PPFIA binding protein 1b

Overview
NamePPFIA binding protein 1b
Smed IDSMED30012475
Length (bp)2560
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PPFIA binding protein 1b (SMED30012475) t-SNE clustered cells

Violin plots show distribution of expression levels for PPFIA binding protein 1b (SMED30012475) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PPFIA binding protein 1b (SMED30012475) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PPFIA binding protein 1b (SMED30012475) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012475

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30012475SMESG000054431.1 dd_Smed_v4_7610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012475SMESG000054431.1 dd_Smed_v4_7610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012475SMESG000054431.1 dd_Smed_v4_7610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012475SMESG000054431.1 dd_Smed_v4_7610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PPFIA binding protein 1b vs. Ensembl Human
Match: PPFIBP1 (PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9249])

HSP 1 Score: 213.001 bits (541), Expect = 3.547e-57
Identity = 143/366 (39.07%), Postives = 204/366 (55.74%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2285
            S  +F R    R TAGPRL    +  +   D    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK   E  EE + P
Sbjct:  457 SEPEFKRGG-TRATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSNFGNLRKKKQEDGEEYVCP 774          
BLAST of PPFIA binding protein 1b vs. Ensembl Human
Match: PPFIBP1 (PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9249])

HSP 1 Score: 214.157 bits (544), Expect = 3.820e-57
Identity = 143/366 (39.07%), Postives = 204/366 (55.74%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2285
            S  +F R    R TAGPRL    +  +   D    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK   E  EE + P
Sbjct:  604 SEPEFKRGG-TRATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSNFGNLRKKKQEDGEEYVCP 921          
BLAST of PPFIA binding protein 1b vs. Ensembl Human
Match: PPFIBP1 (PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9249])

HSP 1 Score: 212.616 bits (540), Expect = 1.185e-56
Identity = 143/366 (39.07%), Postives = 204/366 (55.74%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2285
            S  +F R    R TAGPRL    +  +   D    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK   E  EE + P
Sbjct:  610 SEPEFKRGG-TRATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSNFGNLRKKKQEDGEEYVCP 927          
BLAST of PPFIA binding protein 1b vs. Ensembl Human
Match: PPFIBP1 (PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9249])

HSP 1 Score: 212.616 bits (540), Expect = 1.231e-56
Identity = 143/366 (39.07%), Postives = 204/366 (55.74%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2285
            S  +F R    R TAGPRL    +  +   D    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK   E  EE + P
Sbjct:  579 SEPEFKRGG-TRATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSNFGNLRKKKQEDGEEYVCP 896          
BLAST of PPFIA binding protein 1b vs. Ensembl Human
Match: PPFIBP1 (PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HGNC:9249])

HSP 1 Score: 207.994 bits (528), Expect = 4.842e-56
Identity = 137/348 (39.37%), Postives = 197/348 (56.61%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFN 2234
            S  +F R    R TAGPRL    +  +   D    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N
Sbjct:  441 SEPEFKRGG-TRATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSN 740          
BLAST of PPFIA binding protein 1b vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 148.673 bits (374), Expect = 4.799e-37
Identity = 119/398 (29.90%), Postives = 189/398 (47.49%), Query Frame = 3
Query: 1197 AENSSSQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNET---SEELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2366
            +++ S+ F R +  R T+  RL     L   +K  P   F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+                  I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  293 SQDQSNSFRRGSAARSTSTARLGSTNHLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALM------------------IYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 639          
BLAST of PPFIA binding protein 1b vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 148.288 bits (373), Expect = 8.671e-37
Identity = 119/398 (29.90%), Postives = 189/398 (47.49%), Query Frame = 3
Query: 1197 AENSSSQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNET---SEELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2366
            +++ S+ F R +  R T+  RL     L   +K  P   F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+                  I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  335 SQDQSNSFRRGSAARSTSTARLGSTNHLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALM------------------IYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 681          
BLAST of PPFIA binding protein 1b vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 149.443 bits (376), Expect = 9.220e-37
Identity = 119/398 (29.90%), Postives = 189/398 (47.49%), Query Frame = 3
Query: 1197 AENSSSQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNET---SEELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2366
            +++ S+ F R +  R T+  RL     L   +K  P   F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+                  I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  567 SQDQSNSFRRGSAARSTSTARLGSTNHLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALM------------------IYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 913          
BLAST of PPFIA binding protein 1b vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 149.443 bits (376), Expect = 9.220e-37
Identity = 119/398 (29.90%), Postives = 189/398 (47.49%), Query Frame = 3
Query: 1197 AENSSSQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNET---SEELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2366
            +++ S+ F R +  R T+  RL     L   +K  P   F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+                  I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  567 SQDQSNSFRRGSAARSTSTARLGSTNHLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALM------------------IYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 913          
BLAST of PPFIA binding protein 1b vs. Ensembl Celegans
Match: hlb-1 (Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q94071])

HSP 1 Score: 149.443 bits (376), Expect = 9.924e-37
Identity = 119/398 (29.90%), Postives = 189/398 (47.49%), Query Frame = 3
Query: 1197 AENSSSQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNET---SEELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2366
            +++ S+ F R +  R T+  RL     L   +K  P   F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+                  I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  525 SQDQSNSFRRGSAARSTSTARLGSTNHLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALM------------------IYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 871          
BLAST of PPFIA binding protein 1b vs. Ensembl Fly
Match: Liprin-beta (gene:FBgn0036376 transcript:FBtr0075814)

HSP 1 Score: 186.037 bits (471), Expect = 3.458e-49
Identity = 130/369 (35.23%), Postives = 194/369 (52.57%), Query Frame = 3
Query: 1194 AAENSSSQFNRNNPLRMTAGPRL-------LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTN--GLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSE-TGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSE 2270
            A E +  +F R    R TAG R+       L G N+      +  W    VC +L  +GLG Y +NCRKWL     + F  AS  +IE+ELN+   LH KK+L     L    +T   +  LT     +   +  R WLDDIGL  Y   F    IDG ML ++TLEDL  L +++ LH+ SL+ GI  +R + ++   LIRR  +     ++  T    N+E+           WT H++M WL+ I+L EY  N+RG+G+HGAL+                  + E RFNA+ LA +L+IP ++SLLRRHL   F+EL+G  ++  K+ A     + P++IT+K+K   K++ F++ +RK+S   S+
Sbjct:  320 ALEQAEPEFRRGGA-RATAGGRIEWSAQTPLFGENE----KHWTTWGAQEVCNWLAYMGLGCYEDNCRKWLNANPSVSFFTASPVDIERELNLKMPLHRKKIL-----LAIDDLTGKEFDDLTLKASSLDVTWVLR-WLDDIGLPQYKDYFMQAKIDGRMLHRLTLEDLSQLHVSSCLHIASLRAGILCMRRLSWNAEGLIRRSIKVVSEDEAAATPDRDNVEL-----------WTAHRIMGWLQTIDLSEYTPNLRGAGVHGALM------------------LYEPRFNADLLADLLSIPPSKSLLRRHLAMHFKELVGRPVILSKRDAESAPGYQPLSITAKLK-PVKRTQFSLKRRKSSKSQSD 647          
BLAST of PPFIA binding protein 1b vs. Ensembl Fly
Match: Liprin-beta (gene:FBgn0036376 transcript:FBtr0075813)

HSP 1 Score: 186.037 bits (471), Expect = 3.458e-49
Identity = 130/369 (35.23%), Postives = 194/369 (52.57%), Query Frame = 3
Query: 1194 AAENSSSQFNRNNPLRMTAGPRL-------LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTN--GLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSE-TGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSE 2270
            A E +  +F R    R TAG R+       L G N+      +  W    VC +L  +GLG Y +NCRKWL     + F  AS  +IE+ELN+   LH KK+L     L    +T   +  LT     +   +  R WLDDIGL  Y   F    IDG ML ++TLEDL  L +++ LH+ SL+ GI  +R + ++   LIRR  +     ++  T    N+E+           WT H++M WL+ I+L EY  N+RG+G+HGAL+                  + E RFNA+ LA +L+IP ++SLLRRHL   F+EL+G  ++  K+ A     + P++IT+K+K   K++ F++ +RK+S   S+
Sbjct:  320 ALEQAEPEFRRGGA-RATAGGRIEWSAQTPLFGENE----KHWTTWGAQEVCNWLAYMGLGCYEDNCRKWLNANPSVSFFTASPVDIERELNLKMPLHRKKIL-----LAIDDLTGKEFDDLTLKASSLDVTWVLR-WLDDIGLPQYKDYFMQAKIDGRMLHRLTLEDLSQLHVSSCLHIASLRAGILCMRRLSWNAEGLIRRSIKVVSEDEAAATPDRDNVEL-----------WTAHRIMGWLQTIDLSEYTPNLRGAGVHGALM------------------LYEPRFNADLLADLLSIPPSKSLLRRHLAMHFKELVGRPVILSKRDAESAPGYQPLSITAKLK-PVKRTQFSLKRRKSSKSQSD 647          
BLAST of PPFIA binding protein 1b vs. Ensembl Fly
Match: Liprin-beta (gene:FBgn0036376 transcript:FBtr0330342)

HSP 1 Score: 186.037 bits (471), Expect = 3.458e-49
Identity = 130/369 (35.23%), Postives = 194/369 (52.57%), Query Frame = 3
Query: 1194 AAENSSSQFNRNNPLRMTAGPRL-------LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTN--GLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSE-TGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSE 2270
            A E +  +F R    R TAG R+       L G N+      +  W    VC +L  +GLG Y +NCRKWL     + F  AS  +IE+ELN+   LH KK+L     L    +T   +  LT     +   +  R WLDDIGL  Y   F    IDG ML ++TLEDL  L +++ LH+ SL+ GI  +R + ++   LIRR  +     ++  T    N+E+           WT H++M WL+ I+L EY  N+RG+G+HGAL+                  + E RFNA+ LA +L+IP ++SLLRRHL   F+EL+G  ++  K+ A     + P++IT+K+K   K++ F++ +RK+S   S+
Sbjct:  320 ALEQAEPEFRRGGA-RATAGGRIEWSAQTPLFGENE----KHWTTWGAQEVCNWLAYMGLGCYEDNCRKWLNANPSVSFFTASPVDIERELNLKMPLHRKKIL-----LAIDDLTGKEFDDLTLKASSLDVTWVLR-WLDDIGLPQYKDYFMQAKIDGRMLHRLTLEDLSQLHVSSCLHIASLRAGILCMRRLSWNAEGLIRRSIKVVSEDEAAATPDRDNVEL-----------WTAHRIMGWLQTIDLSEYTPNLRGAGVHGALM------------------LYEPRFNADLLADLLSIPPSKSLLRRHLAMHFKELVGRPVILSKRDAESAPGYQPLSITAKLK-PVKRTQFSLKRRKSSKSQSD 647          
BLAST of PPFIA binding protein 1b vs. Ensembl Fly
Match: Liprin-gamma (gene:FBgn0034720 transcript:FBtr0342990)

