN + EEM +P K++PRAI IS  +VT +YVL N++YFT LS  ++  S A+AV  G    G M WIIP+FV LS FG VNG++ T+SR+F V A+   +P  L+MI+    TP+PS++F  +++L Y    DIF+++N+  F  WL   LA++ +++ R K  ++ERPI+VNI+ PI ++   +FLII +F   P E  +G  I+ + +PVY+I V W+ KPK
Sbjct:   40 SEDKGEA-AAGGE--DGVALKRTITLLNGVAIIVGTIIGSGIFVTPTGVVKEAGSVGLSLIVWAVCGVFSTVGALCYAELGTTITKSGGDYAYILEVYGSLPAFLKLWIELLIIRPSSQYIVAYVFATYLLKPLFPVCPVPENGAKLVACLCILLLTFVNCYSVKAATRVQDFFAAAKLLALILIIIIGFVKIGQGDTDDLLPENSFKGSNYEFGNIGLALYSGLFAYGGWNYLNFVTEEMIEPYKNLPRAIIISLPIVTAVYVLTNLAYFTTLSPQQMLGSEAVAVDFGNHHLGPMAWIIPVFVGLSCFGSVNGSLFTSSRLFFVGAREGHLPNLLSMIHPTLLTPLPSLIFTCLMTLLYAFSNDIFSVINFFSFFNWLCIALAIIGMMWLRHKKPELERPIKVNILLPISFVLACLFLIIVSFWKTPIECAIGFGIIATGLPVYFIGVWWQNKPK 493          
BLAST of slc7a-9 vs. Ensembl Medaka
Match: si:dkeyp-120h9.1 (Y+L amino acid transporter 2 [Source:NCBI gene;Acc:101167380])

HSP 1 Score: 390.578 bits (1002), Expect = 5.203e-131
Identity = 194/471 (41.19%), Postives = 306/471 (64.97%), Query Frame = 3
Query:   81 GDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKP--FNRMLESINIGVQKMFL 1487
            GDV S        + LK+ I+LL+GV +IVG+MIGSGIF+SP GV + TGS   S+++W + G++++ GA CYAELG  I++S   YAY+ EAFG  +AFIR+W  +++  P   A+I+LTF+ Y+++P Y  C+ P  A +L+AAA I ++T VNC  VK    +Q I T AKV ALI+II+TG+VKL  G+  N+E+ F+G+  + G M +A Y+ L++Y+GW  LN + EE+K+P +++P +I IS  +VT+IY++ N++Y+ ++    +  S A+AV    ++ G   W+IP+ VA+S +GG+N +I+  SR+F V ++   +P  L MI+ K  TPIP++ F   +SL YL  PD+F L+NY  F  WL  GL++ S IY RIK   + RP+++++ FPI+Y   ++FL+I         S++G  + +S  PVY+IC+      +P   +++L+ I +  QK+ L
Sbjct:    5 GDVASQG----SGMRLKQEISLLHGVCLIVGNMIGSGIFVSPKGVLMYTGSFGLSLIVWAIGGVFSVFGALCYAELGTTIRKSGASYAYILEAFGGFLAFIRLWTSLMIVEPACQAVIALTFSSYLVQPFYPTCSAPYHAVRLIAAAIICLLTAVNCLKVKWGAILQVISTVAKVLALIVIIITGLVKLAQGFDQNFENSFKGSKLDPGYMALALYSALYSYSGWDTLNFITEEIKNPERNLPLSIAISMPIVTVIYIMTNIAYYVVMDADTVLSSEAVAVTFADEVLGWARWLIPISVAISCYGGLNSSIIAASRLFFVGSREGHLPNVLCMIHVKRYTPIPALFFNGAMSLFYLSVPDVFQLINYFSFNYWLFIGLSIASQIYLRIKAPDMHRPVKLSLFFPIVYCLCSIFLVIVPLYSDTLNSLVGIGVALSGAPVYYICIHLPPSSRPAFLSKLLDKICLFTQKLCL 471          
BLAST of slc7a-9 vs. Ensembl Medaka
Match: slc7a6 (Y+L amino acid transporter 2 [Source:NCBI gene;Acc:101174987])

HSP 1 Score: 390.578 bits (1002), Expect = 6.234e-131
Identity = 201/469 (42.86%), Postives = 310/469 (66.10%), Query Frame = 3
Query:  114 KTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKP--FNRMLESINIGVQKMFLVILPAMPEK 1514
            +T+ LKK I+LLNGV++IVG+MIGSGIF+SP GV + + S   S++IW + G+++++GA CYAELG  I +S   YAY+ E+FG  +AFIR+W  +++  P + A+I++TFA Y+++P++  C  P +A +LLAAAC+ ++TF+N   V+  TRVQDI TYAKV+ALI+II+TGIVKL  GYT N+ES F+G++ + GD+ +A Y+ LF+Y+GW  LN + EE+K+P +++P AI IS  +VT IY+L NV+Y+ +L    I  S+A+AV       G+M W IP+ VALS +GG+N +I+  SR+F V ++   +P  L+MI+ +  TPIP+++F  I+SL YL   D+F L+NY  F  W   GL+V   IY R K     RP+++ +V+P+++   +VFL+          S++G  I +S +PVY++ V      +P    ++L S+    Q     +L  M + 
