SMED30012451

Overview
NameSMED30012451
Smed IDSMED30012451
Length (bp)950
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30012451 (SMED30012451) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30012451 (SMED30012451) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30012451 (SMED30012451) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30012451 (SMED30012451) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012451

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 32

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012451h1SMcG0014752 Contig4121GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012451h1SMcG0020441 Contig4121GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012451h1SMcG0020441 Contig3017GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30012451h1SMcG0020441 Contig665GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30012451h1SMcG0014752 Contig4121GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020441 Contig4121GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020441 Contig50311uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020441 Contig50311newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020441 Contig15579uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020441 Contig15579newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020946 Contig4911uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020946 Contig4911newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020441 Contig4911uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020441 Contig4911newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020441 Contig36445newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020441 Contig36445uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020442 Contig36445newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020442 Contig36445uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020441 Contig52185uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012451h1SMcG0020441 Contig52185newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30012451h1SMcG0020441 dd_Smed_v4_396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012451h1SMcG0020441 dd_Smed_v4_396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012451h1SMcG0020441 dd_Smed_v4_396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012451h1SMcG0020441 dd_Smed_v4_396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30012451h1SMcG0020441 dd_Smed_v4_215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012451h1SMcG0020441 dd_Smed_v4_215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012451h1SMcG0020441 dd_Smed_v4_215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012451h1SMcG0020441 dd_Smed_v4_215_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30012451h1SMcG0020441 dd_Smed_v4_215_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30012451h1SMcG0020441 dd_Smed_v6_215_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012451h1SMcG0020441 dd_Smed_v6_215_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30012451h1SMcG0020441 dd_Smed_v6_396_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30012451 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.024589:59..2968 -4255
Homology
BLAST of SMED30012451 vs. Ensembl Human
Match: PSAP (prosaposin [Source:HGNC Symbol;Acc:HGNC:9498])

HSP 1 Score: 53.5286 bits (127), Expect = 2.238e-7
Identity = 35/175 (20.00%), Postives = 80/175 (45.71%), Query Frame = -3
Query:  190 CKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCP 714
            C++CE++V     +I++     +IL     +C    + ++ +C   + + G  +   +L +  P  VC ++++C +GT         L + V QP+    C+ C  ++ + ++ +  N+  +   + L   C     P+ + C +F +     +++ ++   DP  VC  +  CP
Sbjct:  315 CEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLC-SGT-----RLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACP 483          
BLAST of SMED30012451 vs. Ensembl Human
Match: PSAP (prosaposin [Source:HGNC Symbol;Acc:HGNC:9498])

HSP 1 Score: 53.5286 bits (127), Expect = 2.390e-7
Identity = 35/175 (20.00%), Postives = 80/175 (45.71%), Query Frame = -3
Query:  190 CKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCP 714
            C++CE++V     +I++     +IL     +C    + ++ +C   + + G  +   +L +  P  VC ++++C +GT         L + V QP+    C+ C  ++ + ++ +  N+  +   + L   C     P+ + C +F +     +++ ++   DP  VC  +  CP
Sbjct:  318 CEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLC-SGT-----RLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACP 486          
BLAST of SMED30012451 vs. Ensembl Zebrafish
Match: psap (prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1])

HSP 1 Score: 55.8398 bits (133), Expect = 2.701e-8
Identity = 44/200 (22.00%), Postives = 81/200 (40.50%), Query Frame = -3
Query:  190 FDKPVQ-QPKKDLSPESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCP 786
             +KPV   P K+L      ++DS  C ICE+++   E MI D     +I+     VC I    +  QC + I + G  + + ++ + DP  VC  + +C   +  +H   ++   F         C  C   + + +  +  N      +  +L  C        ++C +        +++ ++   DP  VC  L  CP
Sbjct:  293 VEKPVATMPAKNLV----RVRDSPQCAICEYVMKEIENMIQDQTSEAEIVQAVEKVCNILPSTLTAQCKDLIETYGQAIIDLLVQEADPKTVCSFLALC---SGVSHVPVMDKQHFA----AGGFCDVCKMAVRYVDGILEQNATQSEIEEAVLKVCSFLPDAVKDECNQLIEQYEPLLVQLLLQTLDPDFVCMKLGACP 481          
BLAST of SMED30012451 vs. Ensembl Zebrafish
Match: psap (prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1])