HSP 1 Score: 105.145 bits (261), Expect = 1.298e-22
Identity = 61/184 (33.15%), Postives = 93/184 (50.54%), Query Frame = 3
Query: 1578 WLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQH-LKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELI 2126
            WL DIGL  Y   F  + +D  MLD ++ ++L+  L +T + H  S+  GI +LR + YD   L  R        QSET          +  P     WT  + + W+R I+L EYA N++ SG+HG L+V                  LE  F+ +++A+ L IP +++++RRHL T+F  LI
Sbjct:  736 WLPDIGLPQYAEPFVQSLVDARMLDTLSKKELEKFLGVTRKFHQASIVHGIHVLRIVKYDRQTLAMR------RVQSET---------VDTDP---IVWTNQRFIRWVRSIDLGEYADNLKDSGVHGGLVV------------------LEPSFSGDTMATALGIPPSKNIIRRHLNTEFDALI 883          
BLAST of PPFIA binding protein 1b vs. Ensembl Fly
Match: Liprin-gamma (gene:FBgn0034720 transcript:FBtr0113106)

HSP 1 Score: 104.76 bits (260), Expect = 1.592e-22
Identity = 61/184 (33.15%), Postives = 93/184 (50.54%), Query Frame = 3
Query: 1578 WLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQH-LKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELI 2126
            WL DIGL  Y   F  + +D  MLD ++ ++L+  L +T + H  S+  GI +LR + YD   L  R        QSET          +  P     WT  + + W+R I+L EYA N++ SG+HG L+V                  LE  F+ +++A+ L IP +++++RRHL T+F  LI
Sbjct:  806 WLPDIGLPQYAEPFVQSLVDARMLDTLSKKELEKFLGVTRKFHQASIVHGIHVLRIVKYDRQTLAMR------RVQSET---------VDTDP---IVWTNQRFIRWVRSIDLGEYADNLKDSGVHGGLVV------------------LEPSFSGDTMATALGIPPSKNIIRRHLNTEFDALI 953          
BLAST of PPFIA binding protein 1b vs. Ensembl Zebrafish
Match: ppfibp1a (PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-041210-298])

HSP 1 Score: 224.557 bits (571), Expect = 2.662e-61
Identity = 147/364 (40.38%), Postives = 204/364 (56.04%), Query Frame = 3
Query: 1215 QFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVP 2285
            +F R   +R TAGPRL     L   N  +    F  WSK+ VC +L + GLG Y N  ++W+ +G   ++AS+ + EKEL I + LH KKL + ++ L+S    A           K+  N+ T+ WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   YD + L RRP EN                  N  P E+C+WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG++   QK+  LEN D++ +T T+++K  R+ SF  F  ++RK   E  EE + P
Sbjct:  494 EFQRGG-VRATAGPRLGWSRDLQRSNNNELNSAFSRWSKEQVCEWLQEQGLGLYMNQAQQWIKSGHTLLKASQHDWEKELGIRHPLHRKKLQLALQSLSSEDGDAMG---------KLDYNWVTQ-WLDDIGLPQYKSQFDEGRVDGRMLHYMTVDDLLGLKVGSVLHHLSIKRAIQVLRLNGYDPNCLRRRPIEN------------------NATPAEICQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFHLLIGSEAQKQKQEYLENPDYTVLTATARVK-PRRLSFGSFGTLRRK-RQEDMEEYVCP 808          
BLAST of PPFIA binding protein 1b vs. Ensembl Zebrafish
Match: ppfibp1a (PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-041210-298])

HSP 1 Score: 224.172 bits (570), Expect = 2.686e-61
Identity = 150/381 (39.37%), Postives = 212/381 (55.64%), Query Frame = 3
Query: 1215 QFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETS 2336
            +F R   +R TAGPRL     L   N  +    F  WSK+ VC +L + GLG Y N  ++W+ +G   ++AS+ + EKEL I + LH KKL + ++ L+S    A           K+  N+ T+ WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   YD + L RRP EN                  N  P E+C+WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG++   QK+  LEN D++ +T T+++K  R+ SF  F  ++RK   E  EE + P       +D+++ Q +S
Sbjct:  459 EFQRGG-VRATAGPRLGWSRDLQRSNNNELNSAFSRWSKEQVCEWLQEQGLGLYMNQAQQWIKSGHTLLKASQHDWEKELGIRHPLHRKKLQLALQSLSSEDGDAMG---------KLDYNWVTQ-WLDDIGLPQYKSQFDEGRVDGRMLHYMTVDDLLGLKVGSVLHHLSIKRAIQVLRLNGYDPNCLRRRPIEN------------------NATPAEICQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFHLLIGSEAQKQKQEYLENPDYTVLTATARVKP-RRLSFGSFGTLRRK-RQEDMEEYVCP-------MDVQMPQSSS 783          
BLAST of PPFIA binding protein 1b vs. Ensembl Zebrafish
Match: ppfibp1a (PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-041210-298])

HSP 1 Score: 224.557 bits (571), Expect = 2.956e-61
Identity = 150/381 (39.37%), Postives = 212/381 (55.64%), Query Frame = 3
Query: 1215 QFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETS 2336
            +F R   +R TAGPRL     L   N  +    F  WSK+ VC +L + GLG Y N  ++W+ +G   ++AS+ + EKEL I + LH KKL + ++ L+S    A           K+  N+ T+ WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   YD + L RRP EN                  N  P E+C+WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG++   QK+  LEN D++ +T T+++K  R+ SF  F  ++RK   E  EE + P       +D+++ Q +S
Sbjct:  494 EFQRGG-VRATAGPRLGWSRDLQRSNNNELNSAFSRWSKEQVCEWLQEQGLGLYMNQAQQWIKSGHTLLKASQHDWEKELGIRHPLHRKKLQLALQSLSSEDGDAMG---------KLDYNWVTQ-WLDDIGLPQYKSQFDEGRVDGRMLHYMTVDDLLGLKVGSVLHHLSIKRAIQVLRLNGYDPNCLRRRPIEN------------------NATPAEICQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFHLLIGSEAQKQKQEYLENPDYTVLTATARVKP-RRLSFGSFGTLRRK-RQEDMEEYVCP-------MDVQMPQSSS 818          
BLAST of PPFIA binding protein 1b vs. Ensembl Zebrafish
Match: ppfibp1a (PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-041210-298])

HSP 1 Score: 223.787 bits (569), Expect = 3.832e-61
Identity = 147/364 (40.38%), Postives = 204/364 (56.04%), Query Frame = 3
Query: 1215 QFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVP 2285
            +F R   +R TAGPRL     L   N  +    F  WSK+ VC +L + GLG Y N  ++W+ +G   ++AS+ + EKEL I + LH KKL + ++ L+S    A           K+  N+ T+ WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   YD + L RRP EN                  N  P E+C+WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG++   QK+  LEN D++ +T T+++K  R+ SF  F  ++RK   E  EE + P
Sbjct:  459 EFQRGG-VRATAGPRLGWSRDLQRSNNNELNSAFSRWSKEQVCEWLQEQGLGLYMNQAQQWIKSGHTLLKASQHDWEKELGIRHPLHRKKLQLALQSLSSEDGDAMG---------KLDYNWVTQ-WLDDIGLPQYKSQFDEGRVDGRMLHYMTVDDLLGLKVGSVLHHLSIKRAIQVLRLNGYDPNCLRRRPIEN------------------NATPAEICQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFHLLIGSEAQKQKQEYLENPDYTVLTATARVK-PRRLSFGSFGTLRRK-RQEDMEEYVCP 773          
BLAST of PPFIA binding protein 1b vs. Ensembl Zebrafish
Match: ppfibp1a (PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-041210-298])

HSP 1 Score: 219.935 bits (559), Expect = 3.002e-60
Identity = 143/357 (40.06%), Postives = 199/357 (55.74%), Query Frame = 3
Query: 1215 QFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSE 2270
            +F R   +R TAGPRL     L   N  +    F  WSK+ VC +L + GLG Y N  ++W+ +G   ++AS+ + EKEL I + LH KKL + ++ L+S    A           K+  N+ T+ WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   YD + L RRP EN                  N  P E+C+WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG++   QK+  LEN D++ +T T+++K  +K     VI++    ET E
Sbjct:  459 EFQRGG-VRATAGPRLGWSRDLQRSNNNELNSAFSRWSKEQVCEWLQEQGLGLYMNQAQQWIKSGHTLLKASQHDWEKELGIRHPLHRKKLQLALQSLSSEDGDAMG---------KLDYNWVTQ-WLDDIGLPQYKSQFDEGRVDGRMLHYMTVDDLLGLKVGSVLHHLSIKRAIQVLRLNGYDPNCLRRRPIEN------------------NATPAEICQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFHLLIGSEAQKQKQEYLENPDYTVLTATARVKAPKK----TVIRKFWDTETKE 764          
BLAST of PPFIA binding protein 1b vs. Ensembl Xenopus
Match: PPFIBP1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:NCBI gene;Acc:100493576])

HSP 1 Score: 202.986 bits (515), Expect = 9.865e-54
Identity = 131/336 (38.99%), Postives = 188/336 (55.95%), Query Frame = 3
Query: 1215 QFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMK 2207
            +F R    R TAGPRL     L   N    T  F  W+K+ VC +L + GLG Y  + ++W+ +G   + AS++++EKEL I + LH KKL + ++ L S     + Y        K+   + TR WLDDIGL  Y + F    IDG ML  + ++DL  LK+ + LH LS+KR IQ+LR  D++ + L RRP++ +                 N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ AL + ++  +T T+K+K
Sbjct:  532 EFKRGG-TRSTAGPRLGWSRDLGQVNSELDTP-FAKWTKEQVCLWLREQGLGGYVGSGKQWIVSGQTLLHASQQDLEKELGIKHPLHRKKLQLALQSLGSED--ESNYG-------KLDYRWVTR-WLDDIGLPQYKTQFDDAKIDGRMLHYLAVDDLLSLKVVSVLHHLSIKRAIQVLRINDFEANCLRRRPSDES-----------------NISPSEVAQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPSNKTLLRRHLATHFNLLIGQRAQIQKQEALASPEYVLLTATAKVK 820          
BLAST of PPFIA binding protein 1b vs. Ensembl Xenopus
Match: PPFIBP1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:NCBI gene;Acc:100493576])

HSP 1 Score: 203.371 bits (516), Expect = 1.092e-53
Identity = 131/336 (38.99%), Postives = 188/336 (55.95%), Query Frame = 3
Query: 1215 QFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMK 2207
            +F R    R TAGPRL     L   N    T  F  W+K+ VC +L + GLG Y  + ++W+ +G   + AS++++EKEL I + LH KKL + ++ L S     + Y        K+   + TR WLDDIGL  Y + F    IDG ML  + ++DL  LK+ + LH LS+KR IQ+LR  D++ + L RRP++ +                 N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ AL + ++  +T T+K+K
Sbjct:  617 EFKRGG-TRSTAGPRLGWSRDLGQVNSELDTP-FAKWTKEQVCLWLREQGLGGYVGSGKQWIVSGQTLLHASQQDLEKELGIKHPLHRKKLQLALQSLGSED--ESNYG-------KLDYRWVTR-WLDDIGLPQYKTQFDDAKIDGRMLHYLAVDDLLSLKVVSVLHHLSIKRAIQVLRINDFEANCLRRRPSDES-----------------NISPSEVAQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPSNKTLLRRHLATHFNLLIGQRAQIQKQEALASPEYVLLTATAKVK 905          
BLAST of PPFIA binding protein 1b vs. Ensembl Xenopus
Match: PPFIBP1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:NCBI gene;Acc:100493576])

