Filamin

Overview
NameFilamin
Smed IDSMED30012447
Length (bp)7136
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Filamin (SMED30012447) t-SNE clustered cells

Violin plots show distribution of expression levels for Filamin (SMED30012447) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Filamin (SMED30012447) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Filamin (SMED30012447) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012447

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012447SMESG000064795.1 Contig2674GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30012447SMESG000064795.1 dd_Smed_v4_2272_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012447SMESG000064795.1 dd_Smed_v4_2272_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30012447SMESG000064795.1 dd_Smed_v4_2272_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30012447SMESG000064795.1 Contig38577newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012447SMESG000064795.1 Contig38577newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30012447SMESG000064795.1 Contig38577newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30012447SMESG000064795.1 Contig38577uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012447SMESG000064795.1 Contig38577uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30012447SMESG000064795.1 Contig38577uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30012447SMESG000064795.1 Contig18792newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012447SMESG000064795.1 Contig18792newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30012447SMESG000064795.1 Contig18792uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30012447SMESG000064795.1 Contig18792uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30012447SMESG000064795.1 dd_Smed_v4_2272_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Filamin vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 1310.82 bits (3391), Expect = 0.000e+0
Identity = 777/2015 (38.56%), Postives = 1146/2015 (56.87%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQ---DGSATICYWPTAPGEYAVHILCDGEDIPNSPYM--ANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQ-TTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG-EVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNE-----TTDYTN-GMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANIS-------GSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P T   NP+ VR YGPG+E    I    AEFTVD   AG+  L I   D  G+ ID++++   D    Y C+YTP     +TI V +   +IP SP++V I + S  P KVKV GPG+E++G+  +  T+F +   +AG G++S    C     S D++ ++  I   +  ++ V+Y     G ++I +  +S +I  SPF V V P  +A  V   G G+   G+  G    F + T+ AG   LNV+  SP   + +VK  +I  NY       Y P++ G  ++ + Y   P+ +SPF + V  P   S I   G  L   V VGK   F  DT G    G L  +I  PS   + C         ++T  + P   G YAV +  DG  +P SPY   A++ P     D SK+K +GPG+  EG  +  P EFTID     +          C   E  +  S  G+      Y P   G + V +  +   +P SPFK  +  P +P+ V   G GL           S+D + AG G L +E   + G     ++ N+ D   + V Y P T+G +Y  +++Y G  +P  P  ++++P +D S  KVF   ++   +F+E+   F V+++ +   G   +KA   +PS   +   V  N DG+Y   Y+P++ G ++++VTY+D+PI NSPF + V  GC PS+V   G GL+  FTN+PN FT+   GAG G LG+ +EGPS++KINC DN DG+C+ EY    PG YD+ I +    + GSPF++P++D ++ + VK  G  L  G   RV Q  +FTVD+S+AG APL+      +G   P+ +    +   G + +T+ P++ GP+ + +K+A+  +P +PF   +LP  +  KV   G G++  G  +  S+PV F ID  +AG+G + + +++ +       + D   G +   Y P   G++ I V +    +   P+ +   Q GDA+KC     G+   +    E    ++   AG+GK++C +  LT +G E ++++     IEN  +GT  I+Y+  +   Y++ ++FGGV IPN  F     D      E   +      F  +  E      +D    G  P +  +P ++    +   V  PSG   +  + DN +G+VT+RY P E G+HEM++   G  I  SP +F+      G V+AYGPGL +G     A FTIVT+DAG GGL LAIEGPSKAEI C DN++G+C VTY P +PGDYSI++K+ D +IPGSPF A I  + +R SQ+ +GS +D  L I+  D+S+LTAS++APSG++E C+LK++PN+++GISF PREVG H +++ ++G H+  SP  I+V Q+EIGDA + +V+G GL  G + EM+ F VDTR+AGYGG+SL++EGPSK +I+  D  DGTC+VSY P+ PG Y+++ K+A+EHV GSPF VKI+GE   ++ E I     A  +  VGS C+L LK+P  + SDM A VT+  G     EI+ +    + ++F+P+EMG+HTV V++R  H+ GSPFQFTVGP+ +GGAHKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI F+D K+GSCGV Y   EPG Y  SIKFND+HI  SP+           + V +  D+A        + +   VN P +  IR   + GK+ A +  PS   E   +  +E ++YA+RFIP E+G H I+V  +    H+ GSPF+V +G+  Q  +P +V A G GL  G  G ++ F +NT  +G G L+VTI+GPSKV++  QE  EGY+ +Y P APG Y I+VKYGG  HI GSPF A ++       GS N++S I V   +    +T      +++P  SS A KV   G G+ KA + Q ++F VD S+AG+++L +G+ GP + CEEVS+KH+G  Q+ + Y+V+E+G + L VKWGE++IPGSPF V V