Sbjct:   26 ETVQLKKEISLLNGVSLIVGNMIGSGIFVSPKGVLIYSASYGLSLVIWAIGGLFSVVGALCYAELGTTITKSGASYAYILESFGGFIAFIRLWTSLLIIEPTSQAVIAITFANYLVQPLFPTCEPPYVAARLLAAACLCLLTFINSAYVRWGTRVQDIFTYAKVAALIVIIVTGIVKLCQGYTNNFESAFQGSSADPGDIALALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTTIYILTNVAYYAVLDVGAILGSDAVAVTFADHTLGLMSWTIPIAVALSCYGGLNASIIAASRLFFVGSREGHLPDALSMIHIERFTPIPALIFNCIMSLIYLTVEDVFQLINYYSFSYWFFMGLSVAGQIYLRWKQPDRARPLKLTLVYPLVFCMCSVFLVAVPLYSNTVNSLIGIAIALSGVPVYFLGVYLPESKRPPIITKLLRSLTYFTQYSCFCVLTEMDKS 494          
BLAST of slc7a-9 vs. Ensembl Medaka
Match: ENSORLT00000010682.2 (Y+L amino acid transporter 2 [Source:NCBI gene;Acc:101165841])

HSP 1 Score: 383.645 bits (984), Expect = 5.470e-128
Identity = 193/476 (40.55%), Postives = 308/476 (64.71%), Query Frame = 3
Query:   63 AESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKP-FNRMLESINIGVQKMFL 1487
            + ++ + D+K  NG   + + +K+ I+L+NG+ +IVG+MIGSGIFISP GV + + S   S+LIW L GI+++ GA CYAELG  I +S   YAY+ E+FG  +AFIR+W  +++  P + A+ISLTFA Y+LE  Y  C  P    +L+AAAC+ I+ F+NC  VK  T VQD+ TYAK+ AL++II  GI+K+  G   ++E+PF+G++T+ G++++A Y+ LF+Y+GW  LN + EE+K+P +++P AI +S  +VT+IY+L N +Y+ +L    +  S+A+AV  G  + G   WIIP+ VA+S +GG+N +I+  SR+F V A+   +P  L++I+ +  TPIP+++F  ++ L +L   D+F L++Y  F  W   GL+V  LI+ RI      RP+++++ FP +Y   ++FL+I    G    S++G  I +S IPVY++ +      +P F R L +      +M L
Sbjct:   19 SAAASKEDLKVPNGVQREKMQMKREISLINGICLIVGNMIGSGIFISPKGVLMYSSSYGLSLLIWALGGIFSVFGALCYAELGTTITKSGASYAYILESFGGFLAFIRLWTSILLIEPASQAVISLTFANYLLEAFYPTCQPPYDGVRLIAAACLCILIFINCAYVKWGTLVQDVFTYAKLMALLLIICIGILKMVAGEMKSFENPFDGSSTDPGEISLALYSALFSYSGWDTLNFVTEEIKNPERNLPLAIAVSMPIVTIIYLLTNAAYYVVLDMPSLLSSDAVAVTFGNAVLGPFKWIIPVSVAMSCYGGLNASIIAASRLFFVGAREGHLPDSLSLIHVQRYTPIPALVFNGLMGLIFLCVEDVFQLISYFSFSYWFFVGLSVAGLIHLRITQPDRHRPVKLSLFFPFVYCLCSLFLVIVPLYGDTINSLIGIAIALSGIPVYYVAIYLPEDRRPRFLRKLNTFTTRYTQMML 494          
BLAST of slc7a-9 vs. Planmine SMEST
Match: SMESG000025359.1 (SMESG000025359.1)

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 483/487 (99.18%), Postives = 485/487 (99.59%), Query Frame = 3
Query:   60 MAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEKAM 1520
            MAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVR+GYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPK FNRMLESINI VQKMF+VILPAMPEKAM
Sbjct:    1 MAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRIGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKRFNRMLESINISVQKMFMVILPAMPEKAM 487          
