SMED30012464

Overview
NameSMED30012464
Smed IDSMED30012464
Length (bp)807
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012464

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30012464h1SMcG0019953 dd_Smed_v4_49258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012464h1SMcG0019953 dd_Smed_v4_49258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012464h1SMcG0019953 dd_Smed_v4_49258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012464h1SMcG0019953 dd_Smed_v4_49258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012464h1SMcG0019953 dd_Smed_v4_49258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012464h1SMcG0019953 dd_Smed_v4_49258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012464h1SMcG0019953 dd_Smed_v4_49258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012464h1SMcG0019953 dd_Smed_v4_49258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012464h1SMcG0019953 dd_Smed_v4_49258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012464h1SMcG0019953 dd_Smed_v4_49258_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012464 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002570:13276..14072 -3883
Homology
BLAST of SMED30012464 vs. Ensembl Zebrafish
Match: ptger2b (prostaglandin E receptor 2b (subtype EP2) [Source:ZFIN;Acc:ZDB-GENE-040724-267])

HSP 1 Score: 53.1434 bits (126), Expect = 1.061e-7
Identity = 45/179 (25.14%), Postives = 79/179 (44.13%), Query Frame = 1
Query:  268 DSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRLNFS-KRLDPSRRCFHR-----------KSVNAAKILFFNTSLFILSWIPVTVS 768
            ++  +C    Y +T   +  +  L   A ER+L+I           K+C  + + +I ++   F + P LGFGKY      T+CFI++  S+   E   F+ I++  L+  IV  +  N  V+  ++   +RL P R    R           K V    +L+F T  F+   +P+ + 
Sbjct:   89 ENRLACGHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSA--SEHKAFNIIYASCLLLMIVCTVLCNASVIYHISLMYRRLKPHRSSVRRQRGHKRHRSMTKEVEHLVLLWFMTIAFVFCSLPLVIQ 265          
BLAST of SMED30012464 vs. Ensembl Zebrafish
Match: ptger2b (prostaglandin E receptor 2b (subtype EP2) [Source:ZFIN;Acc:ZDB-GENE-040724-267])

HSP 1 Score: 49.6766 bits (117), Expect = 1.566e-6
Identity = 44/179 (24.58%), Postives = 78/179 (43.58%), Query Frame = 1
Query:  268 DSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRLN-FSKRLDPSRRCFHR-----------KSVNAAKILFFNTSLFILSWIPVTVS 768
            ++  +C    Y +T   +  +  L   A ER+L+I           K+C  + + +I ++   F + P LGFGKY      T+CFI++  S+   E   F+ I++  L+  IV  +  N  V+  ++   +RL   R    R           K V    +L+F T  F+   +P+ + 
Sbjct:   89 ENRLACGHFAYAMTFFSVVTLAILLSMAVERWLSIGHPFFYEKYSSKRCGYITIALIYLLCALFCVTPFLGFGKYVQYCPGTWCFIDMDPSA--SEHKAFNIIYASCLLLMIVCTVLCNASVIYHISRMYRRLKAHRSSVRRQRGHKRHRSMTKEVEHLVLLWFMTIAFVFCSLPLVIQ 265          
BLAST of SMED30012464 vs. Ensembl Zebrafish
Match: ptger4a (prostaglandin E receptor 4 (subtype EP4) a [Source:ZFIN;Acc:ZDB-GENE-060222-1])

HSP 1 Score: 47.3654 bits (111), Expect = 8.352e-6
Identity = 41/168 (24.40%), Postives = 75/168 (44.64%), Query Frame = 1
Query:  268 DSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFS-----LVLVSQIVSILFLNGLVLVRLNFSKR----LDPSRRCFHRKSVNAAKILFFNTSLFIL 744
            D D  CQ  G++L    L+ +  +   + ERY+ I      N    K+   + L  I   +I F   P +GFG+  +Q   T+CFI+    +       FS++++     L+LV+ + ++L    L+ +   F +R     DP R     +S + +++      + IL
Sbjct:   72 DGDPLCQYFGFVLLFFSLAGLSIICAMSIERYIAINHAYFYNDYVDKRLAGVTLLAIYASNILFCALPSVGFGEVKMQYPQTWCFIDW--RTNVSAHAAFSYMYAGCSSLLILVTVVCNVLVCGALIRMHRRFVRRTSLGTDPQRAADPGRSRSFSRLAGAEIQMVIL 237          
BLAST of SMED30012464 vs. Ensembl Zebrafish
Match: parietopsin (parietopsin [Source:ZFIN;Acc:ZDB-GENE-101129-2])