Sbjct:  638 PATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMD--GTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS-HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGD-AVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNG--LENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-----DPSKVKAHGPGL--EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPC---EAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKD-GTYAVTYVPLTAG-MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQ--SFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGD---GTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG--VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTV--LTPDGTEAEADV-----IENE-DGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGE--GRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPY----------LVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDV--KFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETC----YSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2601          

HSP 2 Score: 1085.09 bits (2805), Expect = 0.000e+0
Identity = 762/2299 (33.14%), Postives = 1134/2299 (49.33%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTD-----HDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGF-TNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSST---IP---GTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV----APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-------EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG--EVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVP------LKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGI-SNEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKII----------CQQEA----ADITQVGSQCELTLKVP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ + +   ++R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGLVW LILHYSISMP+WE E       KQTPKQR++ WI  ++P   + N   +W DG A+GALVDSCAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE+I P+VDE ++MTYLSQFP AK+ PGAP+  KLNP K R YG GIE    +  Q A+FTVD  SAG+G++ + + D  G   + ++    DK   Y   Y P   G + +TV +A + I +SPF+V++DK  GD SKV  KGPG+E  G I +  TYF I T  AG G+I   V  P G K+ +   +  +    YR  Y   + G H + IF +   I  SPF V V    N      SGRG+Q  G+R+ +  +F +DT+ AG+G+L V +  P+  EE VK  +     +   Y PS PG Y + I +    + +SPF++ V P      + A+GPGL  G+VG++A FV ++ G E+GSLGF+IEGPS+AKIE  D  DGS  + YWP  PGEYAVHI+CD EDI +SPYMA I P+    +   ++ YGPG++K G  +N+  EFT+D  +  K+ +K  A      G  I + + +  +  Y C Y P+    H + V     ++P SP++V + Q S+P  V+V G G+  +      P +F++D T AG G+++V I  +   +       D D     +D F V Y P  +G  Y   + +    IP SPF +++ P  D SKV  E     +  +       F V  K     GK  +   F  P     G  VK      N D S++  Y+P   G   + VTY   PI  SPF + V    D SK+ +   GLE      +   FT+D  GA GQG L + I  PS   + C   L    T   +ST   IP   G Y + + ++   V GSP+ +    P + + VK  G  L  G + +   P  FT+D   AG   L          E P E K    +   G   ++++PT+ G + + I    + +PG+PF  +I    +P KV   G G+        G L+        +D SEAG G + L   +         I +   G +   Y P  AG + +T+ +    V + P  V+V    D ++  +       +D  +E                  +  +  R  PLT+ G   +K++++ P        + +N +GT  + Y+P E   ++V++ +  V IPN  FK    +         +    K  F +  N  T  T G            G   +   V  PS   ES +   DN +GS +  Y P   G +++N+T  G  I GSP++   ++     KV   GPGL  G R  +   FT+ +  AG   L + + GP      +   DN +G+  VTY P   G Y + +K+AD  IP SPF   ++           G   S+  VP        I+  D     L   +    GK +  I+    +    +++ P + G + I V   G  I  SP++I   Q   GDASK    G G+   + + E   F VD + AG G ++ ++  P  ++AE +  +N DGT  + YT ++PGTY+I +++    +  SPF V  T      + E  +            +EA    +D+  +G +    L +P      ++   V    G T   EI+D  DG  ++++ P E+GLH + +++   HIP SP QF V     G    V A G GL  G  +    F+I T +AG GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +K+ND HI  SPF   + +            D+    +  +G  A F ++  +T        L A+I  PS  +EP +++ +  N   I FIP+E GEHL+++       H+  SP  +++ Q    D       G GL  G   + + FIV+T ++G G +++ ++GPSKV + +++ E+G  +  Y P+ PG Y ++ K+  + H+ GSPFT  IS                      G+  V    T++S A  V         AT+  +   N+   +  +  +   +  P  +  E  +  MG+N   + ++ QE G H + VK+  +++ GSPF
Sbjct:    4 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLD-RESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDD-DAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQ--DGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAG-RYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTK---GAGKAPLNVQFNSP---LPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKL--NGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPC---LVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGK---PAEFTIDTKGAGTGGLGLTV------EGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLS--------VDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATT---------------DFTVDSR--PLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGA-----------GIGGLGITVEGPS---ESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQT--GDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFK-PFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSG---SVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITD------------DSRRCSQVKLGSAADFLLDISETDL----SSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK--NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKF-ADEHVPGSPFTVKIS----------------------GEGRVKESITRTSRAPSV---------ATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPF 2181          