BLAST of slc7a-9 vs. Planmine SMEST
Match: SMESG000044247.1 (SMESG000044247.1)

HSP 1 Score: 662.144 bits (1707), Expect = 0.000e+0
Identity = 309/489 (63.19%), Postives = 407/489 (83.23%), Query Frame = 3
Query:   60 MAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRI--KWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEKAM 1520
            M ++S   + K SN        LKK ITL+NG+ I++GSMIGSGIFISPTGVYLK GSS ++++IW+LCG+++MIGAYCY ELGC+IKRS+GDYAY+Y+AFGP +AF+R+WIDVIVTRPC +AI+SLTFA+Y+LEP++  C QP +AR+ LAA+CIL++TF+NCWSVKASTRVQDI T+AK+ AL+I+I+TG+VKL MG+T NWESPF  T T+ G +TM FY GLFAY GW+YLNCM+EEMK+PVKD+P+A+ ISC +VT++Y+LANVSYFTILS  EI  +NA+AVR+G   + VMWW+IP+FV++STFGGVNG I+TTSR+FLVAAQ DQMP  LAMI+T  STPIPSV+FV++VS+ YL++PD++ LMNYVGFVTWLTF  A+L+L+YFR   K++K+ERP  V+++FPI+YL V+ F+I+FAF+GG +ESMMGT+IM++A+PVY I V WK KPK FNR L      VQK+F+V+    P++++
Sbjct:    1 MKKNSLNENDKKSNDSNEDKCQLKKEITLINGIGIVIGSMIGSGIFISPTGVYLKAGSSGAALVIWMLCGVFSMIGAYCYIELGCIIKRSSGDYAYIYQAFGPFLAFVRLWIDVIVTRPCCIAIVSLTFAEYILEPMFLNCVQPIMARRCLAASCILLLTFINCWSVKASTRVQDIFTFAKLLALVIVILTGVVKLCMGFTSNWESPFSDTNTDIGQLTMGFYNGLFAYCGWNYLNCMMEEMKNPVKDLPKAVLISCSIVTVVYMLANVSYFTILSPIEIKLTNAVAVRIGLDNFSVMWWVIPMFVSMSTFGGVNGIIMTTSRMFLVAAQSDQMPASLAMISTSLSTPIPSVIFVSLVSMVYLVYPDMYVLMNYVGFVTWLTFAFAILALLYFRFSKKYQKLERPFTVHLIFPIVYLLVSAFIIVFAFVGGFYESMMGTIIMLTAVPVYLIGVKWK-KPKSFNRKLGDFTKFVQKLFIVV-ATEPDESL 487          
BLAST of slc7a-9 vs. Planmine SMEST
Match: SMESG000051755.1 (SMESG000051755.1)

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 281/477 (58.91%), Postives = 367/477 (76.94%), Query Frame = 3
Query:   69 SSKRGD--VKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVI 1493
            S+ + D  VK S+ +    ++LKK I LLNG+ IIVGS+IGSGIF+SPT V++K+GS  S+++IW LCGI+++IGAYCY ELG +I RS GDYAYV +AFGP +AF+R+W+DVIV RP + AII+L FA+Y LE +Y  C  P +A++LLAA CI I+TF+NC+SV+ ST VQDI +YAKV AL+IIIMTGIVKL  G T NWE+ F  ++TN GD  MAFY GLFAY GW+YLNC++EEMK+P +D+P +I IS  L+  IYVL N++YFTIL  SEI  + A+AV V  ++YGVMWWI+P+FVA+STFGGVNG +L TSRIF VAAQ +QMP  L  IN K+ TP+PSVLFV++VSL YL F DI  L+NY+GFV WL  G+AV ++I+FR K     RPIRV++ FPIIY   TV L+I +F+GGP+ES+MG +I+++A PVYWI VLWK KPK F   L++I + +QK+F V+
Sbjct:    2 STDKTDEVVKESSND---KVELKKEINLLNGIGIIVGSIIGSGIFVSPTEVFIKSGSPGSALIIWFLCGIFSLIGAYCYMELGTMITRSGGDYAYVLDAFGPFIAFLRLWVDVIVARPVSQAIIALVFAEYTLEALYIGCVSPIMAKRLLAAGCIGILTFINCYSVRWSTLVQDILSYAKVFALLIIIMTGIVKLAQGDTGNWENAFADSSTNPGDYAMAFYAGLFAYNGWNYLNCLIEEMKNPRRDLPLSILISMILIIFIYVLTNMAYFTILLPSEILNTKAVAVTVAIRLYGVMWWIMPIFVAMSTFGGVNGNLLATSRIFFVAAQENQMPMILETINVKYYTPVPSVLFVSLVSLVYLCFSDINILINYMGFVNWLAIGVAVFTVIWFRYKDPSKPRPIRVHLAFPIIYCVATVILLILSFVGGPYESLMGIVIILTAAPVYWIFVLWK-KPKSFQDKLDNITVVLQKLFYVV 474          
BLAST of slc7a-9 vs. Planmine SMEST