HSP 1 Score: 55.8398 bits (133), Expect = 2.795e-8
Identity = 44/200 (22.00%), Postives = 81/200 (40.50%), Query Frame = -3
Query:  190 FDKPVQ-QPKKDLSPESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCP 786
             +KPV   P K+L      ++DS  C ICE+++   E MI D     +I+     VC I    +  QC + I + G  + + ++ + DP  VC  + +C   +  +H   ++   F         C  C   + + +  +  N      +  +L  C        ++C +        +++ ++   DP  VC  L  CP
Sbjct:  291 VEKPVATMPAKNLV----RVRDSPQCAICEYVMKEIENMIQDQTSEAEIVQAVEKVCNILPSTLTAQCKDLIETYGQAIIDLLVQEADPKTVCSFLALC---SGVSHVPVMDKQHFA----AGGFCDVCKMAVRYVDGILEQNATQSEIEEAVLKVCSFLPDAVKDECNQLIEQYEPLLVQLLLQTLDPDFVCMKLGACP 479          
BLAST of SMED30012451 vs. Ensembl Zebrafish
Match: psap (prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1])

HSP 1 Score: 51.2174 bits (121), Expect = 3.331e-7
Identity = 29/98 (29.59%), Postives = 48/98 (48.98%), Query Frame = -3
Query:  493 DKPVQ-QPKKDLSPESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVC 783
            +KPV   P K+L      ++DS  C ICE+++   E MI D     +I+     VC I    +  QC + I + G  + + ++ + DP  VC  + +C
Sbjct:   54 EKPVATMPAKNLV----RVRDSPQCAICEYVMKEIENMIQDQTSEAEIVQAVEKVCNILPSTLTAQCKDLIETYGQAIIDLLVQEADPKTVCSFLALC 147          
BLAST of SMED30012451 vs. UniProt/SwissProt
Match: sp|P07602|SAP_HUMAN (Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2)

HSP 1 Score: 53.5286 bits (127), Expect = 1.075e-6
Identity = 35/175 (20.00%), Postives = 80/175 (45.71%), Query Frame = -3
Query:  190 CKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCP 714
            C++CE++V     +I++     +IL     +C    + ++ +C   + + G  +   +L +  P  VC ++++C +GT         L + V QP+    C+ C  ++ + ++ +  N+  +   + L   C     P+ + C +F +     +++ ++   DP  VC  +  CP
Sbjct:  315 CEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLC-SGT-----RLPALTVHVTQPKDGGFCEVCKKLVGYLDRNLEKNSTKQEILAALEKGCSFLPDPYQKQCDQFVAEYEPVLIEILVEVMDPSFVCLKIGACP 483          
BLAST of SMED30012451 vs. UniProt/SwissProt
Match: sp|P26779|SAP_BOVIN (Prosaposin OS=Bos taurus OX=9913 GN=PSAP PE=1 SV=3)