HSP 3 Score: 285.419 bits (729), Expect = 2.718e-76
Identity = 307/1157 (26.53%), Postives = 493/1157 (42.61%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEG--KGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEG--KISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI--------------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYD--------GTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQ----CELTLKVPGTHHSDMRATVTNLYGTTEV--CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEI-----DFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +    P +F +D   AGQGD+ + + +P+       +  +      +  +Y P   G H +TV F    +   PF V V +  GDA+K   +    E +          +   AG G   I   +    E+ + K+ + L VE  + GN      Y P +   ++V I F G +IP   F  +  +  N           + +    R ETTD+      V+ +   + G+  +   +  P G+ E     D  +G     Y P   G + + +T  G  I  SP++      AG+ KV A+GPGL  G  G  A+F + +  +  G L  AIEGPS+A+I   D  +GSCDV Y+P  PG+Y++ I   D +I  SP++A I               G    +S   + + ++  +   +   + L    +   G+     +K   +     S+TP +   H I V   G +I  SP+++ +GQ       KV+VFG G+ + G+ +NE   FTVD  EAG G +S+ I+  ++   E  ++ D         T  V Y P   G Y I + +A++ +  SPF VK+  +PS    +    + E   +++ G +       T+   G   + +     +      V   +IID  D  +++K+ P + G   V+V +    IP SPF   V   +D    K+    N +++G      EF++ TR AG  G L + I  PS+  +         R++ +   K+   E G Y   + ++   +  SP+ +  +    D   V + G     +   +GKPA FT++    T     G L  T+ GP   E      +      ++ ++P + GE+ +N+  E    HIPGSPF+  I +   DP  V A G GL  G VG+     V+   +G G L +    D  +K ++  Q N++G Y   Y+P   G Y +T+KYGG                     E+  H  + +KV+          P   +   KV   G+  K         F VD+   +Q G D +   IA P     E  V       + + Y   EKG H + V + +  IP SPF V V
Sbjct:  242 LKPGAP----LKPKLNPKKARAYGRGIEPTGNMV--KQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEV----EDPQGKNTVELLVE--DKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIR-ETTDFK-----VDTK---AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS--HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKV--DPSHDASK---VKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKD---QEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTA--KFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-DPSKVKAHGPG--LEGGLVGKPAEFTID----TKGAGTGGLGLTVEGP--CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFE--EVHIPGSPFKADI-EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGG---------------------ELVPHFPARVKVE----------PAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAV 1322          
BLAST of Filamin vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 1308.89 bits (3386), Expect = 0.000e+0
Identity = 776/2009 (38.63%), Postives = 1144/2009 (56.94%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQ---DGSATICYWPTAPGEYAVHILCDGEDIPNSPYM--ANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQ-TTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG-EVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANIS-------GSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P T   NP+ VR YGPG+E    I    AEFTVD   AG+  L I   D  G+ ID++++   D    Y C+YTP     +TI V +   +IP SP++V I + S  P KVKV GPG+E++G+  +  T+F +   +AG G++S    C     S D++ ++  I   +  ++ V+Y     G ++I +  +S +I  SPF V V P  +A  V   G G+   G+  G    F + T+ AG   LNV+  SP   + +VK  +I  NY       Y P++ G  ++ + Y   P+ +SPF + V  P   S I   G  L   V VGK   F  DT G    G L  +I  PS   + C         ++T  + P   G YAV +  DG  +P SPY   A++ P     D SK+K +GPG+  EG  +  P EFTID     +          C   E  +  S  G+      Y P   G + V +  +   +P SPFK  +  P +P+ V   G GL           S+D + AG G L +E   + G     ++ N+ D   + V Y P T+G +Y  +++Y G  +P  P  ++++P +D S  KVF   ++   +F+E+   F V+++ +   G   +KA   +PS   +   V  N DG+Y   Y+P++ G ++++VTY+D+PI NSPF + V  GC PS+V   G GL+  FTN+PN FT+   GAG G LG+ +EGPS++KINC DN DG+C+ EY    PG YD+ I +    + GSPF++P++D ++ + VK  G  L  G   RV Q  +FTVD+S+AG APL+      +G   P+ +    +   G + +T+ P++ GP+ + +K+A+  +P +PF   +LP  +  KV   G G++  G  +  S+PV F ID  +AG+G + + +++ +       + D   G +   Y P   G++ I V +    +   P+ +   Q GDA+KC     G+   +    E    ++   AG+GK++C +  LT +G E ++++     IEN  +GT  I+Y+  +   Y++ ++FGGV IPN  F     D      E   + +      S  N       G  P +  +P ++    +   V  PSG   +  + DN +G+VT+RY P E G+HEM++   G  I  SP +F+      G V+AYGPGL +G     A FTIVT+DAG GGL LAIEGPSKAEI C DN++G+C VTY P +PGDYSI++K+ D +IPGSPF A I  + +R SQ+ +GS +D  L I+  D+S+LTAS++APSG++E C+LK++PN+++GISF PREVG H +++ ++G H+  SP  I+V Q+EIGDA + +V+G GL  G + EM+ F VDTR+AGYGG+SL++EGPSK +I+  D  DGTC+VSY P+ PG Y+++ K+A+EHV GSPF VKI+GE   ++ E I     A  +  VGS C+L LK+P  + SDM A VT+  G     EI+ +    + ++F+P+EMG+HTV V++R  H+ GSPFQFTVGP+ +GGAHKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI F+D K+GSCGV Y   EPG Y  SIKFND+HI  SP+           + V +  D+A        + +   VN P +  IR   + GK+ A +  PS   E   +  +E ++YA+RFIP E+G H I+V  +    H+ GSPF+V +G+  Q  +P +V A G GL  G  G ++ F +NT  +G G L+VTI+GPSKV++  QE  EGY+ +Y P APG Y I+VKYGG  HI GSPF A ++       GS N++S I V   +    +T      +++P  SS A KV   G G+ KA + Q ++F VD S+AG+++L +G+ GP + CEEVS+KH+G  Q+ + Y+V+E+G + L VKWGE++IPGSPF V V