Match: SMESG000017104.1 (SMESG000017104.1)

HSP 1 Score: 332.413 bits (851), Expect = 5.321e-108
Identity = 178/493 (36.11%), Postives = 291/493 (59.03%), Query Frame = 3
Query:   48 INHKMAESSKRGDVKSSNGEVVKT------IDLKKTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIF----ESNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVIL 1496
            +  +M +  +R    SS     K       I L+K I +  GV+II+G ++GSGIF+SP GV   T S   S ++WL+ GI++  GA  +AELG  I RS G+Y Y+ + FG + AF+ +WI  I+      A  S+ FAQY+L+PI+  C  P  A  + A   I+ +  +NC++V+ +T++  + T +KV AL+III+ G V L  G T ++  PF G+  +   + MAFY G +AY+GW+YLN +  EMK+P K++P AI +S  L+T++Y+L NV+Y  +LS  EI      S A+AV    +  GVM W++P+FV +S FG +N  +L+ SR+    A+  QMP+ LAM++ K  TP+P+V+ + ++++ +  + + F L+   GF   +   +AV  L+Y R K   + RP ++ I+ P+++L   +F+        PF+S +   +M+ +IPVY I + W +KP+    ++  I + +QK+  V+L
Sbjct:    1 MGDEMKKEHQRQRTVSSISHASKKTKYKSLIQLRKDIGVFEGVSIIIGVIVGSGIFVSPVGVLKYTDSVGLSFVMWLIAGIFSTTGALVWAELGTTIPRSGGEYIYIMKTFGSMPAFLCLWITFILIGAVATAANSMIFAQYILQPIFGSCEVPVTAVLITANLGIMTLGAINCYNVQWATKMAIVFTVSKVLALLIIIVIGGVYLIRGNTESFVDPFSGSGFHTASIPMAFYQGFWAYSGWNYLNFLTNEMKNPEKNLPLAIILSLTLITVVYLLVNVAYLAVLSPQEILLIGQSSAAVAVNFADRTMGVMSWVMPIFVGMSVFGSMNSELLSLSRLTQTGAEEKQMPEVLAMVSYKHLTPMPAVIIITLLTILFQFYRNAFYLIELAGFAFAVIAAMAVCCLLYLRYKCPDLPRPFKLPIIVPVLFLLADLFIGGLTIYQQPFDSFISLCLMLLSIPVYIIFIAWTKKPRSLTDLISKITVNLQKLLNVVL 493          
BLAST of slc7a-9 vs. Planmine SMEST
Match: SMESG000006721.1 (SMESG000006721.1)

HSP 1 Score: 324.324 bits (830), Expect = 1.712e-105
Identity = 189/479 (39.46%), Postives = 292/479 (60.96%), Query Frame = 3
Query:   96 SNGEVVKTIDLK--KTITLLNGVTIIVGSMIGSGIFISPTGVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEAFGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQLLAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGYTINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMPRAIFISCGLVTLIYVLANVSYFTILSKSEIFE----SNALAVRVGYQMYGVMWWIIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIPSVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKVERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWICVLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEK 1514
            +  ++V  ID+K  K+I +  G+ II+G +IGSGIF+SP GV   T S   S+++W+LCG+++ +G+  YAELG  I +S G+Y Y+ E+FGPL AFI MWI  +     ++A  S  FAQY+L+P++  C+ P  A  L+    +  I  +NC+SVK +TR     T +KV AL+III+ G  KL  G  +++  PF  + T+ G + +AFY G +AY GW+YLN +  EM +P +++P AI  S  +VT+IYV  N++Y  +LS  E+ E    S A+AV    Q  G+   ++P+FV  S FG +NG  L+ SR+   AA    +P+ LAM++ K+ TP+P+V+F+A +S+ +   P I  L+   GF   +  G+AV  LIY RIK   + R  ++ ++ PI++L + +F+ I      P +S++G  I+   IP+Y I V+WK KPK    + ES+ I +QK FLV+    PE+