HSP 1 Score: 202.601 bits (514), Expect = 1.264e-53
Identity = 130/336 (38.69%), Postives = 187/336 (55.65%), Query Frame = 3
Query: 1215 QFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMK 2207
            +F R    R TAGPRL     L   N    T  F  W+K+ VC +L + GLG Y  + ++W+ +G   + AS++++EKEL I + LH KKL + ++ L S   +            K+   + TR WLDDIGL  Y + F    IDG ML  + ++DL  LK+ + LH LS+KR IQ+LR  D++ + L RRP++ +                 N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ AL + ++  +T T+K+K
Sbjct:  522 EFKRGG-TRSTAGPRLGWSRDLGQVNSELDTP-FAKWTKEQVCLWLREQGLGGYVGSGKQWIVSGQTLLHASQQDLEKELGIKHPLHRKKLQLALQSLGSEDESNYG---------KLDYRWVTR-WLDDIGLPQYKTQFDDAKIDGRMLHYLAVDDLLSLKVVSVLHHLSIKRAIQVLRINDFEANCLRRRPSDES-----------------NISPSEVAQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPSNKTLLRRHLATHFNLLIGQRAQIQKQEALASPEYVLLTATAKVK 810          
BLAST of PPFIA binding protein 1b vs. Ensembl Xenopus
Match: PPFIBP1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:NCBI gene;Acc:100493576])

HSP 1 Score: 203.371 bits (516), Expect = 1.268e-53
Identity = 131/336 (38.99%), Postives = 188/336 (55.95%), Query Frame = 3
Query: 1215 QFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMK 2207
            +F R    R TAGPRL     L   N    T  F  W+K+ VC +L + GLG Y  + ++W+ +G   + AS++++EKEL I + LH KKL + ++ L S     + Y        K+   + TR WLDDIGL  Y + F    IDG ML  + ++DL  LK+ + LH LS+KR IQ+LR  D++ + L RRP++ +                 N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ AL + ++  +T T+K+K
Sbjct:  651 EFKRGG-TRSTAGPRLGWSRDLGQVNSELDTP-FAKWTKEQVCLWLREQGLGGYVGSGKQWIVSGQTLLHASQQDLEKELGIKHPLHRKKLQLALQSLGSED--ESNYG-------KLDYRWVTR-WLDDIGLPQYKTQFDDAKIDGRMLHYLAVDDLLSLKVVSVLHHLSIKRAIQVLRINDFEANCLRRRPSDES-----------------NISPSEVAQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPSNKTLLRRHLATHFNLLIGQRAQIQKQEALASPEYVLLTATAKVK 939          
BLAST of PPFIA binding protein 1b vs. Ensembl Xenopus
Match: PPFIBP1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:NCBI gene;Acc:100493576])

HSP 1 Score: 202.986 bits (515), Expect = 1.301e-53
Identity = 131/336 (38.99%), Postives = 188/336 (55.95%), Query Frame = 3
Query: 1215 QFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMK 2207
            +F R    R TAGPRL     L   N    T  F  W+K+ VC +L + GLG Y  + ++W+ +G   + AS++++EKEL I + LH KKL + ++ L S     + Y        K+   + TR WLDDIGL  Y + F    IDG ML  + ++DL  LK+ + LH LS+KR IQ+LR  D++ + L RRP++ +                 N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ AL + ++  +T T+K+K
Sbjct:  554 EFKRGG-TRSTAGPRLGWSRDLGQVNSELDTP-FAKWTKEQVCLWLREQGLGGYVGSGKQWIVSGQTLLHASQQDLEKELGIKHPLHRKKLQLALQSLGSED--ESNYG-------KLDYRWVTR-WLDDIGLPQYKTQFDDAKIDGRMLHYLAVDDLLSLKVVSVLHHLSIKRAIQVLRINDFEANCLRRRPSDES-----------------NISPSEVAQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPSNKTLLRRHLATHFNLLIGQRAQIQKQEALASPEYVLLTATAKVK 842          
BLAST of PPFIA binding protein 1b vs. Ensembl Mouse
Match: Ppfibp1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:MGI Symbol;Acc:MGI:1914783])

HSP 1 Score: 209.534 bits (532), Expect = 6.882e-56
Identity = 139/365 (38.08%), Postives = 205/365 (56.16%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2285
            S  +F R    R TAGPRL    +  +   D    F  W+K+ VC++L + GLG+Y ++ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP++                   ++ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK  +E  EE + P
Sbjct:  569 SEPEFKRGGT-RATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNYG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDEN-----------------SITPSEVQQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLTFSNFGNLRKKKHEDGEEYVCP 886          
BLAST of PPFIA binding protein 1b vs. Ensembl Mouse
Match: Ppfibp1 (PTPRF interacting protein, binding protein 1 (liprin beta 1) [Source:MGI Symbol;Acc:MGI:1914783])

HSP 1 Score: 209.534 bits (532), Expect = 7.807e-56
Identity = 139/365 (38.08%), Postives = 205/365 (56.16%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2285
            S  +F R    R TAGPRL    +  +   D    F  W+K+ VC++L + GLG+Y ++ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP++                   ++ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK  +E  EE + P
Sbjct:  580 SEPEFKRGGT-RATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNYG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDEN-----------------SITPSEVQQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLTFSNFGNLRKKKHEDGEEYVCP 897          
BLAST of PPFIA binding protein 1b vs. Ensembl Mouse
Match: Ppfibp2 (PTPRF interacting protein, binding protein 2 (liprin beta 2) [Source:MGI Symbol;Acc:MGI:894649])

HSP 1 Score: 196.823 bits (499), Expect = 8.137e-52
Identity = 128/362 (35.36%), Postives = 196/362 (54.14%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRLL----AGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAAT---YFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSE 2270
            ++F R   LR TAGPRL       G K      F  WS + VC ++   GLG Y    R+W+T+G   + A+ +++EKEL I + LH KKL++ ++ + +     +    +  +TR             WLDDIGL  Y   F  + +DG ML  +T+ DL  LK+T++LH LS+K  I +L    ++ + L RRPA+ +                 N+ P EV +W+ H+VMEWLR ++L EYA N+RGSG+HG LI                  ILE RF  ++LA +LNIP  ++LLRRHL TKF  LIG +   +K+  + +  ++P+T T+K++  RK  F  F  +++K  +E+++
Sbjct:  529 AEFRRGG-LRATAGPRLSRTRDTKGQKCDANAPFAQWSTERVCTWMEDFGLGQYVIFARQWVTSGHTLLTATPQDMEKELGIKHPLHRKKLVLAVKAINAKQEETSALLDHIWVTR-------------WLDDIGLPQYKDQFHESRVDGRMLQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPNCLHRRPADES-----------------NLSPSEVVQWSNHRVMEWLRSVDLAEYAPNLRGSGVHGGLI------------------ILEPRFTGDTLAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKRDKMASPAYTPLTTTAKVR-PRKLGFSHFGNMRKKKFDESTD 840          
BLAST of PPFIA binding protein 1b vs. Ensembl Mouse
Match: Ppfibp2 (PTPRF interacting protein, binding protein 2 (liprin beta 2) [Source:MGI Symbol;Acc:MGI:894649])

HSP 1 Score: 196.823 bits (499), Expect = 8.856e-52
Identity = 128/362 (35.36%), Postives = 196/362 (54.14%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRLL----AGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAAT---YFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSE 2270
            ++F R   LR TAGPRL       G K      F  WS + VC ++   GLG Y    R+W+T+G   + A+ +++EKEL I + LH KKL++ ++ + +     +    +  +TR             WLDDIGL  Y   F  + +DG ML  +T+ DL  LK+T++LH LS+K  I +L    ++ + L RRPA+ +                 N+ P EV +W+ H+VMEWLR ++L EYA N+RGSG+HG LI                  ILE RF  ++LA +LNIP  ++LLRRHL TKF  LIG +   +K+  + +  ++P+T T+K++  RK  F  F  +++K  +E+++
Sbjct:  518 AEFRRGG-LRATAGPRLSRTRDTKGQKCDANAPFAQWSTERVCTWMEDFGLGQYVIFARQWVTSGHTLLTATPQDMEKELGIKHPLHRKKLVLAVKAINAKQEETSALLDHIWVTR-------------WLDDIGLPQYKDQFHESRVDGRMLQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPNCLHRRPADES-----------------NLSPSEVVQWSNHRVMEWLRSVDLAEYAPNLRGSGVHGGLI------------------ILEPRFTGDTLAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKRDKMASPAYTPLTTTAKVRP-RKLGFSHFGNMRKKKFDESTD 829          
BLAST of PPFIA binding protein 1b vs. Ensembl Mouse
Match: Kazn (kazrin, periplakin interacting protein [Source:MGI Symbol;Acc:MGI:1918779])

HSP 1 Score: 102.064 bits (253), Expect = 1.036e-21
Identity = 57/182 (31.32%), Postives = 92/182 (50.55%), Query Frame = 3
Query: 1560 NFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQ-HLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHL 2102
            ++  + WL+DIGL  Y   F ++ +DG ML+ +   DL+ HL ++ + H +S+  GI+LL ++++    L  R A                   C     +   WT  +V++W+R I+L EYA N+  SG+HGA++V                  LE  FNA ++A+ L IP  + +LRRHL
Sbjct:  450 HWVAKAWLNDIGLSQYSQAFQNHLVDGRMLNSLMKRDLEKHLNVSKKFHQVSILLGIELLYQVNFSREALQERRAR------------------CETQNTDPVVWTNQRVLKWVRDIDLKEYADNLTNSGVHGAVLV------------------LEPTFNAEAMATALGIPSGKHILRRHL 595          
BLAST of PPFIA binding protein 1b vs. UniProt/SwissProt
Match: sp|Q86W92|LIPB1_HUMAN (Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 5.691e-56
Identity = 143/366 (39.07%), Postives = 204/366 (55.74%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPA-ENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2285
            S  +F R    R TAGPRL    +  +   D    F  W+K+ VC +L + GLG+Y N+ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP+ ENT                  + P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK   E  EE + P
Sbjct:  610 SEPEFKRGG-TRATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCNWLMEQGLGSYLNSGKHWIASGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNHG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENT------------------IAPSEVQKWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLAFSNFGNLRKKKQEDGEEYVCP 927          
BLAST of PPFIA binding protein 1b vs. UniProt/SwissProt
Match: sp|Q8C8U0|LIPB1_MOUSE (Liprin-beta-1 OS=Mus musculus OX=10090 GN=Ppfibp1 PE=1 SV=3)

HSP 1 Score: 209.534 bits (532), Expect = 4.814e-55
Identity = 139/365 (38.08%), Postives = 205/365 (56.16%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2285
            S  +F R    R TAGPRL    +  +   D    F  W+K+ VC++L + GLG+Y ++ + W+ +G   ++AS++++EKEL I + LH KKL + ++ L S   T            K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +++ + L RRP++                   ++ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +   QK+ A+E  D+  +T T+K+K  +K +F N    RK  +E  EE + P
Sbjct:  569 SEPEFKRGGT-RATAGPRLGWSRDLGQSNSDLDMPFAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNYG---------KLDFNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDEN-----------------SITPSEVQQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLLTATAKVK-PKKLTFSNFGNLRKKKHEDGEEYVCP 886          
BLAST of PPFIA binding protein 1b vs. UniProt/SwissProt
Match: sp|O35711|LIPB2_MOUSE (Liprin-beta-2 OS=Mus musculus OX=10090 GN=Ppfibp2 PE=1 SV=3)

