TPR_MLP1_2 domain-containing protein

Overview
NameTPR_MLP1_2 domain-containing protein
Smed IDSMED30012468
Length (bp)4099
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TPR_MLP1_2 domain-containing protein (SMED30012468) t-SNE clustered cells

Violin plots show distribution of expression levels for TPR_MLP1_2 domain-containing protein (SMED30012468) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TPR_MLP1_2 domain-containing protein (SMED30012468) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TPR_MLP1_2 domain-containing protein (SMED30012468) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012468

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012468SMESG000065719.1 Contig2921newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012468SMESG000065719.1 Contig2921uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012468SMESG000072738.1 SMESG000072736.1 SMESG000072730.1 SMESG000072726.1 Contig2921newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012468SMESG000072738.1 SMESG000072736.1 SMESG000072730.1 SMESG000072726.1 Contig2921uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30012468SMESG000065719.1 dd_Smed_v4_8360_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012468SMESG000065721.1 SMESG000065719.1 Contig21413newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012468SMESG000065721.1 SMESG000065719.1 Contig21413uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Human
Match: TPR (translocated promoter region, nuclear basket protein [Source:HGNC Symbol;Acc:HGNC:12017])

HSP 1 Score: 42.3578 bits (98), Expect = 8.967e-9
Identity = 146/636 (22.96%), Postives = 274/636 (43.08%), Query Frame = 3
Query: 1653 IEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQA---KISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLREREENIESLKMQLE-EI-RALNLIRN-SISYCDVSCQVDISLFEDFETNEEINTKTMIDEGA---------LINCRNQIVSLQAQLIA-----DKLESDHSLSELR-----------------SEIDKY----------------------KN---ELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTL----QSLEKSFGIERANL---KLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQLKEINSEG--------------SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERYENEISRL--------------RESLSDTNKESKVKIERLNKRLSGNSVSLILDPEVIRESNCVLRQQKEQLERNLINVKCEVEDL 3269
            +E+++ Q+ +L  ++  +S +LD A ++    ++  E YR+E   L   N+ L + +   E  I  +   L+    K+++   R  +L   K +L L++   +RL  +R+  +     Q  + +N+ +++  LE S+  +K ++ ++IE LE                I  LK +LE E+ +   L RN  +   D   Q+D       ETN  +NTK ++             L N   Q+ S  +Q        +K + D  +S+LR                 S +++Y                      KN    L+ES E    LE ++   EK +QE+  +  +  E   +  + LK+ L + Q E+     R   A + E+  +    +  K + EA+ KY+REL LHAAD + L+AA++++  +    Q LE++     + L   K   ++ E+  K ++ +   R +DLE++ +   ++ EKL +++     EG              S    +EI+  ++ + +I      ++ V+  RY   +  L              RE +  T K      E + K  + N         V+ E+N +LR++KE+LE++L  ++ +V  L
Sbjct:  697 LEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSE---VRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQIEKLE--------------HEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDT------ETNLHLNTKELLKNAQKEIATLKQHLSNMEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTSNVEQYQAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRRAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHEELMKKTETMN---------VVMETNKMLREEKERLEQDLQQMQAKVRKL 1300          

HSP 2 Score: 39.2762 bits (90), Expect = 8.967e-9
Identity = 59/223 (26.46%), Postives = 109/223 (48.88%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQEL--EI----------NLKETKNSDRVK-MEEDLQKIKNLEKDLEKAELDRKKLEELSNKLTVGERIVAQLKDIGRKHKGESEKRGQYISELERKMLEFQEQLESLSDEKDQSIEKLNRKETEFEMAAKELKELRTRCEILEKVNKNRENTIGELNVNVEQLKSDL 3934
            EL E+   L   K  LE++  RWK R   LV + +  D E+YR   ++++ + K  Q+L  EI          N   T N + ++ ++EDL K++  EK+  + +LD K + ++  K+    + + Q+K IGR++K + E+    +   + K++E   Q      E+  S++++   +     A  + K L ++ E L+K    +E     L     QL+S+L
Sbjct: 1313 ELSEKSGMLQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLKEDLNKVRT-EKETIQKDLDAKII-DIQEKV----KTITQVKKIGRRYKTQYEE----LKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETLNQAETKSKSLESQVENLQKTLSEKETEARNLQEQTVQLQSEL 1525          
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Zebrafish
Match: tprb (translocated promoter region b, nuclear basket protein [Source:ZFIN;Acc:ZDB-GENE-030131-6410])

HSP 1 Score: 60.4622 bits (145), Expect = 1.844e-8
Identity = 226/1047 (21.59%), Postives = 457/1047 (43.65%), Query Frame = 3
Query:   99 LLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDIYDLREQINNLKVINEELSRSYEDSSNQMKNDIQDKDLEI-----------HRIRNEILQLQQNGISEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKRNYDSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQSKQSDLERQLMVSRKNLQSSNSEIERLNEQVSLFIVVAE--NGSQIKQEAVDADSG--------------LYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKCEELQKYVDKTTEEINQLRQGNSVNKSQITLHEKQIQLLRYLIELKS----PGSSAAIENGLKLIEFGNIVNLDCDEEMEP-ELVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQ---MRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQAKISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLREREENIESLKMQLEEIRALNLI-RNS-ISYCDVSCQVDISLFEDFETNEEINTKTMIDEGALINCRNQIVSLQAQLIADKLESDHSLSE-----LRSEIDKYKNELQESTEKC--------------------------------AFLETQI-SLQEKARQ------EILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLE-----EAETVERTVQEVID--KYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTL----QSLEKSFGIERANL---KLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQLKEINSE 2954
            L ++LE   + E   K KE    ++K++L+  +     EL+ KSE + SL R    +   L  +L  K +E+ ++  +   LK  N  FQ+  +  + ++   +       + F  EL    +L+  Y+ ++   + K   ++   ++  + + +  E   +L+V   +L         ++K  I  ++ E+           HR    IL  +Q  I       M+P AA+  K+ K    L EIY+        + R ++E  R  +  D +  E+      + + + E E   K   SL ++L   VT++   Q +  +  ++  V  ++ Q    ++  + +QV + +V  E   G+ + +E  D  S                + SV ELQ+ N+ L +   DL  + E  + E    K  E++KY+++   E+ QL++  + +  ++    +Q  + R L+   +    P  + A E  L L                P  LV++ +++    E    L   Q+     F+  K+   E  K  IEQ   ++ Q+ EL  ++  +S +L+   ++    ++  E YR++   L    +   +     E     L   LQA    L+  +++L++ +   D+ K   +RL  E++        Q  + +N+ S++  LE S+  ++ ++  +IE  E+ +      L++R EN         E+   +L+ RN  +   D   Q++  + +  +T E+++   +     L N R Q+ S +++L +  + +    SE     LR++I + +N ++E TE+                                 + +E Q+ + QE+ ++      E+  E   + EE +K  A+++Q+L   ++ LS+++  L+      A    +  Q ++D  +  K + EA+ KY+RE+ LHAAD + L+AA+ +        Q LE+   I  A L   ++  ++ E+  K++  +IQSR ++L+R+       N+ L+EQ++ ++ +
Sbjct:  162 LQLKLEESETSEVSIKYKEKRMEQEKDLLQSQVTWLNTELKAKSEELLSLSRQRGNEILELQCNLNNKEDEITRLQDQVTSLKASNETFQKQAEEMIIKMREAKEQQAALEEKFSNELNANIKLSNLYKGAAADAEAKSEELSRAVDELHKLLKEAGEAHKDLEVKMADLESHKNKEIAELKEKISSQEKELDNANDLLSDSRHRGAASILTEEQVTI-------MSPTAAAVAKMIKPGMKLTEIYTAYVETQEHLQREKLENKRLHKYLDDIVQEMEAKAPILKRQREEYERMQKSVSSLSAKLEQAVTEVHRLQKESDESNKRASVLERDNQRFEVQLADMAQQVRVLLVELEEARGNHVMREDDDVGSADVSSTSEVISQHLVTFRSVEELQQQNQRLLVALRDLSEEKEKDELEGDTMKRSEVEKYLEELQRELEQLKEKRTQDLQKVDTVARQRDMFRMLLTQTTGVTFPQGAGAEE--LMLTSTPRRSPAVTPTTGTPTALVATAIESTESVEAKAALKQLQEV----FVAYKKEKIESEKAQIEQNEKLQDQVTELRSENMKISTQLEFTSKRYEMLQDNVEGYRKDIASLNEKLQKQAAAIQQSEQTTHTLTQDLQAAAEKLSIAESELENLRKERDMLKLVEIRLTQEKESFQAQQLGQNMLLTNLKSIQTTLERSETETRQRLTAQIEKQEREI----TQLQKRLEN---------EVEQKHLLARNQDVQLMDTKKQLEAQIAQHHKTKEQLSAAQL----ELTNLRLQLNSGESRLASAAVHTGLQGSERDMEVLRAQIRQTENRIEELTERLKNTTASMEQYKAMSLSLEESLDKEKQVTEQVRSSVENQVEAAQEQYKRLEQKLLEMDKEKQNLLEEKNKAVAAVEQELTELRKSLSSVQAELQSAQEKAAVAAAQEQQALLDGQEQAKMAAEAQDKYEREMLLHAADVEALQAAKAQAQQASLVRQQLEEKVQITSAQLLEARVSWEEQEKILKEEQCKIQSRCENLQRQ-------NKLLHEQIQTLSGQ 1171          
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Xenopus
Match: sos2 (SOS Ras/Rho guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-1006170])

HSP 1 Score: 79.7221 bits (195), Expect = 3.878e-14
Identity = 244/1095 (22.28%), Postives = 490/1095 (44.75%), Query Frame = 3
Query:   78 TNCNTKNLLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDIYDLREQINNLKVINEELSRSYEDSSNQMKNDIQDKDLEIHRIRNEILQLQQNGISEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKRNYDSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQSKQSDLER----QLMVSRKNLQSSNSEIERLNEQVSLFIVVAE--NGSQIKQ-------------EAVDADSGLYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKCEELQKYVDKTTEEINQLRQGNSVNKSQITLHE---KQIQLLRYL------IELKSPGSSAAIENGLKLIEFGNIVNLDCDEEMEPELVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQAKISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLRE---------REENIESLKMQLEEIRALNLIRNSI-----SYCDVSC-QVDISLFE---------DFETNEEINTKTMIDE-----------GALINC---RNQIVSLQAQLIADKLESDHSLSELRSEIDKYKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQSLEKSF--GIERANLKL-----EMKDSEQCRKQQIEEIQSRYKDLERK----LQECENRNEKLYEQLKE------INSEG-SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERY-------ENEISRLRESL 3089
             N     L ++L+ ++S E   K +E    ++KE+L+        EL+ K+E + ++++    +   L   L+ K +E+ ++  +   LK  N   Q+  +  + +L+  +       + F  EL    +L   Y+S+S+  + K + +T   E+  + + +  E  ++  ++ +++     +   +++N     DL     R  +L      +SE  L  M+P AA+  KV K    L E+Y+     +   D+L MEK   KR    L+  +   +     LK + EE  +M +++ S    L   +R  Q  Q + ++      ++ R+N Q    +++ L++Q+ + ++  E   G+ +++             E +      Y ++ ELQ+ N+ L +   +L    E  + E    +  EL+K ++    E+ QLR+  S    Q+TL E   +Q  + R L      + L +P   +      K      +V+        P  V+S  D+    E    L   Q+ +   +   K  +D +     ++++ Q+ EL  ++  +S +L+ A ++    ++  E YR+E   L+   + L + +   E  I  L   L+A    LA  +   ++ K   +L K   +RL  ER+  +     Q  + +N+ +++  LE S+   K +  N+IE LE+ + +T   L           + ++++ L+++ +    LNL  N+      S+ ++S  +  ++ FE         + E  EEI TK    E            A  N    R+ ++SL+  L  +K  ++    E R  I+     L+E++E  + LE ++   EK +QE+  E  K  E+  +    L+Q   + Q E+     R   + + E+  ++   +  + + EA+ KY+REL LHAAD + L+AA++++ +  S+ + F    ++A  +L       ++ E+  K+++ +IQSR +DLE++     ++ E+ ++K+   ++E         EG S    MEI+  ++ + +I      ++ V+  RY       E E+  L++SL
Sbjct:  150 ANTAKMELQMKLDEIQSSEVSIKYREKRLEQEKELLQSQNTWLNGELKSKTEELLAVQKGKGNEILELKGALENKQDEVARLEDQVKSLKSCNENLQKQAEELMNKLKETKEQQASSEEKFHNELNANIKLCNLYKSASEDSEAKSTELTRAVEELHKLLKEAGECKSDYAIVEKDMGEKISNLERELENA---NDLLCSTKRKGVL------LSEEELTAMSPTAAAVAKVVKPGMKLTELYNAF---VETQDQLLMEKQENKRITKYLDEIVKEVEAKAPILKRQREEHERMQKTVASLSAKLEQAMREIQRMQDETDKANKCSSVLEREN-QRLELQMKDLSQQIRVLLMELEEARGNYVQRDDDVSSANISSSSEVITQHLVTYRNIEELQQQNQRLLVALRELGEAKEREEQETTSSRVSELEKELEHALSELQQLREARS---HQMTLVESIVRQRDMYRILLSQTTGVSLPAPDEISLTSTPRKSPGVTQVVSTST-----PAAVAS--DSTEAAEAKAALKQLQE-VFENYRKEKAENDRMLNEQHDKLQEQVTELRSQNTKISTQLEFASKRYEMLQDNVEGYRREITTLQEKTQKLSATTQKQEQIINTLTQDLRAANEKLAVAEVRAENLKREKELLKMSEVRLTQERESLIAEQRGQNLLLTNLQTIQVTLERSETEIKQRYNNQIERLEQELAQTKKKLEHEIEQRHLLGKNQDVQVLELKKQYETELNLHNNTKELLKNSHKEISVLKQQLNSFELQLASHKDVNIEDVEEIKTKLRQSEEQVNDLKERLKTATSNVEQYRSVVLSLEESLNKEKQVTE----EARKTIEVR---LKEASEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVTQLRQSHSSLQAEVQQALQRATTSASNEQKAKQDCQEQARIAAEAQNKYERELMLHAADVEALQAAKEQLASAASVRQKFEETAQKAESQLLECTASWEERERMLKEEVSQIQSRCEDLEKQNRLLHEQIESLSKKMVSSVQEGALNISFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMEREVHELQDSL 1213          
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Xenopus
Match: sos2 (SOS Ras/Rho guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-1006170])