Sbjct:    2 TTDKIVNHIDIKLQKSIGVFQGMCIIIGIIIGSGIFVSPIGVLKYTNSVGMSMILWVLCGLFSALGSIVYAELGVTIPKSGGEYIYILESFGPLSAFICMWITFVTIGGVSLAANSFIFAQYILQPLFASCDIPNSALILVGLLGLASIAAINCYSVKWATRATVFFTISKVLALLIIIVIGFYKLFRGNVLSFTDPFADSNTSPGSLALAFYQGFWAYAGWNYLNFLTSEMINPARNLPIAIIGSLTIVTVIYVTTNIAYLAVLSPREMLEISSKSVAVAVVFADQTMGMFSCLMPIFVGASVFGSMNGEFLSVSRLTYTAAGQGHLPESLAMVSIKYLTPMPAVIFLAALSVVFTFTPSISYLIELAGFSFCVISGMAVSCLIYLRIKCPNLPRSFKLPLILPIMFLLLDLFIGILTVYEKPTDSLIGVAIIALGIPIYIIFVVWKSKPKSVTNLTESLTIYIQKTFLVV----PEE 476          
The following BLAST results are available for this feature:
BLAST of slc7a-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A61.027e-14143.13solute carrier family 7 member 6 [Source:HGNC Symb... [more]
SLC7A61.027e-14143.13solute carrier family 7 member 6 [Source:HGNC Symb... [more]
SLC7A76.042e-13743.94solute carrier family 7 member 7 [Source:HGNC Symb... [more]
SLC7A76.042e-13743.94solute carrier family 7 member 7 [Source:HGNC Symb... [more]
SLC7A76.042e-13743.94solute carrier family 7 member 7 [Source:HGNC Symb... [more]
back to top
BLAST of slc7a-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aat-12.757e-14346.28Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-12.757e-14346.28Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-31.083e-13243.92Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-32.312e-13243.92Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
aat-24.260e-10640.43Amino Acid Transporter [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of slc7a-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG16074.356e-16547.22gene:FBgn0039844 transcript:FBtr0085785[more]
CG16074.356e-16547.22gene:FBgn0039844 transcript:FBtr0085786[more]
CG16075.983e-16547.89gene:FBgn0039844 transcript:FBtr0334550[more]
CG16075.983e-16547.89gene:FBgn0039844 transcript:FBtr0334549[more]
JhI-215.424e-13844.13gene:FBgn0028425 transcript:FBtr0305089[more]
back to top
BLAST of slc7a-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a51.229e-14044.28solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
slc7a52.641e-13944.28solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
slc7a72.233e-13841.92solute carrier family 7 member 7 [Source:ZFIN;Acc:... [more]
slc7a72.233e-13841.92solute carrier family 7 member 7 [Source:ZFIN;Acc:... [more]
slc7a64.184e-13541.86solute carrier family 7 member 6 [Source:NCBI gene... [more]
back to top
BLAST of slc7a-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpm33.919e-14745.42dolichyl-phosphate mannosyltransferase polypeptide... [more]
dpm34.093e-14745.42dolichyl-phosphate mannosyltransferase polypeptide... [more]
slc7a72.202e-14144.65solute carrier family 7 (amino acid transporter li... [more]