HSP 1 Score: 196.438 bits (498), Expect = 6.359e-51
Identity = 128/362 (35.36%), Postives = 196/362 (54.14%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRLL----AGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAAT---YFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSE 2270
            ++F R   LR TAGPRL       G K      F  WS + VC ++   GLG Y    R+W+T+G   + A+ +++EKEL I + LH KKL++ ++ + +     +    +  +TR             WLDDIGL  Y   F  + +DG ML  +T+ DL  LK+T++LH LS+K  I +L    ++ + L RRPA+ +                 N+ P EV +W+ H+VMEWLR ++L EYA N+RGSG+HG LI                  ILE RF  ++LA +LNIP  ++LLRRHL TKF  LIG +   +K+  + +  ++P+T T+K++  RK  F  F  +++K  +E+++
Sbjct:  529 AEFRRGG-LRATAGPRLSRTRDTKGQKCDANAPFAQWSTERVCTWMEDFGLGQYVIFARQWVTSGHTLLTATPQDMEKELGIKHPLHRKKLVLAVKAINAKQEETSALLDHIWVTR-------------WLDDIGLPQYKDQFHESRVDGRMLQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPNCLHRRPADES-----------------NLSPSEVVQWSNHRVMEWLRSVDLAEYAPNLRGSGVHGGLI------------------ILEPRFTGDTLAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKRDKMASPAYTPLTTTAKVR-PRKLGFSHFGNMRKKKFDESTD 840          
BLAST of PPFIA binding protein 1b vs. UniProt/SwissProt
Match: sp|Q8ND30|LIPB2_HUMAN (Liprin-beta-2 OS=Homo sapiens OX=9606 GN=PPFIBP2 PE=1 SV=3)

HSP 1 Score: 193.356 bits (490), Expect = 6.478e-50
Identity = 128/362 (35.36%), Postives = 195/362 (53.87%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRLL----AGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAAT---YFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSE 2270
            ++F R   LR TAGPRL     + G K      F  WS + VCA+L   GL  Y    R+W+++G   + A+ +++EKEL I + LH KKL++ ++ + +     +    +  +TR             WLDDIGL  Y   F  + +D  ML  +T+ DL  LK+T++LH LS+K  I +L    ++   L RRPA+ +                 N+ P EV +W+ H+VMEWLR ++L EYA N+RGSG+HG LI                  ILE RF  ++LA +LNIP  ++LLRRHL TKF  LIG +   +K+  + +  ++P+T T+K++  RK  F  F  I++K  +E+++
Sbjct:  523 AEFRRGG-LRATAGPRLSRTRDSKGQKSDANAPFAQWSTERVCAWLEDFGLAQYVIFARQWVSSGHTLLTATPQDMEKELGIKHPLHRKKLVLAVKAINTKQEEKSALLDHIWVTR-------------WLDDIGLPQYKDQFHESRVDRRMLQYLTVNDLLFLKVTSQLHHLSIKCAIHVLHVNKFNPHCLHRRPADES-----------------NLSPSEVVQWSNHRVMEWLRSVDLAEYAPNLRGSGVHGGLI------------------ILEPRFTGDTLAMLLNIPPQKTLLRRHLTTKFNALIGPEAEQEKREKMASPAYTPLTTTAKVR-PRKLGFSHFGNIRKKKFDESTD 834          
BLAST of PPFIA binding protein 1b vs. UniProt/SwissProt
Match: sp|Q94071|LIPB_CAEEL (Liprin-beta homolog OS=Caenorhabditis elegans OX=6239 GN=hlb-1 PE=2 SV=5)

HSP 1 Score: 148.288 bits (373), Expect = 3.223e-35
Identity = 119/398 (29.90%), Postives = 189/398 (47.49%), Query Frame = 3
Query: 1197 AENSSSQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNET---SEELLVPYTYKIEDLDLKLNQETSSVDNNNAESS 2366
            +++ S+ F R +  R T+  RL     L   +K  P   F  W  + +  ++ +IG   Y N   + + +G  F+  S  E E  LNI N +H K++ I +R++            +  P  K   + T R WLDDIGL  Y  +FA N +DG +L  +T  D   +K+ N  H  +L R IQ L++ D+  + + +   +N              +  C   P  V RWT     EWLR+I+L E+  N+  +G+ GAL+                  I E  F A SLA +L +P +++LLRRHL + F +L+G KI+A K+  L   ++  ++ T ++K  +K   F++ ++K  NE     EELL P         L     T + DN++ ESS
Sbjct:  656 SQDQSNSFRRGSAARSTSTARLGSTNHLGTVSKRPPLSQFVDWRSEQLADWIAEIGYPQYMNEVSRHVRSGRHFLNMSMNEYEGVLNIKNPVHRKRVAILLRRIEE---------DIMEPANKWDVHQTLR-WLDDIGLPQYKDVFAENVVDGPLLLSLTANDAVEMKVVNAHHYATLARSIQFLKKADFRFNAMEKLIDQNIVE-----------KYPC---PDVVVRWTHSATCEWLRKIDLAEFTQNLLFAGVPGALM------------------IYEPSFTAESLAEILQMPPHKTLLRRHLTSHFNQLLGPKIIADKRDFLAAGNYPQISPTGRVKVVKKG--FSLTRKKAKNEICLEPEELLCPQV-------LVHKYPTGAGDNSSFESS 1002          
BLAST of PPFIA binding protein 1b vs. TrEMBL
Match: A0A2I4AZL7 (liprin-beta-1 OS=Austrofundulus limnaeus OX=52670 GN=ppfibp1 PE=4 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 2.202e-60
Identity = 146/368 (39.67%), Postives = 208/368 (56.52%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVPYTYKI 2300
             +F R   +R TAGPRL    +  +  ++    F  WSKD VC +L + GLG YAN  R W+++G   ++AS++++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +YD + L RRP++                   N+ P E+ +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K  RK SF N    RK   E +EE + P   ++
Sbjct:   85 GEFKRGG-VRATAGPRLGWSRDLQRVNNEVDAPFARWSKDQVCGWLQEQGLGLYANLARVWISSGQTLLQASQQDLEKELGIKHPLHRKKLQLALQALGSEE---------DDNKGKLDYNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNNYDPNCLRRRPSDEN-----------------NISPAEISQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFSLLIGSEAQQLKQECLENPDYTLLTATTKVK-PRKLSFGNFGNLRKKKQEENEEYVCPMDVEM 405          
BLAST of PPFIA binding protein 1b vs. TrEMBL
Match: A0A1A7YVJ3 (PTPRF interacting protein, binding protein 1 (Liprin beta 1) OS=Iconisemion striatum OX=60296 GN=PPFIBP1 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 3.661e-59
Identity = 143/363 (39.39%), Postives = 204/363 (56.20%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK-RKTSNETSEELLVP 2285
             +F R   +R TAGPRL    +  +  ++    F  WSKD VC +L + GLG Y N  R W+++G   ++AS++++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +YD + L RRP++                   N+ P E+ +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K  RK  F N    RK   + +EE + P
Sbjct:   51 GEFKRGG-VRATAGPRLGWSRDLQRVNNEVDAPFARWSKDQVCDWLQEQGLGLYMNMARVWISSGQTLLQASQQDLEKELGIKHPLHRKKLQLALQALGSEEEDN---------KGKLDYNWVTR-WLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNNYDPNCLRRRPSDEN-----------------NISPAEISQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMAQLLNIPPNKTLLRRHLATHFGLLIGSEAQQLKQECLENPDYTLLTATTKVK-PRKLPFGNFGSLRKKKQDENEEYVCP 366          
BLAST of PPFIA binding protein 1b vs. TrEMBL
Match: A0A3Q4GXP0 (PPFIA binding protein 1a OS=Neolamprologus brichardi OX=32507 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.363e-58
Identity = 143/358 (39.94%), Postives = 202/358 (56.42%), Query Frame = 3
Query: 1224 RNNPLRMTAGPRLLAGGNKLKPTDD--FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVP 2285
            R   +R TAGPRL    +  +   D  F  WSK+ VCA+LH+ GLG Y    + W+ +G   ++AS+ ++EKEL + + LH KKL + ++ + S              K K+  N+ TR WLDDIGL  Y S F    IDG  L  +T+EDL  LK+ + LH LS+KR IQ+LR   YD + L RRP++ +                 NV P E+ +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  +LA +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K  R+ SF  F  +++K  ++  EE + P
Sbjct:    5 RRGGVRATAGPRLGWSRDTKQIAVDLPFSRWSKEEVCAWLHEQGLGFYVAQGQSWIKSGQTLLQASQHDLEKELGVKHPLHRKKLQLALQAVGSEEEDL---------KGKLDHNWVTR-WLDDIGLPQYKSHFDEARIDGRTLHYMTVEDLLSLKVGSVLHHLSIKRAIQVLRLNYYDPNCLRRRPSDES-----------------NVTPAEISQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVEALALLLNIPPNKTLLRRHLATHFHLLIGSEAQRLKQDCLENPDYTVLTATAKVK-PRRLSFGGFGTLRKKRQDD-GEEYVCP 315          
BLAST of PPFIA binding protein 1b vs. TrEMBL
Match: A0A3B4BQW5 (PPFIA binding protein 1a OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.385e-58
Identity = 151/384 (39.32%), Postives = 215/384 (55.99%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETS 2336
            S S+F R   +R TAGPRL     L  GN  +    F  WSK+ VC +L + GLG Y +  ++W+ +G   + AS+ ++EK+L I + LH KKL + ++ L S    A         K K+  N+ TR WLDDIGL  Y S F    +DG ML  ++++DL +LK+ + LH LS+KR IQ+LR   Y+ + L RRP++                   N+ P EVC WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  R+ SF  F  ++RK   E SEE + P       +D+++ Q +S
Sbjct:  525 SESEFKRGG-VRATAGPRLGWSRDLQRGNNNELDTPFAHWSKEQVCVWLQEQGLGLYLSQAQQWIRSGQTLLSASQHDLEKDLGIRHPLHRKKLQLALQTLGSEEDDA---------KGKLDFNWVTR-WLDDIGLPQYKSQFDEGRVDGRMLHYMSVDDLLYLKVGSVLHHLSIKRAIQVLRINRYEPNCLRRRPSDEN-----------------NITPAEVCEWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPSNKTLLRRHLATHFHLLIGAEAQRLKQECLENPDYTLLTATAKVK-PRRLSFGGFGTLRRK-RQEDSEEYVCP-------MDVQMPQSSS 853          
BLAST of PPFIA binding protein 1b vs. TrEMBL
Match: A0A3B4DI05 (PPFIA binding protein 1a OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 1.548e-58
Identity = 151/384 (39.32%), Postives = 215/384 (55.99%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETS 2336
            S S+F R   +R TAGPRL     L  GN  +    F  WSK+ VC +L + GLG Y +  ++W+ +G   + AS+ ++EK+L I + LH KKL + ++ L S    A         K K+  N+ TR WLDDIGL  Y S F    +DG ML  ++++DL +LK+ + LH LS+KR IQ+LR   Y+ + L RRP++                   N+ P EVC WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  R+ SF  F  ++RK   E SEE + P       +D+++ Q +S
Sbjct:  388 SESEFKRGG-VRATAGPRLGWSRDLQRGNNNELDTPFAHWSKEQVCVWLQEQGLGLYLSQAQQWIRSGQTLLSASQHDLEKDLGIRHPLHRKKLQLALQTLGSEEDDA---------KGKLDFNWVTR-WLDDIGLPQYKSQFDEGRVDGRMLHYMSVDDLLYLKVGSVLHHLSIKRAIQVLRINRYEPNCLRRRPSDEN-----------------NITPAEVCEWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPSNKTLLRRHLATHFHLLIGAEAQRLKQECLENPDYTLLTATAKVK-PRRLSFGGFGTLRRK-RQEDSEEYVCP-------MDVQMPQSSS 716          
BLAST of PPFIA binding protein 1b vs. Ensembl Cavefish
Match: ppfibp1a (liprin-beta-1-like [Source:NCBI gene;Acc:103022099])