HSP 1 Score: 51.2174 bits (121), Expect = 7.102e-6
Identity = 42/206 (20.39%), Postives = 86/206 (41.75%), Query Frame = -3
Query:  190 ISENVKSFDKPVQQPKKDLSPESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCP 807
            +SENV      V+  KKD +P  + I     C++CE++V     +I++     +IL     VC      +A QC   + + G  +   +L +  P  VC ++++C      +        + V   +    C+ C  ++ + ++ +  N+      + L   C      + + C +F +     +++ ++   DP  VC  +  CP
Sbjct:  289 VSENVIPALGLVEPIKKDPAPAKADIY----CEVCEFVVKEVAKLIDNNRTEEEILHALDKVCSKLPTSLAEQCQEVVDTYGSSILSILLDEASPELVCSMLHLC------SSRGLPAATVRVMPRKDGGFCEVCKKLVGYLDRNLEKNSTKEQILAALEKGCSFLPDQYRKQCDQFVTEYEPVLIEILVEVMDPSFVCLKIGACP 484          
BLAST of SMED30012451 vs. TrEMBL
Match: E9IQG2 (Uncharacterized protein (Fragment) OS=Solenopsis invicta OX=13686 GN=SINV_15287 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 9.253e-9
Identity = 50/224 (22.32%), Postives = 97/224 (43.30%), Query Frame = -3
Query:  148 ENVKSFDKPVQQPKKDLSP----ESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFY--VCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPPKKSVKTFQNFLPK 801
            E+ KS  + +Q P + + P    +S +   + AC +CE+++   +  I +  P  +  VK F+  VC      I  +C   + + G  V   ++ + DP++VC ++ +C +    N +  I     + + +    C  C+  +T     I +N      ++ L   C        + C  F      +++  +I    P +VC YL++C P K      NF+P+
Sbjct:  418 EHPKSEAEEMQLPLERMMPFPLLQSESAGGTQACTLCEYLLHYIQDTITN--PTNEEKVKEFFKKVCTKIPSSIEGECQEFVNTYGDAVVALLVQEIDPSQVCSMIRICPSEALLNMWQKIPKEFILTKVEDKPSCPLCLLAVTQVYDVIKNNKTEASIEAELDKLCNHLPRSLTDQCTEFVKTYSKELVDMLIADMTPQEVCTYLRLCDPTKDPGPKHNFIPE 639          
BLAST of SMED30012451 vs. TrEMBL
Match: A0A2I4B147 (prosaposin isoform X2 OS=Austrofundulus limnaeus OX=52670 GN=psap PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 8.959e-8
Identity = 41/186 (22.04%), Postives = 82/186 (44.09%), Query Frame = -3
Query:  181 IKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQ--TTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPPKK 732
            +++S  CKICE+++ + E M+ D     QI+     VC +    +  QC + I + G  + E ++ + DP  VC +M +C NG    +      ++ + QP+      C+ C  ++++ +  +  N      +  +   C      +  +C +        +++ ++   DP  VC  L  CP  K
Sbjct:  318 VRESPTCKICEYVMKQLESMLEDQATEEQIIHAVESVCSVLPSHLTAQCKDLIETYGQAIIELLVQQADPKTVCTVMALC-NGANRQY------VVTLDQPRYKAGGYCEVCKMVVSYIDGILEKNATEAEIEEAVKKVCSFLPDAYRTECDQLIEQYEPMLVQLLLQMLDPDFVCTKLGACPEAK 496          
BLAST of SMED30012451 vs. TrEMBL
Match: A0A2I4B111 (prosaposin isoform X1 OS=Austrofundulus limnaeus OX=52670 GN=psap PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 9.227e-8
Identity = 41/186 (22.04%), Postives = 82/186 (44.09%), Query Frame = -3
Query:  181 IKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQ--TTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPPKK 732
            +++S  CKICE+++ + E M+ D     QI+     VC +    +  QC + I + G  + E ++ + DP  VC +M +C NG    +      ++ + QP+      C+ C  ++++ +  +  N      +  +   C      +  +C +        +++ ++   DP  VC  L  CP  K
Sbjct:  320 VRESPTCKICEYVMKQLESMLEDQATEEQIIHAVESVCSVLPSHLTAQCKDLIETYGQAIIELLVQQADPKTVCTVMALC-NGANRQY------VVTLDQPRYKAGGYCEVCKMVVSYIDGILEKNATEAEIEEAVKKVCSFLPDAYRTECDQLIEQYEPMLVQLLLQMLDPDFVCTKLGACPEAK 498          
BLAST of SMED30012451 vs. TrEMBL
Match: A0A5A9P6K4 (Prosaposin Proactivator polypeptide OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti013819 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 4.064e-7
Identity = 42/200 (21.00%), Postives = 85/200 (42.50%), Query Frame = -3
Query:  190 FDKP-VQQPKKDLSPESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCP 786
             +KP V +P KD+      ++DS  C ICE+++   E M+ D     +I+     VC +    +  QC + I + G  + E ++ + DP  +C  +++C   +      +I+ +M   + +    C  C   + + +  +  N      +  +   C      F ++C +        +++ ++   DP  VC  L  CP
Sbjct:  291 LEKPAVGKPAKDMR----RVRDSPQCAICEFMMKELESMVQDQTSEQEIVQAVEKVCDVLPSSLTAQCKDLIEAYGQAIIELLVQEADPKTICTFLSLCKEASR----TFIS-VMDKTRYEAGGFCDVCKMAVRYVDGILQQNATQAQIEEAVRKVCDFLPDAFKDECDQLIEQYEPLMVQLLLQTLDPDFVCMKLGACP 481          
BLAST of SMED30012451 vs. TrEMBL
Match: A0A1B6E2D6 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.11094 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 4.379e-7
Identity = 47/200 (23.50%), Postives = 84/200 (42.00%), Query Frame = -3
Query:  175 VQQPKKDLSPESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPPKKSV 774
            +Q P + L+P S   K+   C+ CE+ +   ++ I D +   Q+       C      +++QC + I + G      +  K DP++VC  + VC   TE +  N           +    C  C+ ++      +  N      +  L D C +      +DCV+       +V+  VI +  P++VC Y+K+C   K V
Sbjct:  208 MQLPAERLTPLSMLPKNKEECEFCEYFLHYLQVEITDPMTEKQLKQLIERGCDKLPNSVSSQCKDFIETYGQAFVALLAQKIDPSQVCPSIGVCPGLTEKSLINE----------KDKPTCPLCLMVMETLTDELKDNKTEDNIRKTLDDICNLLPKTVTKDCVQLVDTYFEEVIDMVIAEFTPLEVCSYMKMCSAPKDV 397          
BLAST of SMED30012451 vs. Ensembl Cavefish
Match: psap (prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1])