HSP 1 Score: 47.3654 bits (111), Expect = 9.493e-6
Identity = 40/173 (23.12%), Postives = 77/173 (44.51%), Query Frame = 1
Query:  271 SDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITK-NSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSF-------IFSLVLVSQIVSILFLNGLVLVR-LNFSKRLDPSRRCFHRKSVNAAKILFFNTSLFILSWIPVT 762
             D  C   G+ +    L  + TL L A+ERY  + + +     N  + C  LLL  + +  + + +AP+LG+  Y  +G  T C      S  ++E+ W ++       +   +L + I++  + N L+ +R +N S      + C      +A +++      F + W+P T
Sbjct:   92 GDAFCVFQGFAVNYFGLVSLCTLTLLAYERYNVVCKPMAGFKLNVGRSCQGLLL--VWLYCLFWAVAPLLGWSSYGPEGVQTSC------SLGWEERSWRNYSYLILYTLMCFILPTVIITYCYSNVLLTMRKINKSIECQGGKNCAEDNE-HAVRMVLAMIIAFFICWLPYT 255          
BLAST of SMED30012464 vs. Ensembl Xenopus
Match: cntrl (centriolin [Source:Xenbase;Acc:XB-GENE-959037])

HSP 1 Score: 49.6766 bits (117), Expect = 2.438e-6
Identity = 36/143 (25.17%), Postives = 67/143 (46.85%), Query Frame = 1
Query:  346 FAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRLNFSKRLDPSRRCFHRKSVNAAKILFFNTSLFI---LSWIPVTV 765
             A ER+  I +  ++++   KK    ++ ++   +    + PI+G GKYSLQ   ++CF+ L   SK      F  IFS + +  +     LN + +V L    R+   R C  R+  +  +++     + I   L W+P+ +
Sbjct:  147 MALERFFGINKPFSRSATVSKKRACGIVLMVWCFAFFLGLLPIMGVGKYSLQYPKSWCFLTLLQDSKNKS---FGLIFSFIGIFSVSLSFILNTISVVTLC---RVYHDRECVQRRRDSEVEMMVQLVGIMIIASLCWLPLLI 283          
BLAST of SMED30012464 vs. UniProt/SwissProt
Match: sp|O15973|OPSD1_MIZYE (Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis OX=6573 GN=SCOP1 PE=1 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 5.379e-6
Identity = 43/176 (24.43%), Postives = 77/176 (43.75%), Query Frame = 1
Query:  283 CQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEK-----FWFSFIFSLVLVSQIVSILFLNGLVLVRLNFSKRLDPSRRC----------FHRKSVNAAKILFFNTSLFILSWIPVTV 765
            CQL G++     L  I TL   + +RY+ I + +  +    ++ + L++ I+ ++SI   I P  G+G Y  +G  T C  +    +          + F F+  L+++  +  +L + G   VR +  K L  +R              R  +  +KI    T LFI+SW P  +
Sbjct:  125 CQLYGFVGGVFGLMSINTLTAISIDRYVVITKPLQASQTMTRRKVHLMIVIVWVLSILLSIPPFFGWGAYIPEGFQTSCTFDYLTKTARTRTYIVVLYLFGFLIPLIIIG-VCYVLIIRG---VRRHDQKMLTITRSMKTEDARANNKRARSELRISKIAMTVTCLFIISWSPYAI 296          
BLAST of SMED30012464 vs. TrEMBL
Match: A0A1J0CN98 (Xenopsin (Fragment) OS=Argopecten irradians OX=31199 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.274e-9
Identity = 56/195 (28.72%), Postives = 94/195 (48.21%), Query Frame = 1
Query:  196 ILPFLFNAYGEGNFSFQKILTDRVDSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKN--SNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRLNFS---KRLDPSRRCFHRKSVNAAKILFFNTSLFILSWIPVTV 765
            IL FL + +G    +      D +  D  C   G+++T + +S I  L   +F+RY+ IV+   K   S     C+++   + G+   ++ IAP+LG+ KY L+G N  C +   NS  F +  +   +  LVLV  I+ ILF  G +  ++  S   + L  + R   +   + AK + + T  FI SW P  +
Sbjct:   53 ILDFLMSLFGLPMIAISSFARDWIFGDKGCVYYGFIMTLLGISTISILAAISFDRYIVIVKTHLKPMISQRVATCIIVGCLLYGL---AWAIAPLLGWSKYVLEGINISCSVNW-NSDNFGDASFCVALLILVLVIPIIVILFCYGNIFYKVKTSGNNQALSDNDRG-SKMDRDVAKTILWMTLAFIFSWFPYAI 242          
BLAST of SMED30012464 vs. TrEMBL
Match: A0A1L2YYZ3 (Opsin (Fragment) OS=Acanthopleura granulata OX=61363 PE=2 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.905e-8
Identity = 56/178 (31.46%), Postives = 92/178 (51.69%), Query Frame = 1