HSP 1 Score: 222.631 bits (566), Expect = 1.079e-60
Identity = 151/370 (40.81%), Postives = 207/370 (55.95%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKI 2300
            S+F R   +R TAGPRL     L  GN  +    F  WSK+ VC +L   GLG Y N+ ++W+ +G   + AS+ ++EKEL I + LH KKL + ++ L S    +           K+  N+ TR WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   Y+ + L RRP            SN N     N+ P EVC WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  S+A +LNIP +++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  R+ SF  F  ++RK   E SEE + P   ++
Sbjct:  494 SEFKRGG-VRATAGPRLGWSHDLQRGNNNELDTPFARWSKEQVCMWLQDQGLGLYLNHAQQWIRSGQTLLNASQHDLEKELGIRHPLHRKKLQLALQALGSEEDDSMG---------KLDFNWVTR-WLDDIGLPQYKSQFDEGRVDGRMLHFMTVDDLLGLKVGSVLHHLSIKRAIQVLRINHYEPNCLRRRP------------SNEN-----NITPAEVCEWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVESMALLLNIPPSKTLLRRHLATHFHLLIGGEAQRLKQECLENPDYTLLTATAKVK-PRRLSFGGFGTLRRK-RQEDSEEYVCPMDVQM 815          
BLAST of PPFIA binding protein 1b vs. Ensembl Cavefish
Match: ppfibp1a (liprin-beta-1-like [Source:NCBI gene;Acc:103022099])

HSP 1 Score: 222.631 bits (566), Expect = 1.530e-60
Identity = 151/370 (40.81%), Postives = 207/370 (55.95%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKI 2300
            S+F R   +R TAGPRL     L  GN  +    F  WSK+ VC +L   GLG Y N+ ++W+ +G   + AS+ ++EKEL I + LH KKL + ++ L S    +           K+  N+ TR WLDDIGL  Y S F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   Y+ + L RRP            SN N     N+ P EVC WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  S+A +LNIP +++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  R+ SF  F  ++RK   E SEE + P   ++
Sbjct:  524 SEFKRGG-VRATAGPRLGWSHDLQRGNNNELDTPFARWSKEQVCMWLQDQGLGLYLNHAQQWIRSGQTLLNASQHDLEKELGIRHPLHRKKLQLALQALGSEEDDSMG---------KLDFNWVTR-WLDDIGLPQYKSQFDEGRVDGRMLHFMTVDDLLGLKVGSVLHHLSIKRAIQVLRINHYEPNCLRRRP------------SNEN-----NITPAEVCEWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVESMALLLNIPPSKTLLRRHLATHFHLLIGGEAQRLKQECLENPDYTLLTATAKVK-PRRLSFGGFGTLRRK-RQEDSEEYVCPMDVQM 845          
BLAST of PPFIA binding protein 1b vs. Ensembl Cavefish
Match: ppfibp1b (liprin-beta-1 [Source:NCBI gene;Acc:103045253])

HSP 1 Score: 218.779 bits (556), Expect = 4.896e-59
Identity = 143/370 (38.65%), Postives = 206/370 (55.68%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKI 2300
            S S+F R   +R TAGPRL     L   N  +    F  WS++ VC ++ + GLG Y N  R+W+++G   ++AS++++EKEL I   LH KKL + ++ L S              K K+  ++ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +Y+ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K   +K  F    RK   E SEE + P   ++
Sbjct:  601 SESEFKRGG-VRATAGPRLGWSRDLHNSNS-EVDAPFARWSREQVCEWMQEQGLGLYVNLARQWISSGHTLLQASQQDLEKELGIKLPLHRKKLQLALQALGSEEDDN---------KGKLDYHWVTR-WLDDIGLPQYKTHFDEGRVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNNYEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFNLLIGSEAQQLKQDWLENPDYAVLTATAKVKP--RKLGFGTFGRKKKQEDSEEYVCPMDVEM 921          
BLAST of PPFIA binding protein 1b vs. Ensembl Cavefish
Match: ppfibp1b (liprin-beta-1 [Source:NCBI gene;Acc:103045253])

HSP 1 Score: 218.779 bits (556), Expect = 5.150e-59
Identity = 143/370 (38.65%), Postives = 206/370 (55.68%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKI 2300
            S S+F R   +R TAGPRL     L   N  +    F  WS++ VC ++ + GLG Y N  R+W+++G   ++AS++++EKEL I   LH KKL + ++ L S              K K+  ++ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +Y+ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K   +K  F    RK   E SEE + P   ++
Sbjct:  585 SESEFKRGG-VRATAGPRLGWSRDLHNSNS-EVDAPFARWSREQVCEWMQEQGLGLYVNLARQWISSGHTLLQASQQDLEKELGIKLPLHRKKLQLALQALGSEEDDN---------KGKLDYHWVTR-WLDDIGLPQYKTHFDEGRVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNNYEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFNLLIGSEAQQLKQDWLENPDYAVLTATAKVKP--RKLGFGTFGRKKKQEDSEEYVCPMDVEM 905          
BLAST of PPFIA binding protein 1b vs. Ensembl Cavefish
Match: ppfibp1b (liprin-beta-1 [Source:NCBI gene;Acc:103045253])

HSP 1 Score: 218.394 bits (555), Expect = 7.258e-59
Identity = 143/370 (38.65%), Postives = 206/370 (55.68%), Query Frame = 3
Query: 1206 SSSQFNRNNPLRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKI 2300
            S S+F R   +R TAGPRL     L   N  +    F  WS++ VC ++ + GLG Y N  R+W+++G   ++AS++++EKEL I   LH KKL + ++ L S              K K+  ++ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR  +Y+ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG++    K+  LEN D++ +T T+K+K   +K  F    RK   E SEE + P   ++
Sbjct:  616 SESEFKRGG-VRATAGPRLGWSRDLHNSNS-EVDAPFARWSREQVCEWMQEQGLGLYVNLARQWISSGHTLLQASQQDLEKELGIKLPLHRKKLQLALQALGSEE---------DDNKGKLDYHWVTR-WLDDIGLPQYKTHFDEGRVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNNYEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFNLLIGSEAQQLKQDWLENPDYAVLTATAKVKP--RKLGFGTFGRKKKQEDSEEYVCPMDVEM 936          
BLAST of PPFIA binding protein 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004720.1 (pep scaffold:Pmarinus_7.0:GL477448:184654:242858:-1 gene:ENSPMAG00000004269.1 transcript:ENSPMAT00000004720.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 198.364 bits (503), Expect = 4.454e-53
Identity = 136/358 (37.99%), Postives = 191/358 (53.35%), Query Frame = 3
Query: 1236 LRMTAGPRL-----LAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHR---KKSFFNVIKRKTSNETSEELLVP 2285
            LR TA PRL     L GG+       F  WS D VC +LH+ GLG Y    R+W+T+G   + A+  +++KEL I + LH KKL + ++ + S    +         K ++  N+ TR WLDDIGL  Y   F    +DG ML  +T++DL  LK+T+ LH LS KR IQ+LR   +  + L RRP++                   NV P EV +WT H+VMEWLR  +L EYA N+RGSG+HG L+V                  LE RF   +LA +LNIP N++LLRRHL T F  L+G      K+ ALE  +  P+T ++K+K  +     S F  ++R+   E +E+ + P
Sbjct:  525 LRATADPRLGWSRDLRGGSS-DLDAPFAKWSTDQVCNWLHEQGLGMYVGMARQWVTSGQTMLRATAHDLDKELGIKHSLHKKKLQLALQAMGSEEENS---------KGELDYNWVTR-WLDDIGLPQYKDQFNEGRVDGRMLHYLTVDDLLSLKVTSLLHHLSYKRAIQVLRMNKFHPNCLRRRPSDEG-----------------NVTPAEVTQWTNHRVMEWLRSADLAEYAPNLRGSGVHGGLLV------------------LEPRFTVETLALLLNIPPNKTLLRRHLATHFDLLVGPDSRRHKQEALEVPNHIPLTASAKVKPKKLPLGISGFGSLRRR-KQEDAEDYVCP 835          
BLAST of PPFIA binding protein 1b vs. Ensembl Sea Lamprey
Match: kazna (kazrin, periplakin interacting protein a [Source:NCBI gene;Acc:100003663])

HSP 1 Score: 111.309 bits (277), Expect = 1.279e-25
Identity = 77/278 (27.70%), Postives = 134/278 (48.20%), Query Frame = 3
Query: 1308 WSKDHVCAFLH-QIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXX---XXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHL-KLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELI 2126
            W  D + A+L   + +  Y  +CR+ + +G   +  S +E+EK L +    +K  L+  +   RQ   V +   +  CL+R   ++  ++  + WL D+GL  Y  +F S  +DG +L  +  ++L+ L  +T++ H  S+   I+LLR + +D   L RR                     C V   +   WT  +VM+W+R ++L E++ ++  SG+HGAL+V                  LE  F A  LA++L IP N + LRRHL ++   ++
Sbjct:  339 WKSDTILAWLELNMSMPMYGKHCRENIKSGKVLLGLSDEELEKALGVANPLHKRKLRLAIEDYRQAEQV-LVGPSRCCLSRAS-ELDHHWVAKTWLRDVGLPQYAQVFHSQLVDGRVLGSLGRKELEKLLGVTSKFHQTSILHAIELLRSVAFDREELSRR------------------RQLCEVRDVDTVVWTNQRVMQWVRNVDLKEFSEHLVSSGVHGALLV------------------LEGSFTAEGLAAMLKIPHNNAFLRRHLASELAVIV 578          
BLAST of PPFIA binding protein 1b vs. Ensembl Sea Lamprey
Match: kazna (kazrin, periplakin interacting protein a [Source:NCBI gene;Acc:100003663])