Sbjct:  638 PATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMD--GTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS-HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGD-AVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNG--LENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-----DPSKVKAHGPGL--EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPC---EAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKD-GTYAVTYVPLTAG-MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQ--SFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGD---GTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG--VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTV--LTPDGTEAEADV-----IENE-DGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVTEEAYVPVSDMNGL-----GFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGE--GRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPY----------LVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDV--KFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETC----YSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2590          

HSP 2 Score: 1091.26 bits (2821), Expect = 0.000e+0
Identity = 763/2290 (33.32%), Postives = 1138/2290 (49.69%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTD-----HDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGF-TNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSST---IP---GTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV----APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-------EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG--EVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII---------GEPQRRSQICIGSTSDVPLKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGI-SNEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKIT-GEPSAKLMEKIICQQEA----ADITQVGSQCELTLKVP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ + +   ++R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGLVW LILHYSISMP+WE E       KQTPKQR++ WI  ++P   + N   +W DG A+GALVDSCAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE+I P+VDE ++MTYLSQFP AK+ PGAP+  KLNP K R YG GIE    +  Q A+FTVD  SAG+G++ + + D  G   + ++    DK   Y   Y P   G + +TV +A + I +SPF+V++DK  GD SKV  KGPG+E  G I +  TYF I T  AG G+I   V  P G K+ +   +  +    YR  Y   + G H + IF +   I  SPF V V    N      SGRG+Q  G+R+ +  +F +DT+ AG+G+L V +  P+  EE VK  +     +   Y PS PG Y + I +    + +SPF++ V P      + A+GPGL  G+VG++A FV ++ G E+GSLGF+IEGPS+AKIE  D  DGS  + YWP  PGEYAVHI+CD EDI +SPYMA I P+    +   ++ YGPG++K G  +N+  EFT+D  +  K+ +K  A      G  I + + +  +  Y C Y P+    H + V     ++P SP++V + Q S+P  V+V G G+  +      P +F++D T AG G+++V I  +   +       D D     +D F V Y P  +G  Y   + +    IP SPF +++ P  D SKV  E     +  +       F V  K     GK  +   F  P     G  VK      N D S++  Y+P   G   + VTY   PI  SPF + V    D SK+ +   GLE      +   FT+D  GA GQG L + I  PS   + C   L    T   +ST   IP   G Y + + ++   V GSP+ +    P + + VK  G  L  G + +   P  FT+D   AG   L          E P E K    +   G   ++++PT+ G + + I    + +PG+PF  +I    +P KV   G G+        G L+        +D SEAG G + L   +         I +   G +   Y P  AG + +T+ +    V + P  V+V    D ++  +       +D  +E                  +  +  R  PLT+ G   +K++++ P        + +N +GT  + Y+P E   ++V++ +  V IPN  FK    +         +    K  F +  N  T  T G            G   +   V  PS   ES +   DN +GS +  Y P   G +++N+T  G  I GSP++   ++     KV   GPGL  G R  +   FT+ +  AG   L + + GP      +   DN +G+  VTY P   G Y + +K+AD  IP SPF   ++               S   + ++  V   I+  D     L   +    GK +  I+    +    +++ P + G + I V   G  I  SP++I   Q   GDASK    G G+   + + E   F VD + AG G ++ ++  P  ++AE +  +N DGT  + YT ++PGTY+I +++    +  SPF V  T GE +A  +E+    +EA    +D+  +G +    L +P      ++   V    G T   EI+D  DG  ++++ P E+GLH + +++   HIP SP QF V     G    V A G GL  G  +    F+I T +AG GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +K+ND HI  SPF   + +            D+    +  +G  A F ++  +T        L A+I  PS  +EP +++ +  N   I FIP+E GEHL+++       H+  SP  +++ Q    D       G GL  G   + + FIV+T ++G G +++ ++GPSKV + +++ E+G  +  Y P+ PG Y ++ K+  + H+ GSPFT  IS                      G+  V    T++S A  V         AT+  +   N+   +  +  +   +  P  +  E  +  MG+N   + ++ QE G H + VK+  +++ GSPF