Query:  280 SCQLNGYLLTGMF-LSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYC-FIELPNSSKFDEKFWFSFIFSLVLVSQIVSIL--FLNGLVLVR---------LNFSKRLDPS--RRCFHRKS-VNAAKILFFNTSLFILSWIPVTV 765
            +C+L G L+ G+F L  I T+ + A +RYL I R ++   +   K    +L ++ + SI + I PI G+G Y  +G  T C F  L  +  F      S+IF L +   +V +L  F   +++V+         +N +K+LD    R+   +K+ +  AKI F+  +LF+LSW P  V
Sbjct:  119 ACELYG-LVGGIFGLMSINTMAMIAIDRYLVIARPLSVMRHMSHKRAFFMLMLVWIWSILWAIPPIFGWGAYIPEGFQTSCSFDYLTRTDYFR-----SYIFCLYICGFVVPVLIIFFCYVLIVKAVADHEKEMVNMAKKLDAKDIRQGQDQKTEIKTAKIAFYTITLFLLSWTPYAV 290          
BLAST of SMED30012464 vs. TrEMBL
Match: A0A3M6UWE7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00006692 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.080e-7
Identity = 51/215 (23.72%), Postives = 106/215 (49.30%), Query Frame = 1
Query:  169 VLNIIHCSVILPFLFNAYGEGNFSFQKILTDRVDSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFS-------FIFSLVLVSQIVSILFLNGLVLVRLNFSKRLD---PSRRCFHRKSVNAAKILFFNTSLFILSWIP-VTVSYCLQ 780
            V + + C++ +P     + +G++   K           C+++ +++  + L  I  L + +  +YLTI + ++K+S F K+ ++LL+    + S+ F + P+LG+  Y L+G N  C ++   SS F ++ +F        F+   V+VS    I  ++ L++V  N S+R      + R   ++   +A       + F++ W+P  TV++ L 
Sbjct:   56 VCDFLSCALAVPLAIARHFQGDWPLGKT---------GCKVHAFMIFLLALVSITHLAIISLGKYLTITKSLSKDSYFNKRNVLLLIVGWWIYSLMFSVPPLLGWSSYGLEGINVTCSVQW-ESSAFSDRAYFGVVIVSCFFLPLFVIVSCYYKIHRVSRLIVV--NTSRRGGITITASRALMKRHRKSAMYFLAIVAAFLIPWLPYATVAFLLA 258          
BLAST of SMED30012464 vs. TrEMBL
Match: B8K1S1 (C-opsin OS=Tribolium castaneum OX=7070 PE=2 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.638e-7
Identity = 52/196 (26.53%), Postives = 95/196 (48.47%), Query Frame = 1
Query:  193 VILPFLFNAYGEGNFSFQKILTDRVDSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNS-NFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIEL----PNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRLNFSKRLDPSRRCFHRKSVNAAKILFFNTSLFILSWIPVTV 765
            V+  FL +  G     F  I    +  +  C + G++++ + ++ I TL + AFERYL I R    N+ NF    L   +F I + S+S  I P++G+G+Y  + AN  C +      PNS+ +     + F F L L   I++  ++N ++ +R N + R+    +  ++     A ++F     F+ +W P  +
Sbjct:   63 VVSDFLVSVLGNPWTFFSAINYGWIFGETGCTIYGFIMSLLGITSITTLTVLAFERYLLIARPFRNNALNFHSAALS--VFSIWLYSLSLTIPPLIGWGEYVHEAANLSCSVNWEEKSPNSTSY---ILYLFAFGLFLPLVIITFSYVNIILTMRRNAAFRVGQVSKAENK----VAYMIFIMIIAFLTAWSPYAI 249          
BLAST of SMED30012464 vs. TrEMBL
Match: A0A139WJH6 (Opsin Rh3-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC032846 PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 2.688e-7
Identity = 52/196 (26.53%), Postives = 95/196 (48.47%), Query Frame = 1
Query:  193 VILPFLFNAYGEGNFSFQKILTDRVDSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNS-NFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIEL----PNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRLNFSKRLDPSRRCFHRKSVNAAKILFFNTSLFILSWIPVTV 765
            V+  FL +  G     F  I    +  +  C + G++++ + ++ I TL + AFERYL I R    N+ NF    L   +F I + S+S  I P++G+G+Y  + AN  C +      PNS+ +     + F F L L   I++  ++N ++ +R N + R+    +  ++     A ++F     F+ +W P  +
Sbjct:   63 VVSDFLVSVLGNPWTFFSAINYGWIFGETGCTIYGFIMSLLGITSITTLTVLAFERYLLIARPFRNNALNFHSAALS--VFSIWLYSLSLTIPPLIGWGEYVHEAANLSCSVNWEEKSPNSTSY---ILYLFAFGLFLPLVIITFSYVNIILTMRRNAAFRVGQVSKAENK----VAYMIFIMIIAFLTAWSPYAI 249          
BLAST of SMED30012464 vs. Ensembl Cavefish
Match: GALR1 (galanin receptor type 1 [Source:NCBI gene;Acc:103047815])