HSP 1 Score: 78.5666 bits (192), Expect = 9.187e-14
Identity = 250/1108 (22.56%), Postives = 495/1108 (44.68%), Query Frame = 3
Query:   78 TNCNTKNLLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDIYDLREQINNLKVINEELSRSYEDSSNQMKNDIQDK----DLEIHRIRNEILQLQQNGI--SEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKRNYDSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQSKQSDLER----QLMVSRKNLQSSNSEIERLNEQVSLFIVVAE--NGSQIKQ-------------EAVDADSGLYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKCEELQKYVDKTTEEINQLRQGNSVNKSQITLHE---KQIQLLRYL------IELKSPGSSAAIENGLKLIEFGNIVNLDCDEEMEPELVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQAKISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLRE---------REENIESLKMQLEEIRALNLIRNS----------------------ISYCDVSCQVDISLFEDFETNEEINTKTMIDE-----------GALINC---RNQIVSLQAQLIADKLESDHSLSELRSEIDKYKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQSLEKSF--GIERANLKL-----EMKDSEQCRKQQIEEIQSRYKDLERK----LQECENRNEKLYEQLKE------INSEG-SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERY-------ENEISRLRESL 3089
             N     L ++L+ ++S E   K +E    ++KE+L+        EL+ K+E + ++++    +   L   L+ K +E+ ++  +   LK  N   Q+  +  + +L+  +       + F  EL    +L   Y+S+S+  + K + +T   E+  +    L+E   + K I E+LS+  + +  Q++ D+ +K    + E+    + +   ++ G+  SE  L  M+P AA+  KV K    L E+Y+     +   D+L MEK   KR    L+  +   +     LK + EE  +M +++ S    L   +R  Q  Q + ++      ++ R+N Q    +++ L++Q+ + ++  E   G+ +++             E +      Y ++ ELQ+ N+ L +   +L    E  + E    +  EL+K ++    E+ QLR+  S    Q+TL E   +Q  + R L      + L +P   +      K      +V+        P  V+S  D+    E    L   Q+ +   +   K  +D +     ++++ Q+ EL  ++  +S +L+ A ++    ++  E YR+E   L+   + L + +   E  I  L   L+A    LA  +   ++ K   +L K   +RL  ER+  +     Q  + +N+ +++  LE S+   K +  N+IE LE+ + +T   L           + ++++ L+++ +    LNL  N+                      +     S Q D+++ ED E   EI TK    E            A  N    R+ ++SL+  L  +K  ++    E R  I+     L+E++E  + LE ++   EK +QE+  E  K  E+  +    L+Q   + Q E+     R   + + E+  ++   +  + + EA+ KY+REL LHAAD + L+AA++++ +  S+ + F    ++A  +L       ++ E+  K+++ +IQSR +DLE++     ++ E+ ++K+   ++E         EG S    MEI+  ++ + +I      ++ V+  RY       E E+  L++SL
Sbjct:  155 ANTAKMELQMKLDEIQSSEVSIKYREKRLEQEKELLQSQNTWLNGELKSKTEELLAVQKGKGNEILELKGALENKQDEVARLEDQVKSLKSCNENLQKQAEELMNKLKETKEQQASSEEKFHNELNANIKLCNLYKSASEDSEAKSTELTRAVEELHKL---LKEAGESNKSIQEQLSQ-MDAAKIQVEKDMGEKISNLERELENANDLLCSTKRKGVLLSEEELTAMSPTAAAVAKVVKPGMKLTELYNAF---VETQDQLLMEKQENKRITKYLDEIVKEVEAKAPILKRQREEHERMQKTVASLSAKLEQAMREIQRMQDETDKANKCSSVLEREN-QRLELQMKDLSQQIRVLLMELEEARGNYVQRDDDVSSANISSSSEVITQHLVTYRNIEELQQQNQRLLVALRELGEAKEREEQETTSSRVSELEKELEHALSELQQLREARS---HQMTLVESIVRQRDMYRILLSQTTGVSLPAPDEISLTSTPRKSPGVTQVVSTST-----PAAVAS--DSTEAAEAKAALKQLQE-VFENYRKEKAENDRMLNEQHDKLQEQVTELRSQNTKISTQLEFASKRYEMLQDNVEGYRREITTLQEKTQKLSATTQKQEQIINTLTQDLRAANEKLAVAEVRAENLKREKELLKMSEVRLTQERESLIAEQRGQNLLLTNLQTIQVTLERSETEIKQRYNNQIERLEQELAQTKKKLEHEIEQRHLLGKNQDVQVLELKKQYETELNLHNNTKELLKNSHKEISVLKQQLNSFELQLASRSSQQDVNI-EDVE---EIKTKLRQSEEQVNDLKERLKTATSNVEQYRSVVLSLEESLNKEKQVTE----EARKTIEVR---LKEASEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVTQLRQSHSSLQAEVQQALQRATTSASNEQKAKQDCQEQARIAAEAQNKYERELMLHAADVEALQAAKEQLASAASVRQKFEETAQKAESQLLECTASWEERERMLKEEVSQIQSRCEDLEKQNRLLHEQIESLSKKMVSSVQEGALNISFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMEREVHELQDSL 1232          
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Xenopus
Match: sos2 (SOS Ras/Rho guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-1006170])

HSP 1 Score: 78.1814 bits (191), Expect = 1.157e-13
Identity = 249/1101 (22.62%), Postives = 494/1101 (44.87%), Query Frame = 3
Query:   99 LLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDIYDLREQINNLKVINEELSRSYEDSSNQMKNDIQDK----DLEIHRIRNEILQLQQNGI--SEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKRNYDSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQSKQSDLER----QLMVSRKNLQSSNSEIERLNEQVSLFIVVAE--NGSQIKQ-------------EAVDADSGLYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKCEELQKYVDKTTEEINQLRQGNSVNKSQITLHE---KQIQLLRYL------IELKSPGSSAAIENGLKLIEFGNIVNLDCDEEMEPELVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQAKISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLRE---------REENIESLKMQLEEIRALNLIRNS----------------------ISYCDVSCQVDISLFEDFETNEEINTKTMIDE-----------GALINC---RNQIVSLQAQLIADKLESDHSLSELRSEIDKYKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQSLEKSF--GIERANLKL-----EMKDSEQCRKQQIEEIQSRYKDLERK----LQECENRNEKLYEQLKE------INSEG-SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERY-------ENEISRLRESL 3089
            L ++L+ ++S E   K +E    ++KE+L+        EL+ K+E + ++++    +   L   L+ K +E+ ++  +   LK  N   Q+  +  + +L+  +       + F  EL    +L   Y+S+S+  + K + +T   E+  +    L+E   + K I E+LS+  + +  Q++ D+ +K    + E+    + +   ++ G+  SE  L  M+P AA+  KV K    L E+Y+     +   D+L MEK   KR    L+  +   +     LK + EE  +M +++ S    L   +R  Q  Q + ++      ++ R+N Q    +++ L++Q+ + ++  E   G+ +++             E +      Y ++ ELQ+ N+ L +   +L    E  + E    +  EL+K ++    E+ QLR+  S    Q+TL E   +Q  + R L      + L +P   +      K      +V+        P  V+S  D+    E    L   Q+ +   +   K  +D +     ++++ Q+ EL  ++  +S +L+ A ++    ++  E YR+E   L+   + L + +   E  I  L   L+A    LA  +   ++ K   +L K   +RL  ER+  +     Q  + +N+ +++  LE S+   K +  N+IE LE+ + +T   L           + ++++ L+++ +    LNL  N+                      +     S Q D+++ ED E   EI TK    E            A  N    R+ ++SL+  L  +K  ++    E R  I+     L+E++E  + LE ++   EK +QE+  E  K  E+  +    L+Q   + Q E+     R   + + E+  ++   +  + + EA+ KY+REL LHAAD + L+AA++++ +  S+ + F    ++A  +L       ++ E+  K+++ +IQSR +DLE++     ++ E+ ++K+   ++E         EG S    MEI+  ++ + +I      ++ V+  RY       E E+  L++SL
Sbjct:  198 LQMKLDEIQSSEVSIKYREKRLEQEKELLQSQNTWLNGELKSKTEELLAVQKGKGNEILELKGALENKQDEVARLEDQVKSLKSCNENLQKQAEELMNKLKETKEQQASSEEKFHNELNANIKLCNLYKSASEDSEAKSTELTRAVEELHKL---LKEAGESNKSIQEQLSQ-MDAAKIQVEKDMGEKISNLERELENANDLLCSTKRKGVLLSEEELTAMSPTAAAVAKVVKPGMKLTELYNAF---VETQDQLLMEKQENKRITKYLDEIVKEVEAKAPILKRQREEHERMQKTVASLSAKLEQAMREIQRMQDETDKANKCSSVLEREN-QRLELQMKDLSQQIRVLLMELEEARGNYVQRDDDVSSANISSSSEVITQHLVTYRNIEELQQQNQRLLVALRELGEAKEREEQETTSSRVSELEKELEHALSELQQLREARS---HQMTLVESIVRQRDMYRILLSQTTGVSLPAPDEISLTSTPRKSPGVTQVVSTST-----PAAVAS--DSTEAAEAKAALKQLQE-VFENYRKEKAENDRMLNEQHDKLQEQVTELRSQNTKISTQLEFASKRYEMLQDNVEGYRREITTLQEKTQKLSATTQKQEQIINTLTQDLRAANEKLAVAEVRAENLKREKELLKMSEVRLTQERESLIAEQRGQNLLLTNLQTIQVTLERSETEIKQRYNNQIERLEQELAQTKKKLEHEIEQRHLLGKNQDVQVLELKKQYETELNLHNNTKELLKNSHKEISVLKQQLNSFELQLASRSSQQDVNI-EDVE---EIKTKLRQSEEQVNDLKERLKTATSNVEQYRSVVLSLEESLNKEKQVTE----EARKTIEVR---LKEASEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVTQLRQSHSSLQAEVQQALQRATTSASNEQKAKQDCQEQARIAAEAQNKYERELMLHAADVEALQAAKEQLASAASVRQKFEETAQKAESQLLECTASWEERERMLKEEVSQIQSRCEDLEKQNRLLHEQIESLSKKMVSSVQEGALNISFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMEREVHELQDSL 1268          
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Xenopus
Match: sos2 (SOS Ras/Rho guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-1006170])