HSP 1 Score: 51.2174 bits (121), Expect = 8.530e-7
Identity = 36/180 (20.00%), Postives = 68/180 (37.78%), Query Frame = -3
Query:  190 KDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCP 729
            ++   C ICE+++   E MI D     +++     VC I    +  QC + I + G  + E ++ + DP  +C ++ +C  G        +    F    Q    C  C   + + +  +  N      +  +   C      F   C +        +++ ++   DP  VC  L  CP
Sbjct:  296 REPPQCAICEYVMKELEDMIQDQTTEEEVMQAVEKVCNILPSTLTAQCKDLIETYGQAIIELLVQEADPKTICTVLGLC-KGASRAFIPVMEKADF----QAGGFCDVCKMAVRYVDGILEQNATEAQIEEAVRKVCNFLPDEFKTQCDQLVQQYEPLLIQLLLQTLDPDFVCMKLGACP 470          
BLAST of SMED30012451 vs. Ensembl Cavefish
Match: psap (prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1])

HSP 1 Score: 48.1358 bits (113), Expect = 7.535e-6
Identity = 20/83 (24.10%), Postives = 40/83 (48.19%), Query Frame = -3
Query:  481 KDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGT 729
            ++   C ICE+++   E MI D     +++     VC I    +  QC + I + G  + E ++ + DP  +C ++ +C   +
Sbjct:  296 REPPQCAICEYVMKELEDMIQDQTTEEEVMQAVEKVCNILPSTLTAQCKDLIETYGQAIIELLVQEADPKTICTVLGLCKGAS 378          
BLAST of SMED30012451 vs. Ensembl Nematostella
Match: EDO31455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXX5])

HSP 1 Score: 59.3066 bits (142), Expect = 6.392e-10
Identity = 41/197 (20.81%), Postives = 84/197 (42.64%), Query Frame = -3
Query:  175 PKKDLSPESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPPKKSV 765
            PKK +   +  +K S  C +CE+++   + M++      +I+     VC I    I ++C   +   G  + E +  +  P  VC  + +C N          + ++      + + C+ C  ++T+ + ++N+N       ++L   C         +C    S  G  VL+ +I  TDP  +C+ + +C   + V
Sbjct:  225 PKKHVLKATYPVKTSTECVLCEFVMKELDDMLSKNSTQQEIIQAVEKVCSILPSTIKSKCDQFVQEYGPALIEILEQEVSPKLVCTTLGLCANREHRIAMRRSHKLVI----GSNETCEICTTVMTYLKAFLNNNATDEEIVNFLEKVCNYLPSQIASECNAIVSEYGSTVLQ-IIANTDPTTLCKEIGLCSANQHV 416          
BLAST of SMED30012451 vs. Ensembl Medaka
Match: psap (prosaposin [Source:NCBI gene;Acc:101163196])