HSP 1 Score: 48.1358 bits (113), Expect = 4.382e-6
Identity = 46/173 (26.59%), Postives = 79/173 (45.66%), Query Frame = 1
Query:  250 ILTDRVDSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGAN-TYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILF---LNGLVLVRLNFSKRLDPSRRCFHRKSVNAAKILFFNTSLFILSWIP 756
            +L   V   F+C+   Y  T   L  IFTL+  + +RY+ IVR  + +S    +  +L +  I ++S++   AP+    +   +  N TYC+   P +         +F+F  VL   ++S  +   LN L     N SK+ + S+R         A+ +     +F LSW+P
Sbjct:   86 VLPTWVLGAFACKFVHYFFTVSMLVSIFTLSAMSVDRYVAIVRARSSSSVRVARNALLAVVAIWLLSLAMA-APVAYHQRIIEREDNATYCWELWPQAHHRKIYVVCTFVFGYVLPLLLISFCYARVLNHLRKKLKNMSKKSEASKR-------KTAQTVLVVVVVFCLSWLP 250          
BLAST of SMED30012464 vs. Ensembl Nematostella
Match: EDO40334 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7I1])

HSP 1 Score: 55.4546 bits (132), Expect = 6.399e-9
Identity = 37/167 (22.16%), Postives = 84/167 (50.30%), Query Frame = 1
Query:  271 SDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRLNFSKRLDPSR--RCFHRKSVNAAKILFFNTSLFILSWIPVTV 765
             +  C++N +L+T + L+ + T+ + +  RYL IV+     S F  K + +++ +I ++ + F + P+LG+  Y+ + +   C +E   S  F+         +L +   ++   + N    V ++ S R+D  R  RC + + +   + L    + F++ ++P+T+
Sbjct:   77 DEVVCKVNAFLITELLLASMLTICVISVNRYLKIVKPRVYCSVFNSKTISVIILLIWVLPLLFSVPPLLGWSDYAFKPSKCICLVE---SDDFNSYGIVLGCATLGINVPLIIFCYFNVFRAVGVH-STRMDCHRHQRCINVEEIRITQTLLIVIAAFLVCFLPITI 239          
BLAST of SMED30012464 vs. Ensembl Nematostella
Match: NVOP377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXB7])