HSP 1 Score: 77.7962 bits (190), Expect = 1.391e-13
Identity = 250/1104 (22.64%), Postives = 498/1104 (45.11%), Query Frame = 3
Query:   99 LLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDIYDLREQINNLKVINEELSRSYEDSSNQMKNDIQDK----DLEIHRIRNEILQLQQNGI--SEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKRNYDSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQSKQSDLER----QLMVSRKNLQSSNSEIERLNEQVSLFIVVAE--NGSQIKQ-------------EAVDADSGLYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKCEELQKYVDKTTEEINQLRQGNSVNKSQITLHE---KQIQLLRYL------IELKSPGSSAAIENGLKLIEFGNIVNLDCDEEMEPELVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQA---KISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLRE---------REENIESLKMQLEEIRALNLIRNS----------------------ISYCDVSCQVDISLFEDFETNEEINTKTMIDE-----------GALINC---RNQIVSLQAQLIADKLESDHSLSELRSEIDKYKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQSLEKSF--GIERANLKL-----EMKDSEQCRKQQIEEIQSRYKDLERK----LQECENRNEKLYEQLKE------INSEG-SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERY-------ENEISRLRESL 3089
            L ++L+ ++S E   K +E    ++KE+L+        EL+ K+E + ++++    +   L   L+ K +E+ ++  +   LK  N   Q+  +  + +L+  +       + F  EL    +L   Y+S+S+  + K + +T   E+  +    L+E   + K I E+LS+  + +  Q++ D+ +K    + E+    + +   ++ G+  SE  L  M+P AA+  KV K    L E+Y+     +   D+L MEK   KR    L+  +   +     LK + EE  +M +++ S    L   +R  Q  Q + ++      ++ R+N Q    +++ L++Q+ + ++  E   G+ +++             E +      Y ++ ELQ+ N+ L +   +L    E  + E    +  EL+K ++    E+ QLR+  S    Q+TL E   +Q  + R L      + L +P   +      K      +V+        P  V+S  D+    E    L   Q+ +   +   K  +D +     ++++ Q+ EL  ++  +S +L+ A ++    ++  E YR+E   L+   + L + +   E  I  L   L+A   K+++   R  +L   K LL +++   +RL  ER+  +     Q  + +N+ +++  LE S+   K +  N+IE LE+ + +T   L           + ++++ L+++ +    LNL  N+                      +     S Q D+++ ED E   EI TK    E            A  N    R+ ++SL+  L  +K  ++    E R  I+     L+E++E  + LE ++   EK +QE+  E  K  E+  +    L+Q   + Q E+     R   + + E+  ++   +  + + EA+ KY+REL LHAAD + L+AA++++ +  S+ + F    ++A  +L       ++ E+  K+++ +IQSR +DLE++     ++ E+ ++K+   ++E         EG S    MEI+  ++ + +I      ++ V+  RY       E E+  L++SL
Sbjct:  186 LQMKLDEIQSSEVSIKYREKRLEQEKELLQSQNTWLNGELKSKTEELLAVQKGKGNEILELKGALENKQDEVARLEDQVKSLKSCNENLQKQAEELMNKLKETKEQQASSEEKFHNELNANIKLCNLYKSASEDSEAKSTELTRAVEELHKL---LKEAGESNKSIQEQLSQ-MDAAKIQVEKDMGEKISNLERELENANDLLCSTKRKGVLLSEEELTAMSPTAAAVAKVVKPGMKLTELYNAF---VETQDQLLMEKQENKRITKYLDEIVKEVEAKAPILKRQREEHERMQKTVASLSAKLEQAMREIQRMQDETDKANKCSSVLEREN-QRLELQMKDLSQQIRVLLMELEEARGNYVQRDDDVSSANISSSSEVITQHLVTYRNIEELQQQNQRLLVALRELGEAKEREEQETTSSRVSELEKELEHALSELQQLREARS---HQMTLVESIVRQRDMYRILLSQTTGVSLPAPDEISLTSTPRKSPGVTQVVSTST-----PAAVAS--DSTEAAEAKAALKQLQE-VFENYRKEKAENDRMLNEQHDKLQEQVTELRSQNTKISTQLEFASKRYEMLQDNVEGYRREITTLQEKTQKLSATTQKQEQIINTLTQDLRAANEKLAVAEVRAENLKREKELLKMSE---VRLTQERESLIAEQRGQNLLLTNLQTIQVTLERSETEIKQRYNNQIERLEQELAQTKKKLEHEIEQRHLLGKNQDVQVLELKKQYETELNLHNNTKELLKNSHKEISVLKQQLNSFELQLASRSSQQDVNI-EDVE---EIKTKLRQSEEQVNDLKERLKTATSNVEQYRSVVLSLEESLNKEKQVTE----EARKTIEVR---LKEASEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVTQLRQSHSSLQAEVQQALQRATTSASNEQKAKQDCQEQARIAAEAQNKYERELMLHAADVEALQAAKEQLASAASVRQKFEETAQKAESQLLECTASWEERERMLKEEVSQIQSRCEDLEKQNRLLHEQIESLSKKMVSSVQEGALNISFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMEREVHELQDSL 1256          
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Xenopus
Match: sos2 (SOS Ras/Rho guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-1006170])

HSP 1 Score: 76.2554 bits (186), Expect = 3.852e-13
Identity = 245/1098 (22.31%), Postives = 491/1098 (44.72%), Query Frame = 3
Query:   90 TKNLLVELESLRSKESIY-----KMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDIYDLREQINNLKVINEELSRSYEDSSNQMKNDIQDKDLEIHRIRNEILQLQQNGI--SEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKRNYDSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQSKQSDLER----QLMVSRKNLQSSNSEIERLNEQVSLFIVVAE--NGSQIKQ-------------EAVDADSGLYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKCEELQKYVDKTTEEINQLRQGNSVNKSQITLHE---KQIQLLRYL------IELKSPGSSAAIENGLKLIEFGNIVNLDCDEEMEPELVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQAKISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLRE---------REENIESLKMQLEEIRALNLIRNSI-----SYCDVSC-QVDISLFE---------DFETNEEINTKTMIDE-----------GALINC---RNQIVSLQAQLIADKLESDHSLSELRSEIDKYKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQSLEKSF--GIERANLKL-----EMKDSEQCRKQQIEEIQSRYKDLERK----LQECENRNEKLYEQLKE------INSEG-SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERY-------ENEISRLRESL 3089
            T  LL  ++S  + ++IY     K +E    ++KE+L+        EL+ K+E + ++++    +   L   L+ K +E+ ++  +   LK  N   Q+  +  + +L+  +       + F  EL    +L   Y+S+S+  + K + +T   E+  + + +  E  ++  + ++  +  Y+     M   I + + E+    + +   ++ G+  SE  L  M+P AA+  KV K    L E+Y+     +   D+L MEK   KR    L+  +   +     LK + EE  +M +++ S    L   +R  Q  Q + ++      ++ R+N Q    +++ L++Q+ + ++  E   G+ +++             E +      Y ++ ELQ+ N+ L +   +L    E  + E    +  EL+K ++    E+ QLR+  S    Q+TL E   +Q  + R L      + L +P   +      K      +V+        P  V+S  D+    E    L   Q+ +   +   K  +D +     ++++ Q+ EL  ++  +S +L+ A ++    ++  E YR+E   L+   + L + +   E  I  L   L+A    LA  +   ++ K   +L K   +RL  ER+  +     Q  + +N+ +++  LE S+   K +  N+IE LE+ + +T   L           + ++++ L+++ +    LNL  N+      S+ ++S  +  ++ FE         + E  EEI TK    E            A  N    R+ ++SL+  L  +K     S  E+R         L+E++E  + LE ++   EK +QE+  E  K  E+  +    L+Q   + Q E+     R   + + E+  ++   +  + + EA+ KY+REL LHAAD + L+AA++++ +  S+ + F    ++A  +L       ++ E+  K+++ +IQSR +DLE++     ++ E+ ++K+   ++E         EG S    MEI+  ++ + +I      ++ V+  RY       E E+  L++SL
Sbjct:  115 TYYLLYNVDSETNNKAIYVLLFNKYREKRLEQEKELLQSQNTWLNGELKSKTEELLAVQKGKGNEILELKGALENKQDEVARLEDQVKSLKSCNENLQKQAEELMNKLKETKEQQASSEEKFHNELNANIKLCNLYKSASEDSEAKSTELTRAVEELHKLLKEAGECKSDYAIGSKNTAIWYQ----YMGEKISNLERELENANDLLCSTKRKGVLLSEEELTAMSPTAAAVAKVVKPGMKLTELYNAF---VETQDQLLMEKQENKRITKYLDEIVKEVEAKAPILKRQREEHERMQKTVASLSAKLEQAMREIQRMQDETDKANKCSSVLEREN-QRLELQMKDLSQQIRVLLMELEEARGNYVQRDDDVSSANISSSSEVITQHLVTYRNIEELQQQNQRLLVALRELGEAKEREEQETTSSRVSELEKELEHALSELQQLREARS---HQMTLVESIVRQRDMYRILLSQTTGVSLPAPDEISLTSTPRKSPGVTQVVSTST-----PAAVAS--DSTEAAEAKAALKQLQE-VFENYRKEKAENDRMLNEQHDKLQEQVTELRSQNTKISTQLEFASKRYEMLQDNVEGYRREITTLQEKTQKLSATTQKQEQIINTLTQDLRAANEKLAVAEVRAENLKREKELLKMSEVRLTQERESLIAEQRGQNLLLTNLQTIQVTLERSETEIKQRYNNQIERLEQELAQTKKKLEHEIEQRHLLGKNQDVQVLELKKQYETELNLHNNTKELLKNSHKEISVLKQQLNSFELQLASHKDVNIEDVEEIKTKLRQSEEQVNDLKERLKTATSNVEQYRSVVLSLEESLNKEKQVHLRSSLEVR---------LKEASEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVTQLRQSHSSLQAEVQQALQRATTSASNEQKAKQDCQEQARIAAEAQNKYERELMLHAADVEALQAAKEQLASAASVRQKFEETAQKAESQLLECTASWEERERMLKEEVSQIQSRCEDLEKQNRLLHEQIESLSKKMVSSVQEGALNISFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMEREVHELQDSL 1184          
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Mouse
Match: Tpr (translocated promoter region, nuclear basket protein [Source:MGI Symbol;Acc:MGI:1922066])

HSP 1 Score: 56.9954 bits (136), Expect = 1.763e-12
Identity = 257/1191 (21.58%), Postives = 524/1191 (44.00%), Query Frame = 3
Query:   78 TNCNTKNLLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDIYDLREQINNL-KVINEELSRSYEDSSNQMKNDIQDK----DLEIHRIRNEILQLQQNG--ISEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKR--NY-DSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQSKQSDLERQLMVSRKNLQSSNSEIERLNEQVSLFIVVAE--NGSQI-------------KQEAVDADSGLYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKCEELQKYVDKTTEEINQLRQGNSVNKSQITLHEKQIQLLRYLIELKSPGSSAAIENGLKLIEFGNIVNLDCDEE---------MEPELVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQA---KISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLREREENIESLKMQLE-EI-RALNLIRN-SISYCDVSCQVDISLFEDFETNEEINTKTMIDEGA--LINCRNQIVSLQAQLIADKLE-SDHSLSELRSEIDKYKNELQESTEKC----AFLETQISLQEKARQEI------LSENIKITEEAHK-----------MNASL----------KQDLHNS--------QEELSAMKIRLEEAETVERTVQEVIDKY-----------------IKESNEAKAKYKRELTLHAADSKILEAARKEIDTL----QSLEKSFGIERANL---KLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQL-------------KEINSEG-SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERYENEISRLRESLSDTNKESKVKIERLNKRLSGNSVS----LILDPE---VIRESNCVLRQQKEQLERNLINVKCEVEDL 3269
            +N     L ++L+ L++ +   K +E    ++KE+L +       EL+ K++ + +L R+   +   L  +L+ K  E+ ++  + + LK  N   Q+ ++  + +L+  +       + F  EL    +L+  Y+S++   + K    +NE  +   +++ L ++     K I + L +  E+S +QM+ ++ +K    + E+    + +   ++ G  +SE  L  M+P AA+  K+ K    L E+Y   +  +   D+L +EK   KR   Y D +  E+      + + + E E   K   SL ++L   + +++  Q       +   V  ++ Q    +I+ L++Q+ + ++  E   G+ +               E +      Y ++ ELQ+ N+ L     +L    E  + E    K  ELQ  ++ +  E+ QLR+        +    +Q  + R L+   S  +  AI   L+     +I  L   +            PE V    + +  +   +QL    +    E ID+++  +E     +E+++ Q+ +L  ++  +S +LD A ++    ++  E YR+E   L+  N+ L + +   E  I  +   L+    K+++   R  +L   K +L L++   +RL  +R+  +     Q  + +N+ +++  LE S+  +K ++ ++IE LE                I  LK +LE E+ +   L RN  +   D   Q+D       E N  +NTK ++      +   +  + +++AQL +   + +       R ++D  K++L+++ E+       L+T  S  E+ R  +      L++  ++TEE HK               L          KQ+L +         +++LS +K  L    TV+  VQE + +                   K + EA+ KY+REL LHAAD + L+AA++++  +    Q LE++     + L   K   ++ E+  K ++ +  SR +DLE++ +   ++ EKL +++               +N EG S    +EI+  ++ + +I      ++ V+  RY   +            +  + +ER   +++  +++    L+   E   V+ E+N +LR++KE+LE+NL  ++ +V  L
Sbjct:  155 SNTTKGELQLKLDELQASDVAVKYREKRLEQEKELLHNQNSWLNTELKTKTDELLALGREKGNEILELKCNLENKKEEVLRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAK----SNELTRAVDELHKLLKEAGEANKTIQDHLLQ-VEESKDQMEKEMLEKIGKLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELY---NAYVETQDQLLLEKQENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSAKLEQAMKEIQRLQEDTDKANKHSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSYRNIEELQQQNQRLLFALRELGETREREEQETTSSKIAELQHKLENSLAELEQLRESRQHQMQLVDSIVRQRDMYRILL---SQTTGMAIP--LQASSLDDISLLSTPKRSSTSQTVSTPAPEPVIDSTEAIEAKAALKQLQEIFENYKKEKIDSEKLQNE----QLEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLQERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSE---VRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLNSQIEKLE--------------HEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDT------EINLHLNTKELLKNAQKDIATLKQHLNNMEAQLASQSTQRTGKGQPGDRDDVDDLKSQLRQAEEQVNDLKERLKTSTSNVEQYRAMVTSLEDSLNKEKQVTEEVHKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRKAIESMEQQLSELKKTLS---TVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMTSIRQHLEETTQKAESQLLECKASWEERERVLKDEVSKSVSRCEDLEKQNRLLHDQIEKLSDKVVTSMKDAVQAPLNVSLNEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVE--LLERELQELQDSLNVEREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQNLQQMQAKVRKL 1300          

HSP 2 Score: 36.5798 bits (83), Expect = 1.763e-12
Identity = 54/217 (24.88%), Postives = 106/217 (48.85%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQEL--EIN-LKETKNSDRVKMEEDLQKIKNLEKDLEKAELDRKKLE-ELSNKLT-VGERI--VAQLKDIGRKHKGESEKRGQYISELERKMLEFQEQLESLSDEKDQSIEKLNRKETEFEMAAKELKELRTRCEILEKVNKNRENTIGELNVNVEQLKSDL 3934
            EL E+   L   K  LE++  RWK R  +L+ + +  D E+YR   ++++ + K  Q+L  E+  LK         +  +   I++L +DL KA  +++ ++ +L  K+  + E++  + Q+K IGR++K + E+    +   + K +E   Q      E+  S++++   +     +  + K L  + E L+K    +E     L     QL+S+L
Sbjct: 1313 ELSEKSGMLQAEKKLLEEDVKRWKARNQQLINQQKDPDTEEYRKLLSEKEIHTKRIQQLNEEVGRLKAEIARSNASLTNNQNLIQSLREDLSKARTEKEGIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQFEE----LKAQQNKAMETSTQSSGDHQEQHISVQEMQELKDTLSQSETKTKSLEGQVENLQKTLSEKETEARSLQEQTVQLQSEL 1525          
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Mouse
Match: Tpr (translocated promoter region, nuclear basket protein [Source:MGI Symbol;Acc:MGI:1922066])

HSP 1 Score: 56.225 bits (134), Expect = 3.297e-12
Identity = 257/1191 (21.58%), Postives = 524/1191 (44.00%), Query Frame = 3
Query:   78 TNCNTKNLLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDIYDLREQINNL-KVINEELSRSYEDSSNQMKNDIQDK----DLEIHRIRNEILQLQQNG--ISEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKR--NY-DSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQSKQSDLERQLMVSRKNLQSSNSEIERLNEQVSLFIVVAE--NGSQI-------------KQEAVDADSGLYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKCEELQKYVDKTTEEINQLRQGNSVNKSQITLHEKQIQLLRYLIELKSPGSSAAIENGLKLIEFGNIVNLDCDEE---------MEPELVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQA---KISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLREREENIESLKMQLE-EI-RALNLIRN-SISYCDVSCQVDISLFEDFETNEEINTKTMIDEGA--LINCRNQIVSLQAQLIADKLE-SDHSLSELRSEIDKYKNELQESTEKC----AFLETQISLQEKARQEI------LSENIKITEEAHK-----------MNASL----------KQDLHNS--------QEELSAMKIRLEEAETVERTVQEVIDKY-----------------IKESNEAKAKYKRELTLHAADSKILEAARKEIDTL----QSLEKSFGIERANL---KLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQL-------------KEINSEG-SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERYENEISRLRESLSDTNKESKVKIERLNKRLSGNSVS----LILDPE---VIRESNCVLRQQKEQLERNLINVKCEVEDL 3269
            +N     L ++L+ L++ +   K +E    ++KE+L +       EL+ K++ + +L R+   +   L  +L+ K  E+ ++  + + LK  N   Q+ ++  + +L+  +       + F  EL    +L+  Y+S++   + K    +NE  +   +++ L ++     K I + L +  E+S +QM+ ++ +K    + E+    + +   ++ G  +SE  L  M+P AA+  K+ K    L E+Y   +  +   D+L +EK   KR   Y D +  E+      + + + E E   K   SL ++L   + +++  Q       +   V  ++ Q    +I+ L++Q+ + ++  E   G+ +               E +      Y ++ ELQ+ N+ L     +L    E  + E    K  ELQ  ++ +  E+ QLR+        +    +Q  + R L+   S  +  AI   L+     +I  L   +            PE V    + +  +   +QL    +    E ID+++  +E     +E+++ Q+ +L  ++  +S +LD A ++    ++  E YR+E   L+  N+ L + +   E  I  +   L+    K+++   R  +L   K +L L++   +RL  +R+  +     Q  + +N+ +++  LE S+  +K ++ ++IE LE                I  LK +LE E+ +   L RN  +   D   Q+D       E N  +NTK ++      +   +  + +++AQL +   + +       R ++D  K++L+++ E+       L+T  S  E+ R  +      L++  ++TEE HK               L          KQ+L +         +++LS +K  L    TV+  VQE + +                   K + EA+ KY+REL LHAAD + L+AA++++  +    Q LE++     + L   K   ++ E+  K ++ +  SR +DLE++ +   ++ EKL +++               +N EG S    +EI+  ++ + +I      ++ V+  RY   +            +  + +ER   +++  +++    L+   E   V+ E+N +LR++KE+LE+NL  ++ +V  L
Sbjct:  229 SNTTKGELQLKLDELQASDVAVKYREKRLEQEKELLHNQNSWLNTELKTKTDELLALGREKGNEILELKCNLENKKEEVLRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAK----SNELTRAVDELHKLLKEAGEANKTIQDHLLQ-VEESKDQMEKEMLEKIGKLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELY---NAYVETQDQLLLEKQENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSAKLEQAMKEIQRLQEDTDKANKHSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSYRNIEELQQQNQRLLFALRELGETREREEQETTSSKIAELQHKLENSLAELEQLRESRQHQMQLVDSIVRQRDMYRILL---SQTTGMAIP--LQASSLDDISLLSTPKRSSTSQTVSTPAPEPVIDSTEAIEAKAALKQLQEIFENYKKEKIDSEKLQNE----QLEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLQERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSE---VRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLNSQIEKLE--------------HEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDT------EINLHLNTKELLKNAQKDIATLKQHLNNMEAQLASQSTQRTGKGQPGDRDDVDDLKSQLRQAEEQVNDLKERLKTSTSNVEQYRAMVTSLEDSLNKEKQVTEEVHKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRKAIESMEQQLSELKKTLS---TVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMTSIRQHLEETTQKAESQLLECKASWEERERVLKDEVSKSVSRCEDLEKQNRLLHDQIEKLSDKVVTSMKDAVQAPLNVSLNEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVE--LLERELQELQDSLNVEREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQNLQQMQAKVRKL 1374          

HSP 2 Score: 36.5798 bits (83), Expect = 3.297e-12
Identity = 54/217 (24.88%), Postives = 106/217 (48.85%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQEL--EIN-LKETKNSDRVKMEEDLQKIKNLEKDLEKAELDRKKLE-ELSNKLT-VGERI--VAQLKDIGRKHKGESEKRGQYISELERKMLEFQEQLESLSDEKDQSIEKLNRKETEFEMAAKELKELRTRCEILEKVNKNRENTIGELNVNVEQLKSDL 3934
            EL E+   L   K  LE++  RWK R  +L+ + +  D E+YR   ++++ + K  Q+L  E+  LK         +  +   I++L +DL KA  +++ ++ +L  K+  + E++  + Q+K IGR++K + E+    +   + K +E   Q      E+  S++++   +     +  + K L  + E L+K    +E     L     QL+S+L
Sbjct: 1387 ELSEKSGMLQAEKKLLEEDVKRWKARNQQLINQQKDPDTEEYRKLLSEKEIHTKRIQQLNEEVGRLKAEIARSNASLTNNQNLIQSLREDLSKARTEKEGIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQFEE----LKAQQNKAMETSTQSSGDHQEQHISVQEMQELKDTLSQSETKTKSLEGQVENLQKTLSEKETEARSLQEQTVQLQSEL 1599          
BLAST of TPR_MLP1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|F6ZDS4|TPR_MOUSE (Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 2.015e-11
Identity = 257/1191 (21.58%), Postives = 524/1191 (44.00%), Query Frame = 3
Query:   78 TNCNTKNLLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDIYDLREQINNL-KVINEELSRSYEDSSNQMKNDIQDK----DLEIHRIRNEILQLQQNG--ISEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKR--NY-DSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQSKQSDLERQLMVSRKNLQSSNSEIERLNEQVSLFIVVAE--NGSQI-------------KQEAVDADSGLYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKCEELQKYVDKTTEEINQLRQGNSVNKSQITLHEKQIQLLRYLIELKSPGSSAAIENGLKLIEFGNIVNLDCDEE---------MEPELVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQA---KISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLREREENIESLKMQLE-EI-RALNLIRN-SISYCDVSCQVDISLFEDFETNEEINTKTMIDEGA--LINCRNQIVSLQAQLIADKLE-SDHSLSELRSEIDKYKNELQESTEKC----AFLETQISLQEKARQEI------LSENIKITEEAHK-----------MNASL----------KQDLHNS--------QEELSAMKIRLEEAETVERTVQEVIDKY-----------------IKESNEAKAKYKRELTLHAADSKILEAARKEIDTL----QSLEKSFGIERANL---KLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQL-------------KEINSEG-SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERYENEISRLRESLSDTNKESKVKIERLNKRLSGNSVS----LILDPE---VIRESNCVLRQQKEQLERNLINVKCEVEDL 3269
            +N     L ++L+ L++ +   K +E    ++KE+L +       EL+ K++ + +L R+   +   L  +L+ K  E+ ++  + + LK  N   Q+ ++  + +L+  +       + F  EL    +L+  Y+S++   + K    +NE  +   +++ L ++     K I + L +  E+S +QM+ ++ +K    + E+    + +   ++ G  +SE  L  M+P AA+  K+ K    L E+Y   +  +   D+L +EK   KR   Y D +  E+      + + + E E   K   SL ++L   + +++  Q       +   V  ++ Q    +I+ L++Q+ + ++  E   G+ +               E +      Y ++ ELQ+ N+ L     +L    E  + E    K  ELQ  ++ +  E+ QLR+        +    +Q  + R L+   S  +  AI   L+     +I  L   +            PE V    + +  +   +QL    +    E ID+++  +E     +E+++ Q+ +L  ++  +S +LD A ++    ++  E YR+E   L+  N+ L + +   E  I  +   L+    K+++   R  +L   K +L L++   +RL  +R+  +     Q  + +N+ +++  LE S+  +K ++ ++IE LE                I  LK +LE E+ +   L RN  +   D   Q+D       E N  +NTK ++      +   +  + +++AQL +   + +       R ++D  K++L+++ E+       L+T  S  E+ R  +      L++  ++TEE HK               L          KQ+L +         +++LS +K  L    TV+  VQE + +                   K + EA+ KY+REL LHAAD + L+AA++++  +    Q LE++     + L   K   ++ E+  K ++ +  SR +DLE++ +   ++ EKL +++               +N EG S    +EI+  ++ + +I      ++ V+  RY   +            +  + +ER   +++  +++    L+   E   V+ E+N +LR++KE+LE+NL  ++ +V  L
Sbjct:  229 SNTTKGELQLKLDELQASDVAVKYREKRLEQEKELLHNQNSWLNTELKTKTDELLALGREKGNEILELKCNLENKKEEVLRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAK----SNELTRAVDELHKLLKEAGEANKTIQDHLLQ-VEESKDQMEKEMLEKIGKLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELY---NAYVETQDQLLLEKQENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSAKLEQAMKEIQRLQEDTDKANKHSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSYRNIEELQQQNQRLLFALRELGETREREEQETTSSKIAELQHKLENSLAELEQLRESRQHQMQLVDSIVRQRDMYRILL---SQTTGMAIP--LQASSLDDISLLSTPKRSSTSQTVSTPAPEPVIDSTEAIEAKAALKQLQEIFENYKKEKIDSEKLQNE----QLEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLQERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSE---VRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLNSQIEKLE--------------HEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDT------EINLHLNTKELLKNAQKDIATLKQHLNNMEAQLASQSTQRTGKGQPGDRDDVDDLKSQLRQAEEQVNDLKERLKTSTSNVEQYRAMVTSLEDSLNKEKQVTEEVHKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRKAIESMEQQLSELKKTLS---TVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMTSIRQHLEETTQKAESQLLECKASWEERERVLKDEVSKSVSRCEDLEKQNRLLHDQIEKLSDKVVTSMKDAVQAPLNVSLNEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVE--LLERELQELQDSLNVEREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQNLQQMQAKVRKL 1374          

HSP 2 Score: 36.5798 bits (83), Expect = 2.015e-11
Identity = 54/217 (24.88%), Postives = 106/217 (48.85%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQEL--EIN-LKETKNSDRVKMEEDLQKIKNLEKDLEKAELDRKKLE-ELSNKLT-VGERI--VAQLKDIGRKHKGESEKRGQYISELERKMLEFQEQLESLSDEKDQSIEKLNRKETEFEMAAKELKELRTRCEILEKVNKNRENTIGELNVNVEQLKSDL 3934
            EL E+   L   K  LE++  RWK R  +L+ + +  D E+YR   ++++ + K  Q+L  E+  LK         +  +   I++L +DL KA  +++ ++ +L  K+  + E++  + Q+K IGR++K + E+    +   + K +E   Q      E+  S++++   +     +  + K L  + E L+K    +E     L     QL+S+L
Sbjct: 1387 ELSEKSGMLQAEKKLLEEDVKRWKARNQQLINQQKDPDTEEYRKLLSEKEIHTKRIQQLNEEVGRLKAEIARSNASLTNNQNLIQSLREDLSKARTEKEGIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQFEE----LKAQQNKAMETSTQSSGDHQEQHISVQEMQELKDTLSQSETKTKSLEGQVENLQKTLSEKETEARSLQEQTVQLQSEL 1599          
BLAST of TPR_MLP1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|F1MA98|TPR_RAT (Nucleoprotein TPR OS=Rattus norvegicus OX=10116 GN=Tpr PE=1 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 1.274e-9
Identity = 83/316 (26.27%), Postives = 148/316 (46.84%), Query Frame = 3
Query: 2427 LQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTL----QSLEKSFGIERANL---KLEMKDSEQCRKQQIEEIQSRYKDLERK----LQECENRNEKLYEQLKEI---------NSEG-SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERYENEISRL--------------RESLSDTNKESKVKIERLNKRLSGNSVSLILDPEVIRESNCVLRQQKEQLERNLINVKCEVEDL 3269
            L+ES E    LE ++   EK +QE+  +  K  E   +    LK+ L + Q E+     R   A + E+  +    +  K + EA+ KY+REL LHAAD + L+AA++++  +    Q LE++     + L   K   ++ E+  K ++ +  SR +DLE++      + E  ++K+   +KE+         N EG S    +EI+  ++ + +I      ++ V+  RY   +  L              RE +  T K      E + K  + N         V+ E+N +LR++KE+LE+NL  ++ +V  L
Sbjct:  994 LKESAEFQTQLEKKLMEVEKEKQELQDDKRKAIESMEQQLTELKKTLSSVQSEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQLLECKASWEERERVLKDEVSKSVSRCEDLEKQNRLLHDQIEKLSDKVVTSMKEVVQSPLNISLNEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHEELMKKTETMN---------VVMETNKMLREEKERLEQNLQQMQAKVRKL 1300          

HSP 2 Score: 37.7354 bits (86), Expect = 1.274e-9
Identity = 57/225 (25.33%), Postives = 110/225 (48.89%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQEL---------EI---NLKETKNSDRVK-MEEDLQKIKNLEKDLEKAELDRKKLEELSNKLTVGERIVAQLKDIGRKHKGESEKRGQYISELERKMLEFQEQLESLSDEKDQ--SIEKLNRKETEFEMAAKELKELRTRCEILEKVNKNRENTIGELNVNVEQLKSDL 3934
            EL E+   L   K  LE++  RWK R   L+ + +  D E+YR   ++++ + K  Q+L         EI   N   T N + ++ ++EDL K++  ++ ++K +LD K + ++  K+    + + Q+K IGR++K + E       EL+ +    +   +S  D ++Q  S++++   +     +  + K L  + E L+K    +E     L     QL+S+L
Sbjct: 1313 ELSEKSGMLQAEKKLLEEDVKRWKARNQHLINQQKDPDTEEYRKLLSEKEIHTKRIQQLNEEVGRLKAEIARSNASLTNNQNLIQSLKEDLSKVRTEKESIQK-DLDAKII-DIQEKV----KTITQVKKIGRRYKTQFE-------ELKAQQKAMETSTQSSGDHQEQHISVQEMQELKDNLSQSETKTKSLEGQVENLQKTLSEKETEARSLQEQTAQLQSEL 1524          
BLAST of TPR_MLP1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P12270|TPR_HUMAN (Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3)

HSP 1 Score: 42.3578 bits (98), Expect = 3.992e-8
Identity = 146/636 (22.96%), Postives = 274/636 (43.08%), Query Frame = 3
Query: 1653 IEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQA---KISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLREREENIESLKMQLE-EI-RALNLIRN-SISYCDVSCQVDISLFEDFETNEEINTKTMIDEGA---------LINCRNQIVSLQAQLIA-----DKLESDHSLSELR-----------------SEIDKY----------------------KN---ELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTL----QSLEKSFGIERANL---KLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQLKEINSEG--------------SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERYENEISRL--------------RESLSDTNKESKVKIERLNKRLSGNSVSLILDPEVIRESNCVLRQQKEQLERNLINVKCEVEDL 3269
            +E+++ Q+ +L  ++  +S +LD A ++    ++  E YR+E   L   N+ L + +   E  I  +   L+    K+++   R  +L   K +L L++   +RL  +R+  +     Q  + +N+ +++  LE S+  +K ++ ++IE LE                I  LK +LE E+ +   L RN  +   D   Q+D       ETN  +NTK ++             L N   Q+ S  +Q        +K + D  +S+LR                 S +++Y                      KN    L+ES E    LE ++   EK +QE+  +  +  E   +  + LK+ L + Q E+     R   A + E+  +    +  K + EA+ KY+REL LHAAD + L+AA++++  +    Q LE++     + L   K   ++ E+  K ++ +   R +DLE++ +   ++ EKL +++     EG              S    +EI+  ++ + +I      ++ V+  RY   +  L              RE +  T K      E + K  + N         V+ E+N +LR++KE+LE++L  ++ +V  L
Sbjct:  697 LEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSE---VRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLSSQIEKLE--------------HEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDT------ETNLHLNTKELLKNAQKEIATLKQHLSNMEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTSNVEQYQAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRRAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHEELMKKTETMN---------VVMETNKMLREEKERLEQDLQQMQAKVRKL 1300          

HSP 2 Score: 39.2762 bits (90), Expect = 3.992e-8
Identity = 59/223 (26.46%), Postives = 109/223 (48.88%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQEL--EI----------NLKETKNSDRVK-MEEDLQKIKNLEKDLEKAELDRKKLEELSNKLTVGERIVAQLKDIGRKHKGESEKRGQYISELERKMLEFQEQLESLSDEKDQSIEKLNRKETEFEMAAKELKELRTRCEILEKVNKNRENTIGELNVNVEQLKSDL 3934
            EL E+   L   K  LE++  RWK R   LV + +  D E+YR   ++++ + K  Q+L  EI          N   T N + ++ ++EDL K++  EK+  + +LD K + ++  K+    + + Q+K IGR++K + E+    +   + K++E   Q      E+  S++++   +     A  + K L ++ E L+K    +E     L     QL+S+L
Sbjct: 1313 ELSEKSGMLQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLKEDLNKVRT-EKETIQKDLDAKII-DIQEKV----KTITQVKKIGRRYKTQYEE----LKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETLNQAETKSKSLESQVENLQKTLSEKETEARNLQEQTVQLQSEL 1525          
BLAST of TPR_MLP1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5EE04|TPR_XENLA (Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 5.518e-6
Identity = 62/239 (25.94%), Postives = 121/239 (50.63%), Query Frame = 3
Query: 2427 LQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQSLE-------KSFGIERANLKLEMKDSEQCRKQQIEEIQSRYKDLERK----LQECENRNEKLYEQLKE------INSEG-SNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERYENEISRLRESL 3089
            L+ES+E  + LE ++   EK +QE+  E  K  E+  +    L+Q L + Q E+     R   + + E+  ++   +  + + EA+ KY+REL LHAAD + L+AA+K++ +  ++        +  G +    +   ++ E+  K+++ +IQSR KDLE++     ++ E+ ++K+   ++E         EG S    MEI+  ++ + +I      ++ V+  RY   I  +   L
Sbjct:  669 LKESSEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVTQLRQSLSSLQAEVQQALQRATTSASNEQKAKQDCQEQARIAAEAQNKYERELMLHAADVEALQAAKKQLTSASAIRHKCEETAQKAGSQLLESRASWEERERMLKEEVSQIQSRCKDLEKQNGLLHEQIESLSKKMVTSVQEGALNMSFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMEREL 907          
BLAST of TPR_MLP1_2 domain-containing protein vs. TrEMBL
Match: H2KR53 (Nucleoprotein TPR OS=Clonorchis sinensis OX=79923 GN=CLF_105528 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 4.447e-35
Identity = 96/343 (27.99%), Postives = 169/343 (49.27%), Query Frame = 3
Query: 2409 DKYKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQS-------------------------LEKSFGIERANL--KLEMKDSEQCRKQ-QIEEIQSRYKDLERKLQECENRNEKLYEQLKE--INSEG------SNSNYMEIIEDLKNQIDIKNMSTNLSDV--------------QRERYENEI------SRLRESLSDTNKESKVKIERLNKRLSGNSVSLILDPEVIRESNCVLRQQKEQLERNLINVKCEVEDL 3269
            ++  +EL+++T++C FLE Q+ L++K RQ +++ENI+ TEEAH++NA L++ L + Q EL +++ R E A  +E   + VI+ + + + EA+ KY+REL+LHA D + L AAR+E+D  +S                         + +S+  ER  L  KL + D +Q   Q QI ++  +   L RKL E  N   +      E  +++E       ++ + ++++  L+ Q  I   + + S                QR+  + E+      S L    S  + E   ++E+LN               ++ ESN +LR ++E L+ NL   + +V DL
Sbjct: 1127 ERLGSELEQTTQRCEFLEAQLDLEKKERQNLVNENIRTTEEAHQLNAELRRQLSSLQGELDSIRTRCESALELEAGAKSVIEAHERAAQEARLKYERELSLHAEDVEALTAARQEVDNWKSKLADVQRQLTTSESRADTVAKELDDMSRSWDTERQELNEKLHLADKDQSLMQDQIIKLTQQLIAL-RKLMEKPNETTEPSGSTSELPVSAEAGVTDLKASEDLLQLVNYLRRQKSIAEATCDASAAEVSRLLLRVASLESQRDHLQTELENERRASELAAETSQRHSELMERVEQLN---------------LLTESNRLLRHERETLQANLKTSEGQVRDL 1453          