Sbjct:    4 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLD-RESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDD-DAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQ--DGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAG-RYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTK---GAGKAPLNVQFNSP---LPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKL--NGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPC---LVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGK---PAEFTIDTKGAGTGGLGLTV------EGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLS--------VDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATT---------------DFTVDSR--PLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGA-----------GIGGLGITVEGPS---ESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQT--GDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTA--VEEAPVTEEAYVPVSDMNGLGFK-PFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSG---SVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITD------------DSRRCSQVKLGSAADFLLDISETDL----SSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK--NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKF-ADEHVPGSPFTVKIS----------------------GEGRVKESITRTSRAPSV---------ATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPF 2170          

HSP 3 Score: 318.931 bits (816), Expect = 1.782e-86
Identity = 282/995 (28.34%), Postives = 445/995 (44.72%), Query Frame = 3
Query:  831 PGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMV----------SPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIF--VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKP-EASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS--NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHG--NLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCD--PSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSIN----RVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKV--KVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAF 3728
            P +P   K+ P    +KV   GPG+ S  + A    +F +DA  AG G L + ITD  GK     + +  +K   Y  TY P   G Y I V Y   DIP SP+++   +T GD SK    GPGI    V       F++  + AG G+++C VL+P G + + +  + +    +Y + YTA + G + I +      I NSPF VM           +P +    V VS      NG+  G K    +       G++  ++  P     + +I +         Y P++ G++E+ I Y    +  SP +  V    +  ++A+GPGL  GV  K A F  VT+  GE G L  +IEGPS+A+I C DN+DG+ T+ Y PT PG+Y++ +  + + IP SP+ A I  +++    S++K            L S  +F +D  E  +D+    AS    SG + P ++    N      + P   G H V +  +   V  SP  + V Q    +    +V G GL     +  + F +DT +AG+G  +LAVE   ++        + D +     V Y P   G VY  S ++   ++PGSPFT++I  E  + +      +            +N K I       + A  T PS   + + +   G  S+   + P + G + + V Y    +  SPF   V P  +    KV   G GLE G    P  F+I    AG G L +A+EGPS A+I   D+ +G+C V Y +  PG Y++ IKFND  +  SP+ +P+  P + A        LT  S+     +V+QP +F +  + A +  + A      G      +   E   P  Y + F+P E G H I++K     V G+PF   +    EP +     +           T  +  +F I+ + AG G + +++  P  + +      EG   +   YTP   G + I+V +
Sbjct: 1503 PRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHD--NKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQT-GDASKCLATGPGIAST-VKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEAD--VIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVTEEAYVPVS----DMNGL--GFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGE-GGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKI--TDDSRRCSQVK------------LGSAADFLLDISE--TDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVD-----IQTEDLEDGTCKVSYFPTVPG-VYIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLK-IPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARR------LTVMSLQESGLKVNQPASFAIRLNGA-KGKIDAKVHSPSGAVEECHVSELE---PDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRV---GEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEG---YKVMYTPMAPGNYLISVKY 2445          

HSP 4 Score: 299.286 bits (765), Expect = 1.486e-80
Identity = 374/1481 (25.25%), Postives = 599/1481 (40.45%), Query Frame = 3
Query:  786 AMMTYLSQFPNAKVNPGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDA---FSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSG-DPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTT-GVVGKAAI-FVTDTN--GELGSLGFSI---EGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASC--FTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAG-------------HGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIK-PEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNL--DGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFK-LPIRDPINTAN-VKCFGEPLTPGSINRVDQPITFTVDASRAG-----EAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVP--------VQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVK--EYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGK----VAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHN-IPGSPFIANIIGE-------------------PQRRSQIC-------------------------IGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVV 4928