HSP 1 Score: 49.6766 bits (117), Expect = 3.395e-7
Identity = 39/171 (22.81%), Postives = 81/171 (47.37%), Query Frame = 1
Query:  280 SCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKK----CLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFW---FSFIFSLVLVSQIVSILFLNGLVLVRLNFSK-RLDPSRRCFHRKSVNAAKILFFNTSLFILSWIPVTVS 768
             CQ++ +L+  + L  I  L   A E++LTIV+ +  + +F  +    C+V  L++  ++ I+ P  P+ G+ +Y L+  N  C +   +    D+ ++   F   F L L   + S   +  +        K +L  ++R   RK + +A       + ++++W P T++
Sbjct:   73 GCQVHAFLIYTLGLVSITNLAALALEKFLTIVKCLYSDEHFFTRLQAICVVAGLWVYCLL-ITIP--PLFGWARYGLEPGNKTCSLRWDDDGPADDAYYGVMFGGYFILPLALMVFSYFRIFKVECHDRQCKKWQLSHNKRALLRKHIQSAVFFLLLIAGYLMAWTPYTIA 240          
BLAST of SMED30012464 vs. Ensembl Nematostella
Match: EDO37556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG7])

HSP 1 Score: 49.6766 bits (117), Expect = 4.559e-7
Identity = 35/133 (26.32%), Postives = 65/133 (48.87%), Query Frame = 1
Query:  247 KILTDRVDSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRL 645
             I  D V     CQL+G+L +  F   IFTL + + E+Y  +VR +++     +     ++F +  +S    I PI G+G +    +   C +  P   +  E+    ++F LV+++  V+ LF+ G   +R+
Sbjct:   84 SISRDWVLGSSFCQLHGFLGSFFFCVSIFTLTIMSIEQYYALVRPLSRAITIRRAW--GMMFAVWALSAVISIEPIFGWGHFDYNSSTLSCGVAFPR--RLSERL---YLFLLVMIA-FVTPLFIMGYAYIRI 208          
BLAST of SMED30012464 vs. Ensembl Nematostella
Match: EDO44764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW2])

HSP 1 Score: 48.9062 bits (115), Expect = 5.542e-7
Identity = 37/174 (21.26%), Postives = 75/174 (43.10%), Query Frame = 1
Query:  250 ILTDRVDSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSI--LFLNGLVLVRLNFSKRLDPSRRCFHRKSVNAAKILFFNTSLFILSWIPVTV 765
            I   R   DF CQL G+ +  +    + T+ L A  RY  IVR       F      L++  + +IS + P+  +L   +Y       +CF  L       E  +F+ +  + +   ++++  L+ +   ++R + +      +     + +   + LFF    F++ WIP+++
Sbjct:   52 IAGTRTFGDFICQLQGFAIAALACVSLLTMTLVAINRYFLIVRPHQYRRIFTPLNTKLMILGVWLISCTEPLPYLLSGHRYEYHAGKVFCFQVL-------EVNFFTLLGYVYVALPVIALTSLYFSVFRVIRAHQATLRSLRKASVSVEDITVTRTLFFTVCGFLICWIPISI 218          
BLAST of SMED30012464 vs. Ensembl Nematostella
Match: EDO33255 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSR8])

HSP 1 Score: 48.9062 bits (115), Expect = 5.556e-7
Identity = 46/220 (20.91%), Postives = 88/220 (40.00%), Query Frame = 1
Query:  115 FKNNNFHXXXXXXXAETFVLNIIHCSVILPFLFNAYGEGNFSFQKILTDRVDSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRLNFSKR--LDPSRRCFHRKSV---NAAKILFFNTSLFILSWIPV 759
            +KN N   +    +    + +I+  ++  P   +    G  +F           F CQL G+ +  +    + T+ L A  RY  IVR  T    F  +    ++ +I ++S + P+  +L   +Y       +CF  L    + D      +++  + V  + S  ++   +L +     R     +R   HR SV   N  + LF     F++ W+P+
Sbjct:   26 YKNRNLRTIPNQFVISLALADILMAAICAPPCLSVLIAGTRTF---------GSFVCQLQGFAIAALACVSLLTMTLVAINRYFLIVRPQTYQWLFTPRKTKAMIVMIWLLSCTEPLPYLLSGHRYEYHAGKVFCFQVL----EVDFYTLLGYVYVALPVVVLTSCYYVVFKILRQHQERIRSLRKSNRSSTHRVSVEDINVTRTLFITVCGFLICWLPI 232          
BLAST of SMED30012464 vs. Planmine SMEST
Match: SMESG000035411.1 (SMESG000035411.1)