HSP 1 Score: 55.8398 bits (133), Expect = 2.447e-8
Identity = 35/183 (19.13%), Postives = 79/183 (43.17%), Query Frame = -3
Query:  190 IKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQ--TTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCP 732
            +K+S  C ICE+++ + E M+ D     +++     VC++    +  QC + I + G  + E ++ + DP  VC ++ +C + +          ++ + QP+  T   C+ C   + + +  +  N      +  +   C      +  +C +        +++ ++   DP  VC  +  CP
Sbjct:  316 VKESPQCAICEFVMKQVEAMLTDETTEEEVIQAVQKVCYLVPSSLTAQCKDLIETYGEAIIELLVQEVDPKTVCTMLALCNDASR-------AYVVALDQPRFKTGGYCEVCKMAVGYIDGILEKNATEAEIEEAVKKVCSFLPDAYKTECDQLVEQYEPVLVQLLLQMLDPDFVCTKVGACP 491          
BLAST of SMED30012451 vs. Planmine SMEST
Match: SMESG000019984.1 (SMESG000019984.1)

HSP 1 Score: 262.307 bits (669), Expect = 1.881e-87
Identity = 128/230 (55.65%), Postives = 162/230 (70.43%), Query Frame = -3
Query:  190 MRSIYFAGIFVLCYSFVQAGNTWISENVKSFDKPVQQPKKDLSPESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWN-HFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCP 876
            MRSIYFAGIFVLCYSFVQA N  + ++VK+FDKPV+QP KDL  ESS    S AC IC  +V  YE +IN+ +P   IL+K    C + + +I  QC+     VG++V +AILHKE+ T VC+LMN+CVN TE + HF ++ L+M VQQPQT D C YCVD I W E  IN+ N P   Q+  LDYC IF+CP+N+ C  F+SG GYQV+K ++ KTDPI+VCQYL VCP
Sbjct:    1 MRSIYFAGIFVLCYSFVQADNIRLLKDVKTFDKPVEQPNKDLYQESSIGNASKACDICRKVVENYEAVINNDLPIRYILIKILQACDLLNYDIKRQCHEFYRGVGYKVLKAILHKENSTAVCRLMNICVNETELDQHFKFMGLMMLVQQPQTIDACTYCVDTIAWYEININYYNRPERVQTGFLDYCSIFRCPYNDLCSVFYSGTGYQVIKYILKKTDPIRVCQYLNVCP 230          
BLAST of SMED30012451 vs. Planmine SMEST
Match: SMESG000019986.1 (SMESG000019986.1)

HSP 1 Score: 116.316 bits (290), Expect = 1.431e-28
Identity = 66/197 (33.50%), Postives = 105/197 (53.30%), Query Frame = -3
Query:  178 KDLSPESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEW---NHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPPKKS 759
            K + P++ A   +  CK C WIV RYE ++N  +    I  K   +C IY+  +   C       G EV  AIL  E P K+C+L+N+C +  E    N+F  + LI F ++P   D C+ C+ +I + EK  N++      Q  LL+YC IF+  F   CV +F+  G+++++ ++ K +P KVC+ L  C  + S
Sbjct:  473 KMVKPKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKP-APDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNS 668          

HSP 2 Score: 98.5969 bits (244), Expect = 1.609e-22
Identity = 53/180 (29.44%), Postives = 92/180 (51.11%), Query Frame = -3
Query:  178 CKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEW-NHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPPKKS 714
            CK+C+  V  Y++ IN  +    I  K    C IY   + T C     + G +V +A+L   + T +CKLM+ C+  +E      +++L+  +   ++  KC+ C+  +TW E+ +N  N  +  Q  + + C +    +   CV++FS  G Q++KDV+N  DP   CQ  K+C  + S
Sbjct:  689 CKLCKKRVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTLCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFLDLLQMLTSGKSEKKCQLCISSVTWLEENVNKENSSKFVQELMFEICSVLYQRYQRMCVKYFSTRGLQLIKDVLNDVDPNVSCQTQKLCRKRHS 868          