            A M  L+     ++ P  P   K+ P    ++++V+GPGIE KD+    T +FTVD+      G  ++   I + +G   +  + +  D    Y+  YTP  KG + + V Y +  IP SPFKV +  T G  PS+V+ +GPG+++     +    F + T  AG G +   V  PS  + KIN +  ++   S   EY     G + +NI    A I  SPF V V    +   V ++G G+ S G+R      F +D+  AG   L V++L P    E V + +         Y PS+ G Y + + Y +  + RSPFK+ VLPT   S + A GPGL++ GV     + F  D    GE G L   I   EG  +  I   DN+DG+  + Y P   G Y + +   G+DIP SPY    + + +  D SK    GPG+    V       F +D    K+  K + +C   T  G E    +    +  Y   Y     G + ++V      +P SPF V          V  + E   +   Y P     D    G              G +  E++   G      + ++ D  +  V Y P   G ++   I+Y G +IP SP    +  P       +   L   +  ++    +V   A    G+G +      PS  +   +   N DG+ + +Y P   G Y + V Y D  I  SPF  ++         +  G   +         F +D+      +L  +I+ PS     C      +    + +     G + + IK N   V  SP   + ++  I  A   K +G  L+ G    +   I  T DA   G     E P K            ++I++ E+   G   +++ PT  G + +  K A+  VPG+PF            VK+ GEG        T   P           ++ + E    D+   +++P   +   +I+  GK   C ++ P + G H ++V +    V   PF   V  +G+     +  G    E          +I T EAG G +S  +      G  K+ ++     +++ NG+  + Y   E   Y V IKF    IP   +    I P++    +  +   +S     +           P  F + ++     ++A V +PSG  E   V +       +R+ P E G+H ++V  +G  + GSP+K      G       V+AYG GL  G TG+ +EF I T  AG G LS+ IEGPSK ++ C++   G   V Y P+ PG+Y I +K+   N I GSPF A + G+                    +  ++ C                         +G  S   +  +    + L   V  P+   E   +K + N    +++  +E G++ + V     HI GSPF + V
Sbjct: 1199 AGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNAD--GTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAV--TEGCQPSRVQAQGPGLKE--AFTNKPNVFTVVTRGAGIGGLGITVEGPS--ESKINCRDNKDGSCS--AEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGS-GVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGE-GLLAVQITDQEGKPKRAI-VHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYR---IRATQTGDASKCLATGPGIAST-VKTGEEVGFVVDA---KTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATD----GEVTAVEEAPVTEEAYVPVS---DMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTV-TVRYAPTEVG-LHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDA----GEGGLDLAIEGPSKAEISCI--DNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAAD---------FLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSK------------VDIQT-EDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFT-----------VKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAV-----EGPSKAEITF----DDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQ-----------PASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEG-YKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2590          

HSP 5 Score: 285.034 bits (728), Expect = 3.699e-76
Identity = 307/1157 (26.53%), Postives = 493/1157 (42.61%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEG--KGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEG--KISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI--------------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYD--------GTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQ----CELTLKVPGTHHSDMRATVTNLYGTTEV--CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEI-----DFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +    P +F +D   AGQGD+ + + +P+       +  +      +  +Y P   G H +TV F    +   PF V V +  GDA+K   +    E +          +   AG G   I   +    E+ + K+ + L VE  + GN      Y P +   ++V I F G +IP   F  +  +  N           + +    R ETTD+      V+ +   + G+  +   +  P G+ E     D  +G     Y P   G + + +T  G  I  SP++      AG+ KV A+GPGL  G  G  A+F + +  +  G L  AIEGPS+A+I   D  +GSCDV Y+P  PG+Y++ I   D +I  SP++A I               G    +S   + + ++  +   +   + L    +   G+     +K   +     S+TP +   H I V   G +I  SP+++ +GQ       KV+VFG G+ + G+ +NE   FTVD  EAG G +S+ I+  ++   E  ++ D         T  V Y P   G Y I + +A++ +  SPF VK+  +PS    +    + E   +++ G +       T+   G   + +     +      V   +IID  D  +++K+ P + G   V+V +    IP SPF   V   +D    K+    N +++G      EF++ TR AG  G L + I  PS+  +         R++ +   K+   E G Y   + ++   +  SP+ +  +    D   V + G     +   +GKPA FT++    T     G L  T+ GP   E      +      ++ ++P + GE+ +N+  E    HIPGSPF+  I +   DP  V A G GL  G VG+     V+   +G G L +    D  +K ++  Q N++G Y   Y+P   G Y +T+KYGG                     E+  H  + +KV+          P   +   KV   G+  K         F VD+   +Q G D +   IA P     E  V       + + Y   EKG H + V + +  IP SPF V V