HSP 2 Score: 77.7962 bits (190), Expect = 4.447e-35
Identity = 55/145 (37.93%), Postives = 83/145 (57.24%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKY-RKL------SQELEINLKETKNSDRVKMEEDLQKIKNLEKDLEKAELDRKKLEE-----------LSNKLTVGERIVAQLKDIGRKHKGESE 3685
            EL  Q N+L   K  LE+E++RWKERC +LVE A++MDPEQYR+ACN+RD+  R+L       Q+  + L E+    R ++ E    +K  + +L +A   R+  EE           L  +L   E  V +L++IGRK++ E+E
Sbjct: 1466 ELMAQVNSLGTEKHSLEEERDRWKERCNRLVETAQRMDPEQYRMACNERDELQRQLRRAEEEVQQYSVKLNES----RTELNE---AVKRHDAELNEALASRQAAEEECVQHRSTCETLRKELEGKETTVVKLREIGRKYRQEAE 1603          
BLAST of TPR_MLP1_2 domain-containing protein vs. TrEMBL
Match: A0A419QBR3 (Nucleoprotein TPR (Fragment) OS=Clonorchis sinensis OX=79923 GN=tpr PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.721e-35
Identity = 96/343 (27.99%), Postives = 168/343 (48.98%), Query Frame = 3
Query: 2409 DKYKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQS-------------------------LEKSFGIERANL--KLEMKDSEQCRKQ-QIEEIQSRYKDLERKLQECENRNEKLYEQLKE--INSEG------SNSNYMEIIEDLKNQIDIKNMSTNLSDV--------------QRERYENEI------SRLRESLSDTNKESKVKIERLNKRLSGNSVSLILDPEVIRESNCVLRQQKEQLERNLINVKCEVEDL 3269
            ++  +EL+++T++C FLE Q+ L++K RQ +++ENI+ TEEAH++NA L + L + Q EL +++ R E A  +E   + VI+ + + + EA+ KY+REL+LHA D + L AAR+E+D  +S                         + +S+  ER  L  KL + D +Q   Q QI ++  +   L RKL E  N   +      E  +++E       ++ + ++++  L+ Q  I   + + S                QR+  + E+      S L    S  + E   ++E+LN               ++ ESN +LR ++E L+ NL   + +V DL
Sbjct:  639 ERLGSELEQTTQRCEFLEAQLDLEKKERQNLVNENIRTTEEAHQLNAELHRQLSSLQGELDSIRTRCESALELEAGAKSVIEAHERAAQEARLKYERELSLHAEDVEALTAARQEVDNWKSKLADVQRQLTTSESRADTVAKELDDMSRSWDTERQELNEKLHLADKDQSLMQDQIIKLTQQLIAL-RKLMEKPNETTEPSGSTSELPVSAEAGVTDLKASEDLLQLVNYLRRQKSIAEATCDASAAEVSRLLLRVASLESQRDHLQTELENERRASELAAETSQRHSELMERVEQLN---------------LLTESNRLLRHERETLQANLKTSEGQVRDL 965          

HSP 2 Score: 78.1814 bits (191), Expect = 4.721e-35
Identity = 62/171 (36.26%), Postives = 93/171 (54.39%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKY-RKL------SQELEINLKETKNSDRVKMEEDLQKIKNLEKDLEKAELDRKKLEE-----------LSNKLTVGERIVAQLKDIGRKHKGESEKRGQYISELERKMLEFQE---QLESL 3754
            EL  Q N+L   K  LE+E++RWKERC +LVE A++MDPEQYR+ACN+RD+  R+L       Q+  + L E+    R ++ E    +K  + +L +A   R+  EE           L  +L   E  V +L++IGRK++ E+E        L R++   Q    QL+SL
Sbjct:  978 ELMAQVNSLGTEKHSLEEERDRWKERCNRLVETAQRMDPEQYRMACNERDELQRQLRRAEEEVQQYSVKLNES----RTELNE---AVKRHDAELNEALASRQAAEEECVQHRSTCETLRKELEGKETTVVKLREIGRKYRQEAET-------LRRQLFANQSDGAQLQSL 1134          
BLAST of TPR_MLP1_2 domain-containing protein vs. TrEMBL
Match: A0A3Q0KR67 (Putative tpr OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.247e-34
Identity = 96/331 (29.00%), Postives = 172/331 (51.96%), Query Frame = 3
Query: 2415 YKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQ----SLEKSFGIERANLKLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQLKEIN------------SEGSNSNYMEIIEDLKN-QIDIKNM------------STNLSDVQRERYENEISR--LRESLSDTNKE---SKVKIERLNKRLSGNSV---SLILDP----EVIRESNCVLRQQKEQLERNLINVKCEVEDLSDQVA 3284
            +  ++ E+ ++C FLE Q+ L+   RQ +++ENI+ TEEAHK+NA L+++L + Q EL + + R E A  VE   +  I+ + + + EA+ KY+RELTLHA D ++L A R ++D+++     LE+     R+  +  M D     K Q E  +S  ++L R+L++ +     L +Q+ ++             S  S+ + M   +D+++   DIK                N++DV  E    E+SR  LR S  ++ KE   S++  ER    L+  +    S +++      ++ ESN +LR ++E L   L + + ++  L+D+V 
Sbjct: 1028 FSRDMCETKQRCEFLEAQLDLERTERQNLVNENIRTTEEAHKLNADLRRELASLQNELESSRTRYESALQVEAGAKAEIESHQQAAQEARDKYERELTLHAHDVELLTAVRSQLDSIKMHSSELEQELNESRSKAETAMAD----LKIQSELWESEKQELNRQLKQGQEEQNLLQDQIIQLTQQMVSLRKSLDKSNISSEDRMSSTQDIESINSDIKTSEELLQVIGYLRRQKNMADVAHEAASAEVSRLLLRVSSLESQKENLQSQIDNERKAAELAMETARKHSEVMERVEQLNLVTESNRLLRHEREVLRSKLSDAENQLAKLNDEVG 1354          

HSP 2 Score: 81.6481 bits (200), Expect = 2.247e-34
Identity = 84/250 (33.60%), Postives = 136/250 (54.40%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKY-RKLS---QELEIN---LKETKN--SDRVKMEED-LQKIKNLEKDLEKAELDRKKLEE--LSNKLTVGERIVAQLKDIGRKHKGESEKRGQYISELERKMLEFQEQLESLSDEK--DQSIEKLNRKETEFEMAAKELKELRTRCEILEKV----------NKNRENTIGELNVNVEQLKSDLVILKNLKRTRNDSNEI 3982
            +L  QK+ LI +K  LE+E++RWKERC++LVE A++MDPEQYRLACN+RD+  R+L+   +E++ N   L E KN   D++K   D L+ ++N  ++ E+ ++    ++E  L   L+  E  + +L++IGRK++ E+E        L RK+       +S SDE     + E L   + +      +   LRT+ ++LE             K RE+ I  +N +VE   SD+ I  N+   +   NE 
Sbjct: 1362 DLIAQKDILIYDKRSLEEERDRWKERCSRLVETAQRMDPEQYRLACNERDELQRRLNRAEEEVQNNANKLCELKNESDDQIKKLNDLLESVRNSYQEAEQ-KISSFSVQENLLKEDLSAKETTIMKLREIGRKYRQETEV-------LRRKL------NDSRSDEAQLQTTNEALTEAKADLVTLRSDYSSLRTQYDLLEASVTEALQFLDEVKARESVITIMNSSVE--GSDIEINSNMSNGQKVVNEF 1595          
BLAST of TPR_MLP1_2 domain-containing protein vs. TrEMBL
Match: A0A095AHQ0 (Nucleoprotein TPR OS=Schistosoma haematobium OX=6185 GN=MS3_01651 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.958e-33
Identity = 96/328 (29.27%), Postives = 172/328 (52.44%), Query Frame = 3
Query: 2415 YKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQ----SLEKSFGIERANLKLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQL----------------KEINSEGSNSNYME---IIEDLKNQ---IDIKNMSTNLSDVQRERYENEISR--LRESLSDTNKE---SKVKIERLNKRLSGNSV---SLILDP----EVIRESNCVLRQQKEQLERNLINVKCEVEDLSDQVA 3284
            +  ++ E+ ++C FLE Q+ L+ K RQ +++ENI+ TEEAHK+NA L+++L + Q EL + + R E A  VE   +  I+ + + + EA+ KY+RELTLHA D ++L   R ++D+++     LE+     R+  +  + D     K Q+E  +S  ++L R+L++ +     L +Q+                  I++E S S+  +   I  D+K     + +     NL+DV  E    E+SR  LR S  ++ KE   S++  ER    L+  +    S +++      ++ ESN +LR ++E L   L + + ++  L+D+V 
Sbjct:  843 FSRDMCETKQRCEFLEAQLDLERKERQNLVNENIRTTEEAHKLNADLRRELASLQNELESSRTRYESALQVEAGAKAEIECHQQAAQEARDKYERELTLHAHDVELLTTVRSQLDSIKMHSGELEQELNESRSKAETAITD----LKIQMELWESEKQELNRQLKQSQEDQNLLQDQIIQLTQQMVSLRKSLDKSNISAEDSMSSTQDIESINSDIKTSEELLQVIGRQKNLADVAHEAASAEVSRLLLRVSSLESQKENLQSQIDNERKAAELAMETARKHSEVMERVEQLNLVTESNRLLRHEREVLRSKLSDAENQLAKLNDEVG 1166          

HSP 2 Score: 77.0258 bits (188), Expect = 2.958e-33
Identity = 58/140 (41.43%), Postives = 87/140 (62.14%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKY-RKLSQ-ELEINLKETKNSDRVKMEEDLQKIKNLEKDLEKAELDRKKLEE-----------LSNKLTVGERIVAQLKDIGRKHKGESE 3685
            +L  QK+ L+ +K  LE+E++RWKERC++LVE A++MDPEQYRLACN+RD+  R+L++ E E+     K  D +K E D Q IK L   LE A    ++ E+           L   L+  E  + +L++IGRK++ E+E
Sbjct: 1174 DLIAQKDILMSDKRSLEEERDRWKERCSRLVETAQRMDPEQYRLACNERDELQRRLNRAEEEVQNNANKLYD-LKNESDDQ-IKKLNDLLESARNSYQEAEQKISSFSVQENLLREDLSAKETTIMKLREIGRKYRQETE 1311          
BLAST of TPR_MLP1_2 domain-containing protein vs. TrEMBL
Match: A0A430QGJ7 (Nucleoprotein TPR (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0008879 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 4.542e-33
Identity = 97/331 (29.31%), Postives = 171/331 (51.66%), Query Frame = 3
Query: 2415 YKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQ----SLEKSFGIERANLKLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQL----------------KEINSEGSNSNYMEI---------IEDLKNQIDIKNMSTNLSDVQRERYENEISR--LRESLSDTNKE---SKVKIERLNKRLSGNSV---SLILDP----EVIRESNCVLRQQKEQLERNLINVKCEVEDLSDQVA 3284
            +  ++ E+ ++C FLE Q+ L+ K RQ +++ENI+ TEEAHK+NA L+++L + Q EL + + R E A  VE   +  I+ + + + EA+ KY+RELTLHA D ++L   R ++D+++     LE+     R+  +  + D     K Q+E  +S  ++L R+L++ +     L +Q+                  I++E S S+  +I          E+L   I       NL+DV  E    E+SR  LR S  ++ KE   S++  ER    L+  +    S +++      ++ ESN +LR ++E L   L + + ++  L+D+V 
Sbjct:  982 FSRDMCETKQRCEFLEAQLDLERKERQNLVNENIRTTEEAHKLNADLRRELASLQNELESSRTRYESALQVEAGAKAEIECHQQAAQEARDKYERELTLHAHDVELLTTVRSQLDSIKMHSGELEQELNESRSKAETAITD----LKIQMELWESEKQELNRQLKQSQEDQNLLQDQIIQLTQQMVSLRKSLDKSNISAEDSMSSTQDIESINSDIKTSEELLQVIGYLRRQKNLADVAHEAASAEVSRLLLRVSSLESQKESLQSQIDNERKAAELAMETARKHSEVMERVEQLNLVTESNRLLRHEREVLRSKLSDAENQLAKLNDEVG 1308          

HSP 2 Score: 77.0258 bits (188), Expect = 4.542e-33
Identity = 58/140 (41.43%), Postives = 87/140 (62.14%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKY-RKLSQ-ELEINLKETKNSDRVKMEEDLQKIKNLEKDLEKAELDRKKLEE-----------LSNKLTVGERIVAQLKDIGRKHKGESE 3685
            +L  QK+ L+ +K  LE+E++RWKERC++LVE A++MDPEQYRLACN+RD+  R+L++ E E+     K  D +K E D Q IK L   LE A    ++ E+           L   L+  E  + +L++IGRK++ E+E
Sbjct: 1316 DLIAQKDILMSDKRSLEEERDRWKERCSRLVETAQRMDPEQYRLACNERDELQRRLNRAEEEVQNNANKLYD-LKNESDDQ-IKKLNDLLESARNSYQEAEQKISSFSVQENLLREDLSAKETTIMKLREIGRKYRQETE 1453          
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Cavefish
Match: tpra (translocated promoter region a, nuclear basket protein [Source:ZFIN;Acc:ZDB-GENE-081104-2])