slc7a77.117e-14144.26solute carrier family 7 (amino acid transporter li... [more]
slc7a71.634e-14043.74solute carrier family 7 (amino acid transporter li... [more]
back to top
BLAST of slc7a-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc7a83.896e-13845.68solute carrier family 7 (cationic amino acid trans... [more]
Slc7a67.470e-13841.70solute carrier family 7 (cationic amino acid trans... [more]
Slc7a71.451e-13742.92solute carrier family 7 (cationic amino acid trans... [more]
Slc7a71.451e-13742.92solute carrier family 7 (cationic amino acid trans... [more]
Slc7a71.451e-13742.92solute carrier family 7 (cationic amino acid trans... [more]
back to top
BLAST of slc7a-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92536|YLAT2_HUMAN4.932e-14143.13Y+L amino acid transporter 2 OS=Homo sapiens OX=96... [more]
sp|Q9QXW9|LAT2_MOUSE2.725e-13745.68Large neutral amino acids transporter small subuni... [more]
sp|Q8BGK6|YLAT2_MOUSE5.225e-13741.70Y+L amino acid transporter 2 OS=Mus musculus OX=10... [more]
sp|Q9Z1K8|YLAT1_MOUSE1.015e-13642.92Y+L amino acid transporter 1 OS=Mus musculus OX=10... [more]
sp|Q9UM01|YLAT1_HUMAN2.902e-13643.94Y+L amino acid transporter 1 OS=Homo sapiens OX=96... [more]
back to top
BLAST of slc7a-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YK320.000e+0100.00Slc7a-9 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A0H3YJ060.000e+090.76Slc7a-10 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YIW30.000e+063.19Slc7a-7 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A0H3YEY50.000e+058.91Slc7a-6 OS=Schmidtea mediterranea OX=79327 GN=slc7... [more]
A0A1S3IH310.000e+052.25large neutral amino acids transporter small subuni... [more]
back to top
BLAST of slc7a-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a78.425e-14043.72solute carrier family 7 member 7 [Source:NCBI gene... [more]
slc7a78.425e-14043.72solute carrier family 7 member 7 [Source:NCBI gene... [more]
slc7a72.539e-13943.72solute carrier family 7 member 7 [Source:NCBI gene... [more]
slc7a8b6.639e-13344.88large neutral amino acids transporter small subuni... [more]
si:dkeyp-120h9.16.526e-13041.42Y+L amino acid transporter 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of slc7a-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC7A114.473e-10636.72solute carrier family 7 member 11 [Source:HGNC Sym... [more]
ENSPMAT00000002665.12.276e-9940.29pep scaffold:Pmarinus_7.0:GL476806:119517:143089:1... [more]
slc7a71.529e-7849.38solute carrier family 7 member 7 [Source:ZFIN;Acc:... [more]
ENSPMAT00000000258.13.179e-5641.33pep scaffold:Pmarinus_7.0:GL477686:30307:38152:1 g... [more]