Sbjct:  242 LKPGAP----LKPKLNPKKARAYGRGIEPTGNMV--KQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEV----EDPQGKNTVELLVE--DKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIR-ETTDFK-----VDTK---AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS--HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKV--DPSHDASK---VKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKD---QEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTA--KFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-DPSKVKAHGPG--LEGGLVGKPAEFTID----TKGAGTGGLGLTVEGP--CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFE--EVHIPGSPFKADI-EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGG---------------------ELVPHFPARVKVE----------PAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAV 1322          

HSP 6 Score: 178.718 bits (452), Expect = 7.587e-44
Identity = 196/761 (25.76%), Postives = 321/761 (42.18%), Query Frame = 3
Query:  771 NVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAK-LVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDGVN-IPGSPFTIQIKPEI--------DISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            N D    +TYL   P         N K  PG+P T+K+  +  R          +  G  A+F +D       +L  +I   +G+     ++ +P+  N    ++ P   G + ++++     +  SP  + + ++  GD  + KV G G+ +      +   FI+ T DAG G IS  V  PS    K++ +       + +V Y     GV+ ++   +   +  SPF V +S     K  +T + R    +   VG   +  +      +  ++  + SP       +I  +  N     ++P + G++ + + Y    VT SPF+  V P        + A GPGL  G  G  A F +       G L  ++EGPS+A+I   D+++GS  + Y    PG Y V I  + E IP SPY+  ++  ++  D  ++ V    +Q+ G+ +N P  F I     K  I  +A   + SG      +S     KY   + P  +G H + V  +   V  SPFKV+V +P    NP  V   G GL   T    + F I+TT AG G L+V I        P  +  D     + + V Y P   G  Y  S++Y G N I GSPF  ++  +         + S + VE++    T     +  +   +A  + +KG G  KA     SSF     K+GS                  +K  G+  Y+ +Y   + G Y+L V + +  I  SPF++ V
Sbjct: 1860 NKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRC-------SQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPN--NHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSD--FIVDTRDAGYGGISLAVEGPS----KVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRA--PSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSD--DARRLTVMS--LQESGLKVNQPASFAIRLNGAKGKI--DAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEG------PSKVKMDCQETPEGYKVMYTPMAPG-NYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2590          
BLAST of Filamin vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 1306.97 bits (3381), Expect = 0.000e+0
Identity = 773/2009 (38.48%), Postives = 1143/2009 (56.89%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQ---DGSATICYWPTAPGEYAVHILCDGEDIPNSPYM--ANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQ-TTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG-EVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANIS-------GSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P T   NP+ VR YGPG+E    I    AEFTVD   AG+  L I   D  G+ ID++++   D    Y C+YTP     +TI V +   +IP SP++V I + S  P KVKV GPG+E++G+  +  T+F +   +AG G++S    C     S D++ ++  I   +  ++ V+Y     G ++I +  +S +I  SPF V V P  +A  V   G G+   G+  G    F + T+ AG   LNV+  SP   + +VK  +I  NY       Y P++ G  ++ + Y   P+ +SPF + V  P   S I   G  L   V VGK   F  DT G    G L  +I  PS   + C         ++T  + P   G YAV +  DG  +P SPY   A++ P     D SK+K +GPG+  EG  +  P EFTID     +          C   E  +  S  G+      Y P   G + V +  +   +P SPFK  +  P +P+ V   G GL           S+D + AG G L +E   + G     ++ N+ D   + V Y P T+G +Y  +++Y G  +P  P  ++++P +D S  KVF   ++   +F+E+   F V+++ +   G   +KA   +PS   +   V  N DG+Y   Y+P++ G ++++VTY+D+PI NSPF + V  GC PS+V   G GL+  FTN+PN FT+   GAG G LG+ +EGPS++KINC DN DG+C+ EY    PG YD+ I +    + GSPF++P++D ++ + VK  G  L  G   RV Q  +FTVD+S+AG APL+      +G   P+ +    +   G + +T+ P++ GP+ + +K+A+  +P +PF   +LP  +  KV   G G++  G  +  S+PV F ID  +AG+G + + +++ +       + D   G +   Y P   G++ I V +    +   P+ +   Q GDA+KC     G+   +    E    ++   AG+GK++C +  LT +G E ++++     IEN  +GT  I+Y+  +   Y++ ++FGGV IPN  F                +  T+  +    +       G  P +  +P ++    +   V  PSG   +  + DN +G+VT+RY P E G+HEM++   G  I  SP +F+      G V+AYGPGL +G     A FTIVT+DAG GGL LAIEGPSKAEI C DN++G+C VTY P +PGDYSI++K+ D +IPGSPF A I  + +R SQ+ +GS +D  L I+  D+S+LTAS++APSG++E C+LK++PN+++GISF PREVG H +++ ++G H+  SP  I+V Q+EIGDA + +V+G GL  G + EM+ F VDTR+AGYGG+SL++EGPSK +I+  D  DGTC+VSY P+ PG Y+++ K+A+EHV GSPF VKI+GE   ++ E I     A  +  VGS C+L LK+P  + SDM A VT+  G     EI+ +    + ++F+P+EMG+HTV V++R  H+ GSPFQFTVGP+ +GGAHKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI F+D K+GSCGV Y   EPG Y  SIKFND+HI  SP+           + V +  D+A        + +   VN P +  IR   + GK+ A +  PS   E   +  +E ++YA+RFIP E+G H I+V  +    H+ GSPF+V +G+  Q  +P +V A G GL  G  G ++ F +NT  +G G L+VTI+GPSKV++  QE  EGY+ +Y P APG Y I+VKYGG  HI GSPF A ++       GS N++S I V   +    +T      +++P  SS A KV   G G+ KA + Q ++F VD S+AG+++L +G+ GP + CEEVS+KH+G  Q+ + Y+V+E+G + L VKWGE++IPGSPF V V