HSP 3 Score: 88.1965 bits (217), Expect = 4.794e-19
Identity = 59/237 (24.89%), Postives = 108/237 (45.57%), Query Frame = -3
Query:  142 FVQAGNTWISENVKSFDKPVQQPKK----DLSPESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNH-FNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPP--KKSVKTFQNFLPKMI 831
              ++    I +N+   D  V  P      ++S     I  +  C +C+ ++   E+ +N  +    I  +  Y C ++      +C      +G EV +++L  EDPTKVCK + +C+   + +  + +++L+       + +KCK C   I   E+  N +      Q+ + D+CGIF CP+   C +F+   G +V + V+    P  VCQ L+ C    KK +   +   PK +
Sbjct:  248 LARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTICLKHAQHHESYQFLDLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFCRADEKKRIPLIKMVKPKTV 480          

HSP 4 Score: 82.4185 bits (202), Expect = 4.427e-17
Identity = 54/182 (29.67%), Postives = 90/182 (49.45%), Query Frame = -3
Query:  184 NACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCV---NGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPPK 720
            N C+IC+ I++RY+  I+  +    I  +   +C   D      C       G E+ E+I   ED  K+C+++N+C+   +  ++N    + LI   QQP TT +C  CV  + + E++IN    P   Q  L+ YC IFK      C   FS    + +K V+ ++D  ++CQ L +C  +
Sbjct:   86 NKCEICQGIMTRYKSAIDMSLSTKHIQNRFLQICDSADVPFRKICATFFKGKGLEMIESISRSEDSMKICQIINLCLYEDSDDKYNVLTDLLLIDIFQQP-TTKQCTNCVASLDFIEQHINPKLNPEQVQHSLVSYCEIFKPNSQTFCKGLFSTNILKTIKGVLARSDTKEICQNLTLCDMR 266          

HSP 5 Score: 75.485 bits (184), Expect = 7.511e-15
Identity = 59/256 (23.05%), Postives = 108/256 (42.19%), Query Frame = -3
Query:  154 IYFAGIFVLCYSFVQAGNTWISENVKSFDKPVQ--------QPKKDLSPESSAIK----------DSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPPKKSVKTFQNFL 867
            IY A +  LC +F Q     +   + + + P +        Q  K+   E++ +             + C+ C  ++   E   N+     +I  K    C I+ Q+ A  C     S G E+ E+IL KE+P KVC+ ++ C         +   L +F ++ +  D CK C   + + +  IN +  P + Q  ++  C I+K      CV F++  G+ V+K V+   +   +C+ +  C     ++    FL
Sbjct:  521 IYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIHFHRKPAPDHCQSCITMIKFEEKNFNNSKSAVEIQGKLLEYCSIFQQKFANICVEYFNSTGFEIIESILKKENPKKVCEKLHYCHQRNSQGEESQDLLTLFYRKEKDED-CKLCKKRVEFYKISINKSLNPAVIQQKMIAGCAIYKLSLKTLCVFFYNTAGFDVIKAVLTNGESTTICKLMDFCLVDSEIEGSHQFL 775          

HSP 6 Score: 63.1586 bits (152), Expect = 1.025e-10
Identity = 52/212 (24.53%), Postives = 86/212 (40.57%), Query Frame = -3
Query:  136 DLSPESSAIKDSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDK-----CKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPPKKSVKTFQNFLPKMIFQ 756
            DL    + I  +  CKIC   +   E + N      Q+       C I++      C      VG EV E +L    P  VC+ +  C      +    I LI  V+ P+T  +     CK C+ I+   E  +N +      Q+ ++  C I+       C+ F+ G G +V+  ++    P K+CQ + +C   K  +   NFL  ++  
Sbjct:  378 DLLNTFTTINSNEKCKICRIHIQLIERIYNRSKTLEQMQAVVDDFCGIFNCPYEYPCKQFYVKVGLEVREKVL----PRTVCQKLEFC----RADEKKRIPLIKMVK-PKTVARHHNKGCKSCMWIVKRYENIVNKSLSAEYIQTKVIGLCDIYNATVKNLCITFYQGKGLEVINAILASESPRKICQLINLCQSDKERRQENNFLDLLLIH 580          