slc7a52.401e-4139.06solute carrier family 7 member 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc7a-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
MUP11.008e-1923.65High affinity methionine permease; integral membra... [more]
MUP38.138e-1520.59Low affinity methionine permease; similar to Mup1p... [more]
GAP15.364e-725.95General amino acid permease; Gap1p senses the pres... [more]
back to top
BLAST of slc7a-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO415454.040e-12846.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405512.342e-12540.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370745.032e-12540.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO415942.421e-12442.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411486.879e-11539.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc7a-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc7a72.495e-14143.00solute carrier family 7 member 7 [Source:NCBI gene... [more]
slc7a53.835e-13946.17solute carrier family 7 member 5 [Source:NCBI gene... [more]
si:dkeyp-120h9.15.203e-13141.19Y+L amino acid transporter 2 [Source:NCBI gene;Acc... [more]
slc7a66.234e-13142.86Y+L amino acid transporter 2 [Source:NCBI gene;Acc... [more]
ENSORLT00000010682.25.470e-12840.55Y+L amino acid transporter 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of slc7a-9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025359.10.000e+099.18SMESG000025359.1[more]
SMESG000044247.10.000e+063.19SMESG000044247.1[more]
SMESG000051755.10.000e+058.91SMESG000051755.1[more]
SMESG000017104.15.321e-10836.11SMESG000017104.1[more]
SMESG000006721.11.712e-10539.46SMESG000006721.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012513
GenBankAKN21453.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012513 ID=SMED30012513|Name=slc7a-9|organism=Schmidtea mediterranea sexual|type=transcript|length=1563bp
GTTTAAGTGCAACAATTTAAATATTCAAGTAAATGTTATTAATTTAAATT
AATCATAAAATGGCTGAATCTTCTAAAAGGGGTGATGTAAAGAGTAGCAA
TGGTGAAGTTGTAAAAACTATTGATCTAAAGAAAACTATTACACTACTGA
ATGGCGTTACAATCATTGTTGGTAGCATGATTGGGTCTGGGATTTTTATA
AGTCCAACTGGTGTCTATTTAAAAACTGGAAGCAGTGCATCATCTATATT
AATATGGTTACTTTGTGGAATATACACAATGATTGGAGCATACTGTTACG
CGGAGTTAGGATGTTTAATTAAGCGATCGGCTGGTGATTATGCATATGTT
TATGAAGCATTTGGTCCATTGGTGGCGTTTATCAGAATGTGGATTGATGT
TATAGTAACTAGACCGTGTAATGTTGCAATTATATCTCTTACGTTTGCTC
AATACGTCTTAGAACCAATATATTATATGTGTAATCAACCTCCAATTGCT
AGGCAATTATTGGCAGCAGCTTGTATTTTGATTATAACGTTTGTCAATTG
TTGGTCAGTAAAGGCATCAACAAGAGTTCAGGATATTTGCACCTATGCCA
AGGTTAGTGCTCTAATAATCATTATAATGACAGGAATCGTCAAACTTGGA
ATGGGTTACACAATCAATTGGGAGTCGCCATTTGAAGGAACGACAACGAA
TGCCGGAGATATGACTATGGCTTTTTACACCGGTTTGTTTGCCTATACCG
GTTGGAGTTATTTGAATTGCATGGTTGAGGAAATGAAGGATCCGGTAAAA