HSP 1 Score: 110.923 bits (276), Expect = 1.618e-25
Identity = 77/278 (27.70%), Postives = 134/278 (48.20%), Query Frame = 3
Query: 1308 WSKDHVCAFLH-QIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXX---XXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHL-KLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELI 2126
            W  D + A+L   + +  Y  +CR+ + +G   +  S +E+EK L +    +K  L+  +   RQ   V +   +  CL+R   ++  ++  + WL D+GL  Y  +F S  +DG +L  +  ++L+ L  +T++ H  S+   I+LLR + +D   L RR                     C V   +   WT  +VM+W+R ++L E++ ++  SG+HGAL+V                  LE  F A  LA++L IP N + LRRHL ++   ++
Sbjct:  348 WKSDTILAWLELNMSMPMYGKHCRENIKSGKVLLGLSDEELEKALGVANPLHKRKLRLAIEDYRQAEQV-LVGPSRCCLSRAS-ELDHHWVAKTWLRDVGLPQYAQVFHSQLVDGRVLGSLGRKELEKLLGVTSKFHQTSILHAIELLRSVAFDREELSRR------------------RQLCEVRDVDTVVWTNQRVMQWVRNVDLKEFSEHLVSSGVHGALLV------------------LEGSFTAEGLAAMLKIPHNNAFLRRHLASELAVIV 587          
BLAST of PPFIA binding protein 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009262.1 (pep scaffold:Pmarinus_7.0:GL476523:12704:40186:1 gene:ENSPMAG00000008374.1 transcript:ENSPMAT00000009262.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 7.071e-18
Identity = 79/287 (27.53%), Postives = 131/287 (45.64%), Query Frame = 3
Query: 1299 FKLWSKDHVCAFLH-QIGLGA-YANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLK-------IAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQ-HLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIG 2129
            F  W    V A+L   +G+ A Y   CR  + +G      S  EI++E+ I+N LH  KL + I+++ S+   +A     T P  +       +   +    WL  +GL  Y S F    +D  MLD +T +DL+  LK+ +  H  SL+ GI  L+ ++YD   L R+  ++    Q                  +V  W+  +V+ W++ + L EYA+++  SGIHGAL+                   L++ F+  SLA  L IP   +  R+ L+ ++  L+ 
Sbjct:  114 FAQWDGPTVVAWLELWVGMPAWYVAACRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEMVSLTSPSAPPTSRTVPTFRQTLAYSDMNHEWVGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGIMCLKRLNYDRQELERKREDSQHEIQ------------------DVVVWSNERVVRWVQAVGLREYANSLIESGIHGALLA------------------LDESFDHTSLALALQIPTQNTQARQVLEREYNNLLA 364          
BLAST of PPFIA binding protein 1b vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009265.1 (pep scaffold:Pmarinus_7.0:GL476523:20182:40240:1 gene:ENSPMAG00000008374.1 transcript:ENSPMAT00000009265.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 2.722e-16
Identity = 53/185 (28.65%), Postives = 87/185 (47.03%), Query Frame = 3
Query: 1578 WLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQ-HLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIG 2129
            WL  +GL  Y S F    +D  MLD +T +DL+  LK+ +  H  SL+ GI  L+ ++YD   L R+  ++    Q                  +V  W+  +V+ W++ + L EYA+++  SGIHGAL+                   L++ F+  SLA  L IP   +  R+ L+ ++  L+ 
Sbjct:  136 WLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRTSLQYGIMCLKRLNYDRQELERKREDSQHEIQ------------------DVVVWSNERVVRWVQAVGLREYANSLIESGIHGALLA------------------LDESFDHTSLALALQIPTQNTQARQVLEREYNNLLA 284          
BLAST of PPFIA binding protein 1b vs. Ensembl Nematostella
Match: EDO49639 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFP8])

HSP 1 Score: 176.792 bits (447), Expect = 9.126e-50
Identity = 110/334 (32.93%), Postives = 167/334 (50.00%), Query Frame = 3
Query: 1299 FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKI 2300
            F  W    +  +L  +GLG Y + C++ +  G   + AS  E++++L I + LH KKL + ++  TS                   +N     WL+DIGL HY   F+  C+DG ML+ +TL+DLQHLK+TN LH +S++R IQ LR  ++  + L R P +                        +V  WT  +VMEWLR ++L EYA N+RGSG+HGAL+                  ILE RF   +LA++L+IP  ++LLRRHL + FQ L+GT     K  A  +  F+P+    K K  +K      +++K+ +   +  + P    I
Sbjct:    5 FARWPPQMIMNWLDDLGLGCYTDGCQRNIKCGEDLLRASGVELDRQLGIRHPLHRKKLQLALQAFTSDSPDVMGRL----------SNHWVLGWLEDIGLPHYKDAFSDACVDGRMLNHLTLDDLQHLKVTNALHHVSIQRAIQCLRFYNFHPNCLKRYPIDEG---------------------ADVLLWTNGRVMEWLRLVDLAEYAPNLRGSGVHGALM------------------ILEPRFTPETLAALLSIPSTKTLLRRHLASHFQSLVGTACSRTKDEAAADPGFTPLMPGVKHKVMKKSKSLGALRKKSKDSDMDNYVCPMDLDI 289          
BLAST of PPFIA binding protein 1b vs. Ensembl Nematostella
Match: EDO42405 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1P9])

HSP 1 Score: 96.6709 bits (239), Expect = 2.390e-22
Identity = 60/194 (30.93%), Postives = 96/194 (49.48%), Query Frame = 3
Query: 1548 KIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQ-HLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELI 2126
            KI   +  R W+ D+GL  Y   F S  IDG +L+ +T +D++ HL ++ + H  S+  G+ LLR I +D   LI R                   ++C+    +   WT  +VM W R I+L EYA N+R SG+HGA++VI                   + F  + +A+ L I  +++++RRHL ++   LI
Sbjct:   79 KIDHFWVARTWIRDLGLSQYGPAFESQMIDGRLLNVLTRKDMEKHLHISKKFHQTSILNGVDLLRLIAFDKQCLIDR------------------RLSCDETDIDPVVWTNDKVMRWCRSIDLQEYADNLRDSGVHGAMMVI------------------NETFGPDEMANCLAIHPSKNIIRRHLTSEMTALI 236          
BLAST of PPFIA binding protein 1b vs. Ensembl Medaka
Match: ppfibp1b (PPFIA binding protein 1 [Source:NCBI gene;Acc:101174664])

HSP 1 Score: 217.624 bits (553), Expect = 8.055e-59
Identity = 142/368 (38.59%), Postives = 205/368 (55.71%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKK-SFFNVIKRKTSNETSEELLVPYTYKI 2300
             +F R   +R TAGPRL    +  +  +D    F  WSKD VC +L + GLG Y N  R W+++G   ++AS+ ++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   ++ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  +   S F  +++K  +E SEE + P   ++
Sbjct:  545 GEFKRGG-VRATAGPRLGWSRDLQRGNNDVDAPFARWSKDQVCNWLQEQGLGLYVNMARVWISSGQTLLQASQLDLEKELGIKHPLHRKKLQLALQALGSEEEDN---------KGKLDYNWVTR-WLDDIGLPQYKTQFDEARVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNKFEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFSLLIGAEAQQLKQECLENPDYTVLTATTKVKPKKLPFSNFGSLRKKKQDE-SEEYVCPMDVEM 865          
BLAST of PPFIA binding protein 1b vs. Ensembl Medaka
Match: ppfibp1b (PPFIA binding protein 1 [Source:NCBI gene;Acc:101174664])

HSP 1 Score: 217.238 bits (552), Expect = 1.265e-58
Identity = 142/368 (38.59%), Postives = 205/368 (55.71%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKK-SFFNVIKRKTSNETSEELLVPYTYKI 2300
             +F R   +R TAGPRL    +  +  +D    F  WSKD VC +L + GLG Y N  R W+++G   ++AS+ ++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   ++ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  +   S F  +++K  +E SEE + P   ++
Sbjct:  556 GEFKRGG-VRATAGPRLGWSRDLQRGNNDVDAPFARWSKDQVCNWLQEQGLGLYVNMARVWISSGQTLLQASQLDLEKELGIKHPLHRKKLQLALQALGSEEEDN---------KGKLDYNWVTR-WLDDIGLPQYKTQFDEARVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNKFEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFSLLIGAEAQQLKQECLENPDYTVLTATTKVKPKKLPFSNFGSLRKKKQDE-SEEYVCPMDVEM 876          
BLAST of PPFIA binding protein 1b vs. Ensembl Medaka
Match: ppfibp1b (PPFIA binding protein 1 [Source:NCBI gene;Acc:101174664])

HSP 1 Score: 216.468 bits (550), Expect = 2.567e-58
Identity = 142/368 (38.59%), Postives = 205/368 (55.71%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKK-SFFNVIKRKTSNETSEELLVPYTYKI 2300
             +F R   +R TAGPRL    +  +  +D    F  WSKD VC +L + GLG Y N  R W+++G   ++AS+ ++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   ++ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  +   S F  +++K  +E SEE + P   ++
Sbjct:  556 GEFKRGG-VRATAGPRLGWSRDLQRGNNDVDAPFARWSKDQVCNWLQEQGLGLYVNMARVWISSGQTLLQASQLDLEKELGIKHPLHRKKLQLALQALGSEEEDN---------KGKLDYNWVTR-WLDDIGLPQYKTQFDEARVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNKFEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFSLLIGAEAQQLKQECLENPDYTVLTATTKVKPKKLPFSNFGSLRKKKQDE-SEEYVCPMDVEM 876          
BLAST of PPFIA binding protein 1b vs. Ensembl Medaka
Match: ppfibp1b (PPFIA binding protein 1 [Source:NCBI gene;Acc:101174664])

HSP 1 Score: 216.468 bits (550), Expect = 2.951e-58
Identity = 142/368 (38.59%), Postives = 205/368 (55.71%), Query Frame = 3
Query: 1212 SQFNRNNPLRMTAGPRLLAGGNKLKPTDD----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKK-SFFNVIKRKTSNETSEELLVPYTYKI 2300
             +F R   +R TAGPRL    +  +  +D    F  WSKD VC +L + GLG Y N  R W+++G   ++AS+ ++EKEL I + LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y + F    +DG ML  +T++DL  LK+ + LH LS+KR IQ+LR   ++ + L RRP++                   N+ P EV +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  ++A +LNIP N++LLRRHL T F  LIG +    K+  LEN D++ +T T+K+K  +   S F  +++K  +E SEE + P   ++
Sbjct:  571 GEFKRGG-VRATAGPRLGWSRDLQRGNNDVDAPFARWSKDQVCNWLQEQGLGLYVNMARVWISSGQTLLQASQLDLEKELGIKHPLHRKKLQLALQALGSEEEDN---------KGKLDYNWVTR-WLDDIGLPQYKTQFDEARVDGRMLHYMTVDDLLSLKVGSVLHHLSIKRAIQVLRLNKFEPNCLRRRPSDEN-----------------NISPAEVSQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVETMALLLNIPPNKTLLRRHLATHFSLLIGAEAQQLKQECLENPDYTVLTATTKVKPKKLPFSNFGSLRKKKQDE-SEEYVCPMDVEM 891          
BLAST of PPFIA binding protein 1b vs. Ensembl Medaka
Match: ppfibp1a (liprin-beta-1 [Source:NCBI gene;Acc:101162257])