HSP 7 Score: 62.7734 bits (151), Expect = 1.273e-10
Identity = 32/123 (26.02%), Postives = 60/123 (48.78%), Query Frame = -3
Query:  193 EVFEAILHKEDPTKVCKLMNVC-VNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVC 558
            +  + +L + D  ++C+ + +C +   + N    IN+     +     KC  C ++I   E  +N        Q+ +L  C +F  P  + C++F+ G G +V+K V+   DP KVC+ L +C
Sbjct:  242 KTIKGVLARSDTKEICQNLTLCDMRVVDPNTLEVINMSEVFDEISVNQKCNLCKNMIKLLEISVNKTLNATNIQNRVLYACTVFTSPAKDKCIKFYQGLGLEVIKSVLVDEDPTKVCKKLTIC 364          
BLAST of SMED30012451 vs. Planmine SMEST
Match: SMESG000043279.1 (SMESG000043279.1)

HSP 1 Score: 50.447 bits (119), Expect = 2.414e-7
Identity = 42/176 (23.86%), Postives = 72/176 (40.91%), Query Frame = -3
Query:  187 CKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNSIFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQTTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRFFSGPGYQVLKDVINKTDPIKVCQYLKVCPP 714
            C  CE +V      I+  +   QIL     VCF++ + I  +C +  +  G ++ E++L  E  T VC+ +  C      +    I           + +C  C  +I W E  +  +      ++ L  +C ++  P   DC +  S    Q + D I+    +  CQYL  CP 
Sbjct:   22 CDTCENLVDYIGNTIDKSLSAIQILNTLIDVCFVFKRIIHEKCCSYFYWKGMDIVESMLKNETSTFVCEKIIQCTRNVNIHSIVSI-----------SSRCSQCKMVIKWLENSLRTDGPITEMKNTLNKFCHLWTEP--RDCRQLISTANIQAVFDGIS---SVIACQYLSFCPS 181          
The following BLAST results are available for this feature:
BLAST of SMED30012451 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PSAP2.238e-720.00prosaposin [Source:HGNC Symbol;Acc:HGNC:9498][more]
PSAP2.390e-720.00prosaposin [Source:HGNC Symbol;Acc:HGNC:9498][more]
back to top
BLAST of SMED30012451 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012451 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012451 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
psap2.701e-822.00prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1][more]
psap2.795e-822.00prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1][more]
psap3.331e-729.59prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1][more]
back to top
BLAST of SMED30012451 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012451 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012451 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P07602|SAP_HUMAN1.075e-620.00Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV... [more]
sp|P26779|SAP_BOVIN7.102e-620.39Prosaposin OS=Bos taurus OX=9913 GN=PSAP PE=1 SV=3[more]
back to top
BLAST of SMED30012451 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E9IQG29.253e-922.32Uncharacterized protein (Fragment) OS=Solenopsis i... [more]
A0A2I4B1478.959e-822.04prosaposin isoform X2 OS=Austrofundulus limnaeus O... [more]
A0A2I4B1119.227e-822.04prosaposin isoform X1 OS=Austrofundulus limnaeus O... [more]
A0A5A9P6K44.064e-721.00Prosaposin Proactivator polypeptide OS=Triplophysa... [more]
A0A1B6E2D64.379e-723.50Uncharacterized protein OS=Clastoptera arizonana O... [more]
back to top
BLAST of SMED30012451 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
psap8.530e-720.00prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1][more]
psap7.535e-624.10prosaposin [Source:ZFIN;Acc:ZDB-GENE-020108-1][more]
back to top
BLAST of SMED30012451 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012451 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30012451 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO314556.392e-1020.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30012451 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
psap2.447e-819.13prosaposin [Source:NCBI gene;Acc:101163196][more]
back to top
BLAST of SMED30012451 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000019984.11.881e-8755.65SMESG000019984.1[more]
SMESG000019986.11.431e-2833.50SMESG000019986.1[more]
SMESG000043279.12.414e-723.86SMESG000043279.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012451 ID=SMED30012451|Name=SMED30012451|organism=Schmidtea mediterranea sexual|type=transcript|length=950bp
TATATTTATATAAAAAGTTTAAAAACATTATTTATTAAAAATTGTAAACT
TTTCGCTTTTAATCAATCAATAATAAACGGAGCACATTTGATTAATTTAA
TTAACTTAATTTTTGTCATTAATATTCAAATTTTATTGAAAAATCATCTT
TGGTAAGAAATTTTGAAAGGTTTTCACAGATTTTTTTGGTGGGCAGACTT
TAAGATATTGACAGACTTTAATGGGGTCAGTTTTATTTATGACATCCTTC
AGGACTTGATAGCCAGGTCCTGAGAAAAATCGCACGCAATCCTCATTGAA
GGGGCATTTGAAAATCCCACAATAGTCAAGCAAATAACTTTGATCCATTC
GTGGCATATTATTATGATTTATATATTTTTCATTCCATGTGATGATATCA
ACACAATATTTACATTTGTCAGTTGTTTGGGGTTGTTGAACGAACATGAT
GAGGTTTATATAATTAAAATGGTTCCATTCAGTTCCATTGACACAAACAT
TCATCAGTTTACAAACTTTAGTTGGATCCTCCTTGTGAAGAATGGCTTCA
AATACTTCATGTCCCACGCTGAAAATGGAATTATAGCACTGAGTTGCTAT
TTCTTGGTCATAAATGAAACAAACATAAAAACTTTTAACTAAAATTTGGA
AAAATGGAACGAGGTCATTAATCATGAGCTCATATCTTGACACAATCCAT
TCGCAAATCTTGCAAGCGTTACTGTCCTTTATTGCTGAGGATTCCGGCGA
TAAATCTTTTTTCGGTTGTTGGACAGGTTTGTCGAATGATTTCACATTTT
CCGAAATCCAGGTATTACCCGCCTGGACAAAAGAATAGCACAAAACAAAT
ATTCCCGCGAAGTAAATGGATCTCATTATTGATTTTGTATGTGCATCACA
GTGCAATTTATACTGATTTCTATGTCACAAGATCATAATTAATATTTCGA
back to top