HSP 1 Score: 423.705 bits (1088), Expect = 3.717e-151
Identity = 220/226 (97.35%), Postives = 223/226 (98.67%), Query Frame = 1
Query:   91 VSFLICRKFKNNNFHXXXXXXXAETFVLNIIHCSVILPFLFNAYGEGNFSFQKILTDRVDSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRLNFSKRLDPSRRCFHRKSVNAAKILFFNTSLFILSWIPVTVS 768
            VSFLICRKFKNNNFHL LVVLLAETFVLNIIHCSVILPFLFNAYGEGNFSFQKILTDRVDSDFSCQLNGYLLTGMFL+FIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFD KFWFSFIFSLVL+SQIVSILFLNGLVL RLNFSKRLDPSRRCFHRKSVNAAKILFFNTSLFILSWIPVTV+
Sbjct:   16 VSFLICRKFKNNNFHLFLVVLLAETFVLNIIHCSVILPFLFNAYGEGNFSFQKILTDRVDSDFSCQLNGYLLTGMFLAFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDGKFWFSFIFSLVLISQIVSILFLNGLVLDRLNFSKRLDPSRRCFHRKSVNAAKILFFNTSLFILSWIPVTVN 241          
BLAST of SMED30012464 vs. Planmine SMEST
Match: SMESG000035412.1 (SMESG000035412.1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.755e-15
Identity = 56/181 (30.94%), Postives = 91/181 (50.28%), Query Frame = 1
Query:  103 ICRKFKNNNFHXXXXXXXAETFVLNIIHCSVILPFLFNAYGEGNFSFQKILTDRVDSDFSCQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRL 645
            I RK      H+LL+ L+ E   L II+    LP+ +  +       Q I +   DS+  C+++G+ LT + L F  T+ + +FERY TIV + T++    +K ++L +  I   S      P++  GKY  Q   TYC+I+L  ++       FS IF   +  QI+ +   N LV+ +L
Sbjct:   29 IVRKRSLTTLHILLISLICEDLWLIIINAYFSLPY-YIQFINNPERLQNISSSIEDSELQCKIHGFCLTFITLCFFLTIGMISFERYFTIVIRKTRHLIILRKYILLTILFIMFYSSGIACLPLIEIGKYKYQITGTYCYIDLSPATDSVWDLVFSSIFVATICLQILIVTSSNSLVVRKL 208          
BLAST of SMED30012464 vs. Planmine SMEST
Match: SMESG000035413.1 (SMESG000035413.1)