HSP 1 Score: 50.447 bits (119), Expect = 3.932e-9
Identity = 72/273 (26.37%), Postives = 133/273 (48.72%), Query Frame = 3
Query: 2421 NELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQSLEKSFGIERANLKLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQLKEINSEGSNSNYMEII------EDLKNQIDIKNMSTNLSDVQRERYENEISRLR--ESLSDTNKESKVKIERLNKRLSGNSV---SLILDPEVIRESNCVL 3206
            N+L+E+ E    L+ ++   EK +Q++  E +K  E   K    LK+ + + Q EL     R   A T E+   +   +  K ++EA++KY+REL LHAAD + L+AA+K+        K    +      E++      +QQ + ++     L +++ + + +N  L+EQ++ +N++ + +   +I       E  K Q+  KNM+         + E+++ RL    +L+++NK  K +  RL + L  N      L  D   ++ESN  L
Sbjct:  968 NQLKEAQELNKQLDERLREAEKEKQDLQEEKLKAVENVEKHVKELKRSVTDMQTELQEALHRSAAAVTQEQRATQDSQQQAKLASEAQSKYERELMLHAADVEALQAAKKQTQQAAQSIKELEEKAQKATAELQQGRAAWQQQEKSLKEDLVKLRQRVNDLQKQNSMLHEQMEGLNTKMAATVQQQITDIILTAEREKLQLTAKNMA---------QQEDKLKRLENVNTLTESNKMLKQEKNRLEQELQQNLAKVRKLETDMRPLQESNAEL 1231          

HSP 2 Score: 31.5722 bits (70), Expect = 3.932e-9
Identity = 58/236 (24.58%), Postives = 108/236 (45.76%), Query Frame = 2
Query: 3305 ELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQELEINLKETK--NSDRVKMEEDLQK-----------IKNLEKDLEKAELDR----KKLEELSNKLTVGERIVAQLKDIGRKHKGESEK-RGQY---ISELERKMLEFQEQLESLSDEKDQSIEKLNRKETEFEMAAKELKELRTRCEILEKVNKNRENTIGELNVNVEQLKSDLVILKN 3949
            EL E+   L   K  LED+  RWK R  +LV  ++Q D        +D+++ +KL  E E +LK  +    +  K++ DL K           ++NL +++ K   +R    K LE  ++ +    + +  +K IGR++K + E+ + Q+   ++E   K  +  E  +      ++ I+ L   +T    A  +  EL  + E  +K    RE  +  L   + Q++ +L  L+ 
Sbjct: 1230 ELSEKNGMLQAEKRLLEDDIKRWKNRAQQLV--SQQKD--------SDQEENKKLQTERESHLKRIQQLTEETAKLKSDLAKANASASSVQSQLQNLRENVGKLTTERDGLKKDLETKTSDIQEKLKTITTIKKIGRRYKMQYEELKAQHDKMVAEAAAKPAQVDEAQQEALQASEKEIQNL---KTSLTQAQSKTTELEAQVESQQKAVTEREAEVKSLQEQLAQVQPELTRLRT 1452          
BLAST of TPR_MLP1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000065719.1 (SMESG000065719.1)

HSP 1 Score: 2058.49 bits (5332), Expect = 0.000e+0
Identity = 1065/1073 (99.25%), Postives = 1069/1073 (99.63%), Query Frame = 3
Query:   69 MDSTNCNTKNLLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDIYDLREQINNLKVINEELSRSYEDSSNQMKNDIQDKDLEIHRIRNEILQLQQNGISEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKRNYDSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQSKQSDLERQLMVSRKNLQSSNSEIERLNEQVSLFIVVAENGSQIKQEAVDADSGLYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKCEELQKYVDKTTEEINQLRQGNSVNKSQITLHEKQIQLLRYLIELKSPGSSAAIENGLKLIEFGNIVNLDCDEEMEPELVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDXXXXXXXXXXXXXXXMESAIEDLKMKLQAKISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLREREENIESLKMQLEEIRALNLIRNSISYCDVSCQVDISLFEDFETNEEINTKTMIDEGALINCRNQIVSLQAQLIADKLESDHSLSELRSEIDKYKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQSLEKSFGIERANLKLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQLKEINSEGSNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERYENEISRLRESLSDTNKESKVKIERLNKRLSGNSVSLILDPEVIRESNCVLRQQKEQLERNLINVKCEVEDLSDQVAF 3287
            MDSTNCNTKNLLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDI DLREQINNLKVINEELSR+YEDSSNQMKNDIQDKDLEIHRIRNEILQLQQNGISEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKRNYDSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQS+QSDLERQLMVSRKNLQSSNSEIERLNEQVSLFIVVAENGSQIKQEAVDADSGLYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKC+ELQKYVDKTTEEINQLRQGNSVNKSQITLHEKQIQLLRYLIELKSPGSSAAIENGLKLIEFGNIVNLDCDEEMEP LVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDLLRSINKNLLSNSSNMESAIEDLKMKLQAKISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLREREENIESLKMQLEEIRALNLIRNSISYCDVSCQVDISLFEDFETNEEINTKTMIDEGALINCRNQIVSLQAQLIADKLESDHSLSELRSEIDKYKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSK+LEAARKEIDTLQSLEKSFGIERANLKLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQLKEINSEGSNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERYENEISRLRESLSDTNKESKVKIERLNKRLSGNSVSLILDPEVIRESNCVLRQQKEQLERNLINVKCEVEDLSDQV  
Sbjct:    1 MDSTNCNTKNLLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAELQEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKISVITNENEQYKQDINDLREQINNLKVINEELSRNYEDSSNQMKNDIQDKDLEIHRIRNEILQLQQNGISEFHLEKMNPVAASTLKVFKSSKGLMEIYSELHCKISEVDRLEMEKNRWKRNYDSLESELNNTKIYVDKLKNESEETSKMNESLKSRLLSLVTDLRTAQSRQSDLERQLMVSRKNLQSSNSEIERLNEQVSLFIVVAENGSQIKQEAVDADSGLYASVSELQEINRALRLHNEDLISQLESGDSEQYKQKCDELQKYVDKTTEEINQLRQGNSVNKSQITLHEKQIQLLRYLIELKSPGSSAAIENGLKLIEFGNIVNLDCDEEMEPGLVSSGLDNVTKEENSEQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKLDIAIEKLSYEKEMNERYRQESDLLRSINKNLLSNSSNMESAIEDLKMKLQAKISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSNMSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLREREENIESLKMQLEEIRALNLIRNSISYCDVSCQVDISLFEDFETNEEINTKTMIDEGALINCRNQIVSLQAQLIADKLESDHSLSELRSEIDKYKNELQESTEKCAFLETQISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEAETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKLLEAARKEIDTLQSLEKSFGIERANLKLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNEKLYEQLKEINSEGSNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERYENEISRLRESLSDTNKESKVKIERLNKRLSGNSVSLILDPEVIRESNCVLRQQKEQLERNLINVKCEVEDLSDQVCV 1073          