protein sequence of SMED30012451-orf-1

>SMED30012451-orf-1 ID=SMED30012451-orf-1|Name=SMED30012451-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=248bp
MRSIYFAGIFVLCYSFVQAGNTWISENVKSFDKPVQQPKKDLSPESSAIK
DSNACKICEWIVSRYELMINDLVPFFQILVKSFYVCFIYDQEIATQCYNS
IFSVGHEVFEAILHKEDPTKVCKLMNVCVNGTEWNHFNYINLIMFVQQPQ
TTDKCKYCVDIITWNEKYINHNNMPRMDQSYLLDYCGIFKCPFNEDCVRF
FSGPGYQVLKDVINKTDPIKVCQYLKVCPPKKSVKTFQNFLPKMIFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000240body wall musculature
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008373Saposin
IPR011001Saposin-like
IPR008139SaposinB_dom
IPR019774Aromatic-AA_hydroxylase_C
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
Vocabulary: biological process
TermDefinition
GO:0006665sphingolipid metabolic process
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008373SaposinPRINTSPR01797SAPOSINcoord: 55..75
score: 25.17
coord: 104..122
score: 24.81
coord: 206..229
score: 29.76
coord: 152..174
score: 15.53
NoneNo IPR availableGENE3DG3DSA:1.10.225.10coord: 49..137
e-value: 9.0E-8
score: 34.5
coord: 151..236
e-value: 9.8E-8
score: 34.4
NoneNo IPR availablePANTHERPTHR11480:SF67SAPOSIN-RELATEDcoord: 52..231
NoneNo IPR availablePANTHERPTHR11480:SF67SAPOSIN-RELATEDcoord: 46..130
NoneNo IPR availablePANTHERPTHR11480SAPOSIN-RELATEDcoord: 46..130
NoneNo IPR availablePANTHERPTHR11480SAPOSIN-RELATEDcoord: 52..231
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.754
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 51..132
score: 12.435
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 151..232
score: 11.592
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 153..231
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 52..128