HSP 1 Score: 60.077 bits (144), Expect = 2.747e-10
Identity = 42/138 (30.43%), Postives = 67/138 (48.55%), Query Frame = 1
Query:  283 CQLNGYLLTGMFLSFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAPILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILFLNGLVLVRLNFSKRLDPSRRCFHRKS 696
            C + G  L  + +    TL L + ERY TIV + T++    K+ ++L + II   S    I P    GKY+LQ   TYC+++L   ++      F  +F L + SQ + +L  N LV+  L F+  +     C   +S
Sbjct:   98 CYIQGSCLAFVTILISLTLGLISIERYFTIVFRKTRHLIVLKRYIILSILIICGYSSIVAILPFFNIGKYTLQSTKTYCYVDLSLLAENKLDLIFVLMFLLTMASQTILVLSTNILVIKTLVFTPLIKFKSTCSRAQS 235          
The following BLAST results are available for this feature:
BLAST of SMED30012464 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012464 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012464 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012464 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ptger2b1.061e-725.14prostaglandin E receptor 2b (subtype EP2) [Source:... [more]
ptger2b1.566e-624.58prostaglandin E receptor 2b (subtype EP2) [Source:... [more]
ptger4a8.352e-624.40prostaglandin E receptor 4 (subtype EP4) a [Source... [more]
parietopsin9.493e-623.12parietopsin [Source:ZFIN;Acc:ZDB-GENE-101129-2][more]
back to top
BLAST of SMED30012464 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cntrl2.438e-625.17centriolin [Source:Xenbase;Acc:XB-GENE-959037][more]
back to top
BLAST of SMED30012464 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012464 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|O15973|OPSD1_MIZYE5.379e-624.43Rhodopsin, GQ-coupled OS=Mizuhopecten yessoensis O... [more]
back to top
BLAST of SMED30012464 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1J0CN982.274e-928.72Xenopsin (Fragment) OS=Argopecten irradians OX=311... [more]
A0A1L2YYZ32.905e-831.46Opsin (Fragment) OS=Acanthopleura granulata OX=613... [more]
A0A3M6UWE71.080e-723.72G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
B8K1S12.638e-726.53C-opsin OS=Tribolium castaneum OX=7070 PE=2 SV=1[more]
A0A139WJH62.688e-726.53Opsin Rh3-like Protein OS=Tribolium castaneum OX=7... [more]
back to top
BLAST of SMED30012464 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GALR14.382e-626.59galanin receptor type 1 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of SMED30012464 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012464 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012464 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403346.399e-922.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVOP3773.395e-722.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375564.559e-726.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447645.542e-721.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332555.556e-720.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30012464 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012464 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000035411.13.717e-15197.35SMESG000035411.1[more]
SMESG000035412.19.755e-1530.94SMESG000035412.1[more]
SMESG000035413.12.747e-1030.43SMESG000035413.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012464 ID=SMED30012464|Name=SMED30012464|organism=Schmidtea mediterranea sexual|type=transcript|length=807bp
TTTTTTTAAAATTTTTTATTTATGCATTCATTTGGATTTTTTTTTATGGT
CATATTTGGATTTACTGGCTGCCTCTTTGGATTGGGTTTGGTTTCCTTTT
TGATTTGTCGAAAATTTAAAAATAATAATTTCCATCTTCTTTTGGTGGTC
CTTTTGGCTGAAACGTTTGTTCTGAACATCATCCATTGCAGTGTGATTTT
GCCATTCTTGTTTAATGCATATGGTGAAGGAAATTTTTCTTTTCAAAAAA
TTTTGACTGACAGAGTCGATTCCGATTTTAGCTGTCAGTTGAATGGATAT
TTACTGACCGGGATGTTTTTGTCTTTTATTTTCACTTTAAATTTGTTTGC
TTTTGAAAGATATCTCACAATTGTGAGGAAAATTACCAAAAATTCAAATT
TCCCGAAAAAATGTTTAGTGCTATTGTTGTTTATTATCGGAATGATATCA
ATCAGTTTCCCAATTGCTCCGATCTTGGGGTTTGGTAAGTATTCTCTTCA
AGGTGCAAATACTTATTGCTTTATTGAACTCCCGAATTCTAGTAAATTTG
ATGAGAAATTTTGGTTCAGTTTCATTTTTTCTCTAGTTCTTGTTTCTCAA
ATTGTATCAATATTGTTTCTAAATGGATTGGTATTAGTCAGGCTCAATTT
TTCTAAAAGACTGGACCCAAGCCGTCGATGTTTCCATAGAAAGTCAGTGA
ATGCGGCAAAAATATTATTTTTCAACACATCTCTTTTTATTCTATCCTGG
ATACCTGTAACGGTTAGTTATTGTTTGCAAAAGAGTTGAAGGCAGTAGAT
CGGAAGA
back to top

protein sequence of SMED30012464-orf-1

>SMED30012464-orf-1 ID=SMED30012464-orf-1|Name=SMED30012464-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=256bp
MHSFGFFFMVIFGFTGCLFGLGLVSFLICRKFKNNNFHLLLVVLLAETFV
LNIIHCSVILPFLFNAYGEGNFSFQKILTDRVDSDFSCQLNGYLLTGMFL
SFIFTLNLFAFERYLTIVRKITKNSNFPKKCLVLLLFIIGMISISFPIAP
ILGFGKYSLQGANTYCFIELPNSSKFDEKFWFSFIFSLVLVSQIVSILFL
NGLVLVRLNFSKRLDPSRRCFHRKSVNAAKILFFNTSLFILSWIPVTVSY
CLQKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008365Prostanoid_rcpt
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 52..253
e-value: 4.9E-13
score: 49.0
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 4..255
e-value: 7.6E-20
score: 73.2
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 6..253
e-value: 7.9995E-12
score: 61.5246
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 7..252
NoneNo IPR availableTMHMMTMhelixcoord: 89..111
NoneNo IPR availableTMHMMTMhelixcoord: 226..248
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 132..154
NoneNo IPR availableTMHMMTMhelixcoord: 40..62
NoneNo IPR availableTMHMMTMhelixcoord: 183..205
IPR008365Prostanoid receptorPANTHERPTHR11866PROSTAGLANDIN RECEPTORcoord: 8..251
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 20..255
score: 15.657