GATATGCCTCGAGCTATATTTATTTCCTGTGGACTTGTAACCCTTATCTA
TGTCTTGGCTAATGTGTCTTATTTCACCATTCTGTCCAAATCTGAAATCT
TCGAATCAAACGCCTTGGCTGTGAGGGTAGGATACCAAATGTACGGTGTT
ATGTGGTGGATTATTCCTCTTTTTGTCGCTTTGTCAACTTTTGGTGGTGT
TAATGGAACCATTTTAACGACTTCCAGAATATTTTTGGTCGCTGCTCAAA
TTGACCAAATGCCGAAGTGCCTTGCTATGATCAATACAAAATTCAGCACA
CCAATTCCATCAGTTTTGTTTGTTGCAATCGTATCTCTGGGCTATTTGTT
GTTTCCCGATATTTTCACCCTAATGAATTATGTTGGATTTGTCACCTGGT
TGACGTTTGGACTTGCTGTTCTCAGTTTGATTTATTTCAGAATTAAGTGG
AAGAAAGTAGAACGACCGATAAGAGTGAACATCGTATTTCCAATAATCTA
TTTGGCTGTGACTGTGTTTCTGATAATATTCGCATTCATTGGAGGCCCGT
TTGAATCCATGATGGGCACCTTGATTATGATGTCTGCTATCCCGGTCTAT
TGGATTTGTGTTTTATGGAAGCGAAAGCCGAAACCATTCAATCGAATGCT
GGAATCAATTAACATCGGTGTGCAGAAAATGTTCCTGGTTATCTTGCCGG
CTATGCCGGAGAAAGCCATGTAAATTTTTGATGGAAAAAAATATATATAC
TTTTTACTAAAAA
back to top

protein sequence of SMED30012513-orf-1

>SMED30012513-orf-1 ID=SMED30012513-orf-1|Name=SMED30012513-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=488bp
MAESSKRGDVKSSNGEVVKTIDLKKTITLLNGVTIIVGSMIGSGIFISPT
GVYLKTGSSASSILIWLLCGIYTMIGAYCYAELGCLIKRSAGDYAYVYEA
FGPLVAFIRMWIDVIVTRPCNVAIISLTFAQYVLEPIYYMCNQPPIARQL
LAAACILIITFVNCWSVKASTRVQDICTYAKVSALIIIIMTGIVKLGMGY
TINWESPFEGTTTNAGDMTMAFYTGLFAYTGWSYLNCMVEEMKDPVKDMP
RAIFISCGLVTLIYVLANVSYFTILSKSEIFESNALAVRVGYQMYGVMWW
IIPLFVALSTFGGVNGTILTTSRIFLVAAQIDQMPKCLAMINTKFSTPIP
SVLFVAIVSLGYLLFPDIFTLMNYVGFVTWLTFGLAVLSLIYFRIKWKKV
ERPIRVNIVFPIIYLAVTVFLIIFAFIGGPFESMMGTLIMMSAIPVYWIC
VLWKRKPKPFNRMLESINIGVQKMFLVILPAMPEKAM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0015171amino acid transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0003333amino acid transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002293AA/rel_permease1
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002293Amino acid/polyamine transporter IPFAMPF13520AA_permease_2coord: 28..430
e-value: 1.3E-58
score: 198.8
IPR002293Amino acid/polyamine transporter IPIRSFPIRSF006060AA_transportercoord: 7..474
e-value: 2.2E-71
score: 238.0
NoneNo IPR availableGENE3DG3DSA:1.20.1740.10coord: 22..474
e-value: 6.0E-90
score: 304.0
NoneNo IPR availablePANTHERPTHR11785AMINO ACID TRANSPORTERcoord: 16..479
NoneNo IPR availablePANTHERPTHR11785:SF389LD25378Pcoord: 16..479
NoneNo IPR availableTMHMMTMhelixcoord: 371..393
NoneNo IPR availableTMHMMTMhelixcoord: 339..361
NoneNo IPR availableTMHMMTMhelixcoord: 433..452
NoneNo IPR availableTMHMMTMhelixcoord: 406..428
NoneNo IPR availableTMHMMTMhelixcoord: 252..274
NoneNo IPR availableTMHMMTMhelixcoord: 59..81
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 297..319
NoneNo IPR availableTMHMMTMhelixcoord: 217..239
NoneNo IPR availableTMHMMTMhelixcoord: 94..112
NoneNo IPR availableTMHMMTMhelixcoord: 145..167