HSP 2 Score: 461.07 bits (1185), Expect = 3.606e-137
Identity = 238/243 (97.94%), Postives = 241/243 (99.18%), Query Frame = 2
Query: 3281 CVLESRIMELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQELEINLKETKNSDRVKMEEDLQKIKNLEKDLEKAELDRKKLEELSNKLTVGERIVAQLKDIGRKHKGESEKRGQYISELERKMLEFQEQLESLSDEKDQSIEKLNRKETEFEMAAKELKELRTRCEILEKVNKNRENTIGELNVNVEQLKSDLVILKNLKRTRNDSNEIEDKKRQRLD 4009
            CVLESRI EL EQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQELEINLKETKNSDRVKMEEDLQKIKNLEKDLEKAELDR+KLEELSNKLTVGERIVAQLKDIGRKHKGESEKRGQYISELERKMLEFQEQLESLS+EKDQSIEKLNRKETEFEMAAKELKELRTRC+ILEKVNKNRENTIGELNVNVEQLKSDLVILKNLKRTRNDSNEIEDKKRQRLD
Sbjct: 1072 CVLESRITELSEQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQELEINLKETKNSDRVKMEEDLQKIKNLEKDLEKAELDRRKLEELSNKLTVGERIVAQLKDIGRKHKGESEKRGQYISELERKMLEFQEQLESLSNEKDQSIEKLNRKETEFEMAAKELKELRTRCDILEKVNKNRENTIGELNVNVEQLKSDLVILKNLKRTRNDSNEIEDKKRQRLD 1314          
BLAST of TPR_MLP1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000025908.1 (SMESG000025908.1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.000e-7
Identity = 40/119 (33.61%), Postives = 74/119 (62.18%), Query Frame = 2
Query: 3350 LEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQELEINLKETKNSDRVK---MEEDLQKIKNLEKDLEKAELDRKKLEELSNKLTV----GERIVAQLKDIGRKHKGESE 3685
            LE+E++ W++RC  L+E+++Q++PE+++  C ++DK +      +I ++E K+  RV    +EE   +I+  E+ L+  E   + L+E+S+K          ++ QL+DIGRK+K ESE
Sbjct: 1325 LENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQH-----QILIEEEKS--RVNSELLEERKTQIEEYERSLKDKENQFESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESE 1436          
The following BLAST results are available for this feature:
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TPR8.967e-922.96translocated promoter region, nuclear basket prote... [more]
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tprb1.844e-821.59translocated promoter region b, nuclear basket pro... [more]
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sos23.878e-1422.28SOS Ras/Rho guanine nucleotide exchange factor 2 [... [more]
sos29.187e-1422.56SOS Ras/Rho guanine nucleotide exchange factor 2 [... [more]
sos21.157e-1322.62SOS Ras/Rho guanine nucleotide exchange factor 2 [... [more]
sos21.391e-1322.64SOS Ras/Rho guanine nucleotide exchange factor 2 [... [more]
sos23.852e-1322.31SOS Ras/Rho guanine nucleotide exchange factor 2 [... [more]
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tpr1.763e-1221.58translocated promoter region, nuclear basket prote... [more]
Tpr3.297e-1221.58translocated promoter region, nuclear basket prote... [more]
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|F6ZDS4|TPR_MOUSE2.015e-1121.58Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr ... [more]
sp|F1MA98|TPR_RAT1.274e-926.27Nucleoprotein TPR OS=Rattus norvegicus OX=10116 GN... [more]
sp|P12270|TPR_HUMAN3.992e-822.96Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR P... [more]
sp|Q5EE04|TPR_XENLA5.518e-625.94Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=... [more]
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KR534.447e-3527.99Nucleoprotein TPR OS=Clonorchis sinensis OX=79923 ... [more]
A0A419QBR34.721e-3527.99Nucleoprotein TPR (Fragment) OS=Clonorchis sinensi... [more]
A0A3Q0KR672.247e-3429.00Putative tpr OS=Schistosoma mansoni OX=6183 PE=4 S... [more]
A0A095AHQ02.958e-3329.27Nucleoprotein TPR OS=Schistosoma haematobium OX=61... [more]
A0A430QGJ74.542e-3329.31Nucleoprotein TPR (Fragment) OS=Schistosoma bovis ... [more]
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tpra3.932e-926.37translocated promoter region a, nuclear basket pro... [more]
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TPR_MLP1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000065719.13.606e-13799.25SMESG000065719.1[more]
SMESG000025908.13.000e-733.61SMESG000025908.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012468 ID=SMED30012468|Name=TPR_MLP1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4099bp
CTCTTATAAATAAATAGGTCATTTAAAATTTCTTATTTTAGTCGAAAAGA
ATTATTATAAAATAATCAATGGATAGTACAAATTGTAATACAAAAAATCT
TTTGGTTGAATTAGAATCTTTAAGATCGAAGGAGTCGATATATAAGATGA
AAGAAAACAATTTTTTACGTGATAAAGAAGTACTTGAAGATTCAATAGGT
AAGTTCCAAGCTGAATTGCAGGAAAAGTCAGAAATAATTCGTTCACTAAG
GCGTGATTTGAATACTCAATCTTCAAATCTCTTCAAAGATTTACAAATAA
AAAATAATGAGTTGGAAAAAGTTATATTGGAAAATGATGATCTTAAAAAA
CAGAATGTAATTTTCCAAGAAACCATAGATCATCAAGTTCAACGACTTGA
AACATTCCAATCCGATATGGATAAACAGTTGAAAATTTTCGAACGAGAGC
TGGAATGTAAATCAAGACTTGCTGGATTTTATGAGTCAAGCAGCCAGCAG
AAGGATATCAAAATATCTGTGATTACTAATGAAAATGAACAATACAAACA
AGATATATATGATTTGAGAGAACAAATAAATAATTTAAAGGTAATAAATG
AAGAATTGAGTAGGAGTTATGAGGATTCATCTAATCAAATGAAGAATGAC
ATACAGGATAAAGATCTCGAAATACACAGAATTAGAAACGAAATTCTCCA
ATTGCAACAGAATGGGATATCGGAATTTCATTTGGAAAAAATGAATCCGG
TCGCCGCATCAACGTTGAAAGTGTTTAAATCGTCAAAAGGGTTGATGGAA
ATATATTCAGAATTACATTGTAAAATCAGTGAAGTTGATCGGTTGGAAAT
GGAAAAGAACCGGTGGAAGAGAAACTATGATTCTCTTGAATCTGAACTGA
ACAATACAAAGATCTACGTTGATAAATTAAAAAATGAATCCGAAGAGACA
TCGAAAATGAATGAAAGTTTAAAAAGTCGATTATTAAGTCTGGTAACGGA
TCTGAGAACGGCACAGTCAAAACAAAGTGATCTAGAGAGACAGTTAATGG
TTAGCAGAAAAAACTTGCAATCCAGTAATAGTGAAATTGAACGTTTGAAT
GAACAAGTCAGTTTGTTCATTGTAGTTGCTGAAAACGGTTCTCAAATCAA
ACAAGAAGCAGTGGACGCTGACAGCGGTTTATATGCATCTGTGTCGGAAT
TGCAGGAAATTAATCGAGCACTCCGACTCCACAATGAAGATTTGATATCT
CAATTGGAGTCGGGCGATTCTGAACAATACAAGCAAAAATGTGAAGAACT
TCAGAAATATGTCGATAAAACAACCGAAGAAATCAACCAATTGAGACAAG
GAAATAGCGTCAATAAAAGCCAGATAACTCTCCATGAGAAACAAATTCAA
TTGTTACGCTATTTGATTGAACTAAAATCACCAGGATCATCGGCAGCTAT
TGAAAATGGACTGAAACTTATTGAATTCGGTAATATTGTAAATCTGGATT
GTGACGAGGAGATGGAACCGGAACTGGTTAGTTCCGGTTTGGACAATGTG
ACAAAGGAGGAAAATTCCGAACAGCTCATTCATCCACAAGACGGATTGAT
AAGTGAATTCATTGACAACAAACGCGCTAGTGATGAAGTTTACAAGTTGA
CAATTGAGCAAATGAGAGCCCAAATAATGGAACTGTCAAAGAAGTCAAAT
GATCTCAGTGACAAACTTGATATTGCGATTGAAAAATTAAGTTATGAGAA
GGAAATGAATGAAAGATATCGCCAAGAAAGCGATCTATTGAGGTCTATCA
ACAAAAATCTCTTGTCAAATTCATCGAATATGGAATCTGCCATTGAAGAT
TTAAAAATGAAACTTCAAGCGAAAATATCTTTACTTGCCGAAAGAAAGGC
CGATTTAGACAGTTGTAAAAATTTGCTGGATTTGGCTAAATCCGAAAATA
TGCGATTGAAAATTGAGCGCGATGATTCAATGAAAACAATTGAAGTGCAA
GAGAAAATATTTTCTAACATGTCCAGTTTGAAGAATGGACTCGAGTTAAG
TGATCATATCAGCAAAATTCAAGTTCGAAATAAAATAGAAAACTTGGAGA
AATCAATGGAAAAAACAACAAACGATTTAAGAGAACGAGAAGAGAACATT
GAGTCGTTGAAAATGCAGCTGGAGGAAATCAGAGCTTTGAATTTAATCCG
AAATTCTATAAGTTATTGTGATGTGAGTTGTCAAGTTGACATTTCTCTAT
TTGAAGACTTTGAGACCAATGAAGAAATTAATACCAAAACAATGATTGAT
GAAGGGGCTTTGATAAATTGTAGAAATCAAATTGTATCTTTACAAGCTCA
GTTGATTGCGGATAAATTAGAATCAGATCATTCTTTATCAGAGTTGAGGT
CAGAAATAGACAAATATAAAAACGAATTACAAGAGTCAACCGAAAAATGT
GCATTCCTTGAAACTCAAATCAGTCTCCAAGAAAAAGCTCGTCAAGAAAT
CCTCAGTGAAAACATCAAAATAACCGAAGAAGCTCACAAAATGAACGCCT
CTCTAAAGCAAGATCTCCATAACAGTCAGGAAGAGTTATCTGCCATGAAA
ATTCGATTAGAAGAAGCCGAAACTGTTGAAAGAACAGTACAAGAAGTTAT
CGATAAATATATCAAAGAATCCAATGAAGCTAAAGCTAAATATAAAAGAG
AATTAACTCTACATGCTGCCGACTCCAAGATTTTAGAGGCAGCAAGAAAA
GAAATCGATACATTGCAATCGTTAGAAAAGTCGTTTGGAATAGAACGTGC
AAATTTGAAATTAGAAATGAAAGATTCGGAACAGTGTCGAAAGCAACAAA
TCGAAGAAATCCAATCTCGATACAAAGATTTAGAAAGAAAATTACAGGAA
TGTGAAAACAGAAATGAGAAGCTTTATGAACAATTAAAAGAAATCAACAG
CGAAGGATCCAATTCTAATTACATGGAAATAATTGAGGATTTAAAAAATC
AAATCGACATAAAAAATATGTCAACGAATCTATCGGACGTTCAAAGGGAA
CGATATGAAAATGAAATTTCCCGATTGCGAGAATCATTATCCGACACAAA
TAAAGAATCCAAAGTTAAAATAGAAAGACTAAACAAGAGATTATCTGGAA
ATAGTGTTTCTCTGATATTAGATCCGGAAGTTATCAGAGAAAGCAATTGC
GTATTACGACAACAGAAGGAACAATTGGAAAGAAATCTTATTAATGTCAA
ATGTGAAGTGGAAGATTTATCTGACCAAGTTGCGTTCTCGAGTCTCGAAT
CATGGAATTAAGAGAACAGAAAAACGCTTTAATTGTTAACAAAAGTGAAT
TAGAAGACGAAAAGAATCGTTGGAAAGAGCGCTGTACGAAATTAGTTGAA
AGAGCAGAACAAATGGATCCAGAACAATATCGACTTGCTTGCAATGATCG
GGATAAATATCGAAAATTATCTCAAGAGTTGGAAATTAATTTGAAAGAAA
CAAAAAATTCGGATAGAGTAAAAATGGAGGAAGATTTACAGAAAATAAAG
AATTTAGAAAAAGATTTGGAAAAAGCGGAATTAGATAGAAAGAAATTGGA
AGAGTTGTCAAATAAATTGACAGTAGGAGAGAGAATAGTTGCTCAATTGA
AGGATATTGGAAGGAAACATAAAGGAGAGTCGGAAAAGCGAGGACAATAC
ATAAGTGAGTTGGAGAGGAAAATGTTGGAGTTCCAGGAACAACTGGAATC
GCTTTCAGATGAGAAAGATCAATCGATTGAAAAATTAAATCGAAAAGAAA
CAGAATTTGAGATGGCAGCGAAGGAATTAAAGGAATTAAGAACGAGATGT
GAGATTTTGGAAAAAGTAAACAAAAACCGAGAAAACACGATTGGGGAGCT
CAATGTCAACGTGGAACAGTTGAAATCGGATTTGGTAATATTGAAGAATC
TTAAGCGTACAAGGAATGATAGCAATGAAATTGAGGACAAAAAACGGCAG
AGATTAGATGAAACTAATTCTGAGAGTGAAGATGATGAGGAAATGAATGA
AACTGGAACTGCAGATGAAGAAGAAAATGAAGAAATAGAAGGAAATGAT
back to top

protein sequence of SMED30012468-orf-1

>SMED30012468-orf-1 ID=SMED30012468-orf-1|Name=SMED30012468-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=266bp
MELREQKNALIVNKSELEDEKNRWKERCTKLVERAEQMDPEQYRLACNDR
DKYRKLSQELEINLKETKNSDRVKMEEDLQKIKNLEKDLEKAELDRKKLE
ELSNKLTVGERIVAQLKDIGRKHKGESEKRGQYISELERKMLEFQEQLES
LSDEKDQSIEKLNRKETEFEMAAKELKELRTRCEILEKVNKNRENTIGEL
NVNVEQLKSDLVILKNLKRTRNDSNEIEDKKRQRLDETNSESEDDEEMNE
TGTADEEENEEIEGND
back to top

protein sequence of SMED30012468-orf-2

>SMED30012468-orf-2 ID=SMED30012468-orf-2|Name=SMED30012468-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1081bp
MDSTNCNTKNLLVELESLRSKESIYKMKENNFLRDKEVLEDSIGKFQAEL
QEKSEIIRSLRRDLNTQSSNLFKDLQIKNNELEKVILENDDLKKQNVIFQ
ETIDHQVQRLETFQSDMDKQLKIFERELECKSRLAGFYESSSQQKDIKIS
VITNENEQYKQDIYDLREQINNLKVINEELSRSYEDSSNQMKNDIQDKDL
EIHRIRNEILQLQQNGISEFHLEKMNPVAASTLKVFKSSKGLMEIYSELH
CKISEVDRLEMEKNRWKRNYDSLESELNNTKIYVDKLKNESEETSKMNES
LKSRLLSLVTDLRTAQSKQSDLERQLMVSRKNLQSSNSEIERLNEQVSLF
IVVAENGSQIKQEAVDADSGLYASVSELQEINRALRLHNEDLISQLESGD
SEQYKQKCEELQKYVDKTTEEINQLRQGNSVNKSQITLHEKQIQLLRYLI
ELKSPGSSAAIENGLKLIEFGNIVNLDCDEEMEPELVSSGLDNVTKEENS
EQLIHPQDGLISEFIDNKRASDEVYKLTIEQMRAQIMELSKKSNDLSDKL
DIAIEKLSYEKEMNERYRQESDLLRSINKNLLSNSSNMESAIEDLKMKLQ
AKISLLAERKADLDSCKNLLDLAKSENMRLKIERDDSMKTIEVQEKIFSN
MSSLKNGLELSDHISKIQVRNKIENLEKSMEKTTNDLREREENIESLKMQ
LEEIRALNLIRNSISYCDVSCQVDISLFEDFETNEEINTKTMIDEGALIN
CRNQIVSLQAQLIADKLESDHSLSELRSEIDKYKNELQESTEKCAFLETQ
ISLQEKARQEILSENIKITEEAHKMNASLKQDLHNSQEELSAMKIRLEEA
ETVERTVQEVIDKYIKESNEAKAKYKRELTLHAADSKILEAARKEIDTLQ
SLEKSFGIERANLKLEMKDSEQCRKQQIEEIQSRYKDLERKLQECENRNE
KLYEQLKEINSEGSNSNYMEIIEDLKNQIDIKNMSTNLSDVQRERYENEI
SRLRESLSDTNKESKVKIERLNKRLSGNSVSLILDPEVIRESNCVLRQQK
EQLERNLINVKCEVEDLSDQVAFSSLESWN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR012929TPR/MLP1
Vocabulary: biological process
TermDefinition
GO:0006606protein import into nucleus
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0019013viral nucleocapsid
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 149..215
NoneNo IPR availableCOILSCoilCoilcoord: 921..962
NoneNo IPR availableCOILSCoilCoilcoord: 993..1024
NoneNo IPR availableCOILSCoilCoilcoord: 826..853
NoneNo IPR availableCOILSCoilCoilcoord: 613..633
NoneNo IPR availableCOILSCoilCoilcoord: 666..707
NoneNo IPR availableCOILSCoilCoilcoord: 256..304
NoneNo IPR availableCOILSCoilCoilcoord: 326..346
NoneNo IPR availableCOILSCoilCoilcoord: 1050..1070
NoneNo IPR availableCOILSCoilCoilcoord: 401..428
NoneNo IPR availableCOILSCoilCoilcoord: 578..598
NoneNo IPR availableCOILSCoilCoilcoord: 529..556
NoneNo IPR availableCOILSCoilCoilcoord: 75..95
NoneNo IPR availableCOILSCoilCoilcoord: 766..800
NoneNo IPR availableCOILSCoilCoilcoord: 43..63
NoneNo IPR availablePANTHERPTHR18898NUCLEOPROTEIN TPR-RELATEDcoord: 10..1080
IPR012929Nucleoprotein TPR/MLP1PFAMPF07926TPR_MLP1_2coord: 833..958
e-value: 2.1E-12
score: 47.2