HSP 1 Score: 214.542 bits (545), Expect = 6.856e-58
Identity = 143/366 (39.07%), Postives = 199/366 (54.37%), Query Frame = 3
Query: 1224 RNNPLRMTAGPRLLAGGNKLKPTDD-----FKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSF--FNVIKRKTSNETSEELLVPYTYKI 2300
            R   +R TAGPRL   G   +P  +     F  WSK+ VCA+L + GLG Y    + W+ +G   ++AS+ E+EK+L +   LH KKL + ++ L S              K K+  N+ TR WLDDIGL  Y S F    +DG ML  +T+EDL  LK+ + LH LS+KR IQ+LR   YD   L RRP++ +                 NV P E+ +WT H+VMEWLR ++L EYA N+RGSG+HG L+V                  LE RFN  +LA +LNIP  ++LLRRHL T F  L+G +    K+  LEN D+  +T T+K+K  R+ SF  F  + RK  ++  EE + P   ++
Sbjct:  495 RRGGVRATAGPRL---GWSREPKHNSAEAPFSRWSKEEVCAWLQEQGLGLYVAQGQNWIKSGQTLLQASQHELEKDLGVKQPLHRKKLQLALQALVSGEEDL---------KGKLDHNWVTR-WLDDIGLPQYKSGFEEARVDGRMLHFMTVEDLLSLKVGSVLHHLSIKRAIQVLRLNLYDPGCLRRRPSDES-----------------NVTPAEISQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMV------------------LEPRFNVEALALLLNIPPGKTLLRRHLATHFHLLVGAEAQRLKQECLENPDYQVLTATAKVKP-RRLSFGGFGTL-RKKRHDDGEEYVCPMNVEM 810          
BLAST of PPFIA binding protein 1b vs. Planmine SMEST
Match: SMESG000054431.1 (SMESG000054431.1)

HSP 1 Score: 1461.43 bits (3782), Expect = 0.000e+0
Identity = 732/751 (97.47%), Postives = 733/751 (97.60%), Query Frame = 3
Query:  144 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSSSQFNRNNPLRMTAGPRLLAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 2396
            MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENS+SQFNRNNPLRMTAGPRLLAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALI                  ILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL
Sbjct:    1 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTDDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALI------------------ILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 733          
BLAST of PPFIA binding protein 1b vs. Planmine SMEST
Match: SMESG000054431.1 (SMESG000054431.1)

HSP 1 Score: 1447.18 bits (3745), Expect = 0.000e+0
Identity = 731/775 (94.32%), Postives = 733/775 (94.58%), Query Frame = 3
Query:  144 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSSSQFNRNNPLRMTAGPRLLAGGNKLKPTD------------------------DFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 2396
            MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENS+SQFNRNNPLRMTAGPRLLAGGNKLKPT+                        DFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALI                  ILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL
Sbjct:    1 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALI------------------ILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 757          
BLAST of PPFIA binding protein 1b vs. Planmine SMEST
Match: SMESG000054431.1 (SMESG000054431.1)

HSP 1 Score: 1400.19 bits (3623), Expect = 0.000e+0
Identity = 714/775 (92.13%), Postives = 716/775 (92.39%), Query Frame = 3
Query:  144 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKLAAENSSSQFNRNNPLRMTAGPRLLAGGNKLKPTD------------------------DFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 2396
            MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNK                 CSQPVSSNINALALLAVTDKLAAENS+SQFNRNNPLRMTAGPRLLAGGNKLKPT+                        DFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALI                  ILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL
Sbjct:    1 MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDYTDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEFLKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLNSKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSALSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISPPGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISSDSKKKTKLFSNKR----------------CSQPVSSNINALALLAVTDKLAAENSNSQFNRNNPLRMTAGPRLLAGGNKLKPTEVAVQRVLSLSNPNLQSITLLPSKSDFKLWSKDHVCAFLHQIGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQLTSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALI------------------ILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIKRKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTNL 741          
BLAST of PPFIA binding protein 1b vs. Planmine SMEST
Match: SMESG000048911.1 (SMESG000048911.1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.028e-17
Identity = 102/399 (25.56%), Postives = 168/399 (42.11%), Query Frame = 3
Query: 1011 SMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNI-NALALLAVTDK----LAAENSSSQFNRNNPLRMTAGPRLLAGGNKLKPTDDFKLWSKDHVCAFLH-QIGLGA-YANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIA-----ANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQ-HLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALEN 2168
            S+N +T   +   +     F  +S    P  +    +L I  QP+++NI N +   +VT+     L    SS   +R    +      ++A          F  W+   + A+L   +G+ A Y   CR  + +G   +  S+ EI++E+ I+N LH  KL + I+++  +   A       RP   +A       +    WL  +GL  +   F    +D  MLD +T +DL+ HLK+    H  SL  G+  L+ ++YD   L  R                  E+       +V  W+  +VM W+  I+L EYA N+  SG+HGAL+                  +L+  F+AN L  +L IP +    R+ L  +  +L+        KR  EN
Sbjct: 1150 SINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQI-DQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVA------FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPG----PRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHR-----------------QELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALL------------------LLDQHFDANDLIILLQIPASAEQARQTLTRELHDLV--------KRGREN 1494          
BLAST of PPFIA binding protein 1b vs. Planmine SMEST
Match: SMESG000048911.1 (SMESG000048911.1)

HSP 1 Score: 87.8113 bits (216), Expect = 2.244e-17
Identity = 102/399 (25.56%), Postives = 168/399 (42.11%), Query Frame = 3
Query: 1011 SMNFITNRISSDSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNI-NALALLAVTDK----LAAENSSSQFNRNNPLRMTAGPRLLAGGNKLKPTDDFKLWSKDHVCAFLH-QIGLGA-YANNCRKWLTNGLQFIEASKKEIEKEXXXXXXXXXXXXXXXXRQLTSVHVTAATYFCLTRPKLKIA-----ANFTTRLWLDDIGLLHYMSLFASNCIDGYMLDQITLEDLQ-HLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTFNTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGSGIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLRRHLQTKFQELIGTKIVAQKKRALEN 2168
            S+N +T   +   +     F  +S    P  +    +L I  QP+++NI N +   +VT+     L    SS   +R    +      ++A          F  W+   + A+L   +G+ A Y   CR  + +G   +  S+ EI++E+ I+N LH  KL + I+++  +   A       RP   +A       +    WL  +GL  +   F    +D  MLD +T +DL+ HLK+    H  SL  G+  L+ ++YD   L  R                  E+       +V  W+  +VM W+  I+L EYA N+  SG+HGAL+                  +L+  F+AN L  +L IP +    R+ L  +  +L+        KR  EN
Sbjct: 1145 SINQMTRHPTPQFRNPPDAFDERSRNFSPTGFVDQQNLQI-DQPITANITNPMVPFSVTNSNSISLGVGFSSHTEDRRRKKKEELLEEVIANNVA------FCNWNGPTIVAWLELWVGMPAWYVAACRANVKSGAIMVALSETEIQREIGISNPLHRLKLRLAIQEMVQLTSPAPG----PRPNKSLAFGELNHEWVGNYWLPSLGLSQFRPAFMECLVDARMLDHLTKKDLRVHLKMIENFHRSSLLYGVACLKRLNYDRKQLEHR-----------------QELANAKDSNDVLVWSCERVMSWIEHIDLREYAGNLTDSGVHGALL------------------LLDQHFDANDLIILLQIPASAEQARQTLTRELHDLV--------KRGREN 1489          
The following BLAST results are available for this feature:
BLAST of PPFIA binding protein 1b vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPFIBP13.547e-5739.07PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
PPFIBP13.820e-5739.07PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
PPFIBP11.185e-5639.07PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
PPFIBP11.231e-5639.07PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
PPFIBP14.842e-5639.37PPFIA binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of PPFIA binding protein 1b vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hlb-14.799e-3729.90Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
hlb-18.671e-3729.90Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
hlb-19.220e-3729.90Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
hlb-19.220e-3729.90Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
hlb-19.924e-3729.90Liprin-beta [Source:UniProtKB/Swiss-Prot;Acc:Q940... [more]
back to top
BLAST of PPFIA binding protein 1b vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Liprin-beta3.458e-4935.23gene:FBgn0036376 transcript:FBtr0075814[more]
Liprin-beta3.458e-4935.23gene:FBgn0036376 transcript:FBtr0075813[more]
Liprin-beta3.458e-4935.23gene:FBgn0036376 transcript:FBtr0330342[more]
Liprin-gamma1.298e-2233.15gene:FBgn0034720 transcript:FBtr0342990[more]
Liprin-gamma1.592e-2233.15gene:FBgn0034720 transcript:FBtr0113106[more]
back to top
BLAST of PPFIA binding protein 1b vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppfibp1a2.662e-6140.38PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
ppfibp1a2.686e-6139.37PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
ppfibp1a2.956e-6139.37PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
ppfibp1a3.832e-6140.38PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
ppfibp1a3.002e-6040.06PPFIA binding protein 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of PPFIA binding protein 1b vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPFIBP19.865e-5438.99PTPRF interacting protein, binding protein 1 (lipr... [more]
PPFIBP11.092e-5338.99PTPRF interacting protein, binding protein 1 (lipr... [more]
PPFIBP11.264e-5338.69PTPRF interacting protein, binding protein 1 (lipr... [more]
PPFIBP11.268e-5338.99PTPRF interacting protein, binding protein 1 (lipr... [more]
PPFIBP11.301e-5338.99PTPRF interacting protein, binding protein 1 (lipr... [more]
back to top
BLAST of PPFIA binding protein 1b vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppfibp16.882e-5638.08PTPRF interacting protein, binding protein 1 (lipr... [more]
Ppfibp17.807e-5638.08PTPRF interacting protein, binding protein 1 (lipr... [more]
Ppfibp28.137e-5235.36PTPRF interacting protein, binding protein 2 (lipr... [more]
Ppfibp28.856e-5235.36PTPRF interacting protein, binding protein 2 (lipr... [more]
Kazn1.036e-2131.32kazrin, periplakin interacting protein [Source:MGI... [more]
back to top
BLAST of PPFIA binding protein 1b vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86W92|LIPB1_HUMAN5.691e-5639.07Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 P... [more]
sp|Q8C8U0|LIPB1_MOUSE4.814e-5538.08Liprin-beta-1 OS=Mus musculus OX=10090 GN=Ppfibp1 ... [more]
sp|O35711|LIPB2_MOUSE6.359e-5135.36Liprin-beta-2 OS=Mus musculus OX=10090 GN=Ppfibp2 ... [more]
sp|Q8ND30|LIPB2_HUMAN6.478e-5035.36Liprin-beta-2 OS=Homo sapiens OX=9606 GN=PPFIBP2 P... [more]
sp|Q94071|LIPB_CAEEL3.223e-3529.90Liprin-beta homolog OS=Caenorhabditis elegans OX=6... [more]
back to top
BLAST of PPFIA binding protein 1b vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I4AZL72.202e-6039.67liprin-beta-1 OS=Austrofundulus limnaeus OX=52670 ... [more]
A0A1A7YVJ33.661e-5939.39PTPRF interacting protein, binding protein 1 (Lipr... [more]
A0A3Q4GXP01.363e-5839.94PPFIA binding protein 1a OS=Neolamprologus brichar... [more]
A0A3B4BQW51.385e-5839.32PPFIA binding protein 1a OS=Pygocentrus nattereri ... [more]
A0A3B4DI051.548e-5839.32PPFIA binding protein 1a OS=Pygocentrus nattereri ... [more]
back to top
BLAST of PPFIA binding protein 1b vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppfibp1a1.079e-6040.81liprin-beta-1-like [Source:NCBI gene;Acc:103022099... [more]
ppfibp1a1.530e-6040.81liprin-beta-1-like [Source:NCBI gene;Acc:103022099... [more]
ppfibp1b4.896e-5938.65liprin-beta-1 [Source:NCBI gene;Acc:103045253][more]
ppfibp1b5.150e-5938.65liprin-beta-1 [Source:NCBI gene;Acc:103045253][more]
ppfibp1b7.258e-5938.65liprin-beta-1 [Source:NCBI gene;Acc:103045253][more]
back to top
BLAST of PPFIA binding protein 1b vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004720.14.454e-5337.99pep scaffold:Pmarinus_7.0:GL477448:184654:242858:-... [more]
kazna1.279e-2527.70kazrin, periplakin interacting protein a [Source:N... [more]
kazna1.618e-2527.70kazrin, periplakin interacting protein a [Source:N... [more]
ENSPMAT00000009262.17.071e-1827.53pep scaffold:Pmarinus_7.0:GL476523:12704:40186:1 g... [more]
ENSPMAT00000009265.12.722e-1628.65pep scaffold:Pmarinus_7.0:GL476523:20182:40240:1 g... [more]
back to top
BLAST of PPFIA binding protein 1b vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PPFIA binding protein 1b vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO496399.126e-5032.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424052.390e-2230.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PPFIA binding protein 1b vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppfibp1b8.055e-5938.59PPFIA binding protein 1 [Source:NCBI gene;Acc:1011... [more]
ppfibp1b1.265e-5838.59PPFIA binding protein 1 [Source:NCBI gene;Acc:1011... [more]
ppfibp1b2.567e-5838.59PPFIA binding protein 1 [Source:NCBI gene;Acc:1011... [more]
ppfibp1b2.951e-5838.59PPFIA binding protein 1 [Source:NCBI gene;Acc:1011... [more]
ppfibp1a6.856e-5839.07liprin-beta-1 [Source:NCBI gene;Acc:101162257][more]
back to top
BLAST of PPFIA binding protein 1b vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054431.10.000e+097.47SMESG000054431.1[more]
SMESG000054431.10.000e+094.32SMESG000054431.1[more]
SMESG000054431.10.000e+092.13SMESG000054431.1[more]
SMESG000048911.12.028e-1725.56SMESG000048911.1[more]
SMESG000048911.12.244e-1725.56SMESG000048911.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012475 ID=SMED30012475|Name=PPFIA binding protein 1b|organism=Schmidtea mediterranea sexual|type=transcript|length=2560bp
CTTTCTTTGAATGTATTGTTTTACTAAATAGTGTTAATCGCCATAATTTA
ATCTATATATTAATTCTAAAATTAATTTCCTTAAAATTTGCTAAATTTTG
TAATTTTATGAATGATATATTTTGAAAATTAGAATTTTCAGAAATGAGTG
TTAATTATAATGGTTATAATAATAATTCTGCTAGCAAACTTTTGGAATCA
GTTTTAGAGGACATGAATAATATTATTAAAGCAAATGATCATTCTGGTAA
TTCGGAAAATATCTGTCCATTGACTACTAAATATGTAGATTATACTGATT
TTAGTAATGGTAATAATAATTGCTCGGAAATTTCCCATGATCAAAAGTTT
GAGTTGATGGTATCTGAATTACAAAACTGCTTACAAGAAGCAGTAGACGT
TCGTAGTATGATGAGAAATTTATCTAGTGATAAAAAAGAATTTTTAAAAG
CTCTTTTAAAAACTGATCTTGAAAACAACATTAATATATCACATAAAGTT
GATTTAATGGATGAAATATCTAAACTAAAGTTGGATATTGCCTATTTACA
ACGAGACAAACAAGGCTTATTGAATCAAATTAATGACTTAAATTCTAAAG
TACAGCTTTTGAATGATGAAAATGTCAGATTGCGAAAAGAAATGAATTTA
ATGAAAGTTGATGAAATGGATTATTGTTTTCCTCCAAACGAATTAGGTGA
TAATTGTTCAATTGGAGAAAGTCACCAATCAAAAGATTCAGCGTTGTCTG
GTGCATTGAGAAATGAGAGCCCATTAGCAACAAGTACACCAGAAAAACCA
AAATCAGCCACCAAAGTCCCAGTGGTTCCACCTCACAGAATTCAAATAAA
TCAACGTCAGTTACCGCATGATTTTCTTAATAAAATCAGCCCACCTGGCC
ACATTAGAGAGTCTACTGGTAAATCTAACAGTTGGAGTGAATTGCGGACT
AATCAGGTTATTCACGATGATCAAGTACCGATGATGACACCTCCATCTCA
AAGAAAAAGTTCTATGAATTTCATTACGAACAGAATATCCAGTGATAGCA
AGAAAAAGACAAAACTTTTCAGCAATAAAAGTTTGGGCCTATTACCTTGT
GAATATGATGCCAATTTTGATTTATCAATATGCTCCCAACCCGTGAGTTC
AAATATCAATGCTCTTGCCCTGCTAGCTGTGACAGATAAATTGGCCGCTG
AAAATTCTAGTAGTCAATTTAACAGAAACAATCCATTGCGAATGACAGCT
GGGCCAAGATTGCTAGCTGGTGGTAATAAACTTAAACCTACAGATGATTT
CAAGCTATGGTCAAAAGATCACGTTTGTGCATTTTTACATCAAATTGGAC
TAGGTGCGTACGCAAATAATTGTCGAAAATGGCTCACAAATGGATTGCAA
TTTATTGAAGCATCAAAAAAAGAAATTGAGAAGGAACTCAACATCACCAA
TAAATTACATTTGAAAAAGCTGTTGATACATATTCGACAACTGACATCTG
TACACGTTACAGCTGCCACTTATTTTTGTTTGACTCGGCCCAAATTGAAA
ATTGCAGCAAATTTCACTACTCGTTTGTGGCTAGATGATATTGGGTTGCT
TCATTACATGAGTTTGTTTGCTTCTAACTGTATCGATGGCTACATGCTAG
ACCAGATTACATTGGAAGATTTGCAGCATTTAAAATTAACCAACGAACTT
CATGTTCTCAGTTTAAAAAGAGGAATTCAATTATTAAGAGAAATCGATTA
CGATTTGTCACTTCTAATCAGACGACCAGCAGAAAACACATTCAATACTC
AATCGGAAACTGGTAGCAACACTAACTTAGAAGTAACGTGCAATGTGCAC
CCTGGTGAGGTGTGTAGATGGACTCAACACCAAGTTATGGAATGGCTAAG
GCGGATTGAACTTCCAGAATATGCTTCTAATATCCGTGGAAGTGGTATTC
ACGGTGCTCTTATTGTAATAGTTTTTATCGATATTTTCCAAATTTCGCCT
CATATTTTACTTTTCAAGATCCTTGAAGATAGATTTAATGCCAATTCATT
AGCATCGGTTTTAAATATTCCCCAGAATCGTTCACTCTTACGTCGACATC
TTCAAACAAAATTCCAAGAGTTAATCGGAACGAAAATCGTCGCACAAAAG
AAAAGAGCATTAGAAAATTCCGATTTCAGTCCCGTAACAATCACATCTAA
AATGAAGTATCACAGAAAAAAAAGCTTTTTCAATGTTATCAAACGTAAAA
CCAGCAATGAAACGTCTGAAGAACTTCTAGTCCCGTATACATATAAAATT
GAAGATTTAGATCTTAAATTGAATCAGGAAACATCTTCAGTTGATAATAA
TAATGCTGAATCTTCATCAACAAGTAATCTGCCTCAAACAAATTTATAAT
TTCTATTTGAATTTCTTGCTCATTGTTTGTGATTGTACTGGTGTTCGTCA
TCTTATTTATATACCATTGTGTTTATTTTATTCATATTAATAGCTCAACT
TTTCTATGTTGGATTTATTTATTTTCTGTGCATATATATATATTATTTTT
GCCTTTCCAC
back to top

protein sequence of SMED30012475-orf-1

>SMED30012475-orf-1 ID=SMED30012475-orf-1|Name=SMED30012475-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=752bp
MSVNYNGYNNNSASKLLESVLEDMNNIIKANDHSGNSENICPLTTKYVDY
TDFSNGNNNCSEISHDQKFELMVSELQNCLQEAVDVRSMMRNLSSDKKEF
LKALLKTDLENNINISHKVDLMDEISKLKLDIAYLQRDKQGLLNQINDLN
SKVQLLNDENVRLRKEMNLMKVDEMDYCFPPNELGDNCSIGESHQSKDSA
LSGALRNESPLATSTPEKPKSATKVPVVPPHRIQINQRQLPHDFLNKISP
PGHIRESTGKSNSWSELRTNQVIHDDQVPMMTPPSQRKSSMNFITNRISS
DSKKKTKLFSNKSLGLLPCEYDANFDLSICSQPVSSNINALALLAVTDKL
AAENSSSQFNRNNPLRMTAGPRLLAGGNKLKPTDDFKLWSKDHVCAFLHQ
IGLGAYANNCRKWLTNGLQFIEASKKEIEKELNITNKLHLKKLLIHIRQL
TSVHVTAATYFCLTRPKLKIAANFTTRLWLDDIGLLHYMSLFASNCIDGY
MLDQITLEDLQHLKLTNELHVLSLKRGIQLLREIDYDLSLLIRRPAENTF
NTQSETGSNTNLEVTCNVHPGEVCRWTQHQVMEWLRRIELPEYASNIRGS
GIHGALIVIVFIDIFQISPHILLFKILEDRFNANSLASVLNIPQNRSLLR
RHLQTKFQELIGTKIVAQKKRALENSDFSPVTITSKMKYHRKKSFFNVIK
RKTSNETSEELLVPYTYKIEDLDLKLNQETSSVDNNNAESSSTSNLPQTN
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029515Liprin
IPR030444Liprin-beta
IPR001660SAM
IPR013761SAM/pointed_sf
Vocabulary: biological process
TermDefinition
GO:0007528neuromuscular junction development
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0045296cadherin binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005925focal adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 132..173
NoneNo IPR availableCOILSCoilCoilcoord: 418..438
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 192..220
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 730..751
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 192..227
IPR001660Sterile alpha motif domainSMARTSM00454SAM_4coord: 573..663
e-value: 4.0
score: 12.5
coord: 386..453
e-value: 1.0E-7
score: 41.6
coord: 468..534
e-value: 1.5E-7
score: 41.1
IPR001660Sterile alpha motif domainPFAMPF00536SAM_1coord: 475..531
e-value: 1.2E-9
score: 38.4
coord: 389..450
e-value: 1.3E-10
score: 41.5
IPR001660Sterile alpha motif domainPFAMPF07647SAM_2coord: 576..608
e-value: 3.2E-7
score: 30.3
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 389..453
score: 10.696
IPR001660Sterile alpha motif domainPROSITEPS50105SAM_DOMAINcoord: 479..534
score: 11.782
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 472..546
e-value: 1.5E-18
score: 68.9
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 356..469
e-value: 1.4E-20
score: 75.6
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 566..680
e-value: 1.1E-30
score: 107.4
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 568..610
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 381..454
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 478..538
IPR029515LAR-interacting protein, LiprinPANTHERPTHR12587LAR INTERACTING PROTEIN LIP -RELATED PROTEINcoord: 70..711
IPR030444Liprin-betaPANTHERPTHR12587:SF14AT31531Pcoord: 70..711