Sbjct:  638 PATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMD--GTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS-HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGD-AVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNG--LENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-----DPSKVKAHGPGL--EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPC---EAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKD-GTYAVTYVPLTAG-MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQ--SFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGD---GTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG--VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTV--LTPDGTEAEADV-----IENE-DGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPF---------------TVMVTEEAYVPVSDMNG---LGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGE--GRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPY----------LVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDV--KFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETC----YSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2577          

HSP 2 Score: 1089.33 bits (2816), Expect = 0.000e+0
Identity = 760/2285 (33.26%), Postives = 1131/2285 (49.50%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTD-----HDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGF-TNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSST---IP---GTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV----APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-------EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG--EVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVP------LKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGI-SNEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ + +   ++R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGLVW LILHYSISMP+WE E       KQTPKQR++ WI  ++P   + N   +W DG A+GALVDSCAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE+I P+VDE ++MTYLSQFP AK+ PGAP+  KLNP K R YG GIE    +  Q A+FTVD  SAG+G++ + + D  G   + ++    DK   Y   Y P   G + +TV +A + I +SPF+V++DK  GD SKV  KGPG+E  G I +  TYF I T  AG G+I   V  P G K+ +   +  +    YR  Y   + G H + IF +   I  SPF V V    N      SGRG+Q  G+R+ +  +F +DT+ AG+G+L V +  P+  EE VK  +     +   Y PS PG Y + I +    + +SPF++ V P      + A+GPGL  G+VG++A FV ++ G E+GSLGF+IEGPS+AKIE  D  DGS  + YWP  PGEYAVHI+CD EDI +SPYMA I P+    +   ++ YGPG++K G  +N+  EFT+D  +  K+ +K  A      G  I + + +  +  Y C Y P+    H + V     ++P SP++V + Q S+P  V+V G G+  +      P +F++D T AG G+++V I  +   +       D D     +D F V Y P  +G  Y   + +    IP SPF +++ P  D SKV  E     +  +       F V  K     GK  +   F  P     G  VK      N D S++  Y+P   G   + VTY   PI  SPF + V    D SK+ +   GLE      +   FT+D  GA GQG L + I  PS   + C   L    T   +ST   IP   G Y + + ++   V GSP+ +    P + + VK  G  L  G + +   P  FT+D   AG   L          E P E K    +   G   ++++PT+ G + + I    + +PG+PF  +I    +P KV   G G+        G L+        +D SEAG G + L   +         I +   G +   Y P  AG + +T+ +    V + P  V+V    D ++  +       +D  +E                  +  +  R  PLT+ G   +K++++ P        + +N +GT  + Y+P E   ++V++ +  V IPN  FK    +         +    K  F +  N  T  T G            G   +   V  PS   ES +   DN +GS +  Y P   G +++N+T  G  I GSP++   ++     KV   GPGL  G R  +   FT+ +  AG   L + + GP      +   DN +G+  VTY P   G Y + +K+AD  IP SPF   ++           G   S+  VP        I+  D     L   +    GK +  I+    +    +++ P + G + I V   G  I  SP++I   Q   GDASK    G G+   + + E   F VD + AG G ++ ++  P  ++AE +  +N DGT  + YT ++PGTY+I +++    +  SPF V +T E    +          +D+  +G +    L +P      ++   V    G T   EI+D  DG  ++++ P E+GLH + +++   HIP SP QF V     G    V A G GL  G  +    F+I T +AG GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +K+ND HI  SPF   + +            D+    +  +G  A F ++  +T        L A+I  PS  +EP +++ +  N   I FIP+E GEHL+++       H+  SP  +++ Q    D       G GL  G   + + FIV+T ++G G +++ ++GPSKV + +++ E+G  +  Y P+ PG Y ++ K+  + H+ GSPFT  IS                      G+  V    T++S A  V         AT+  +   N+   +  +  +   +  P  +  E  +  MG+N   + ++ QE G H + VK+  +++ GSPF
Sbjct:    4 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLD-RESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDD-DAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQ--DGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAG-RYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTK---GAGKAPLNVQFNSP---LPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKL--NGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPC---LVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGK---PAEFTIDTKGAGTGGLGLTV------EGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLS--------VDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATT---------------DFTVDSR--PLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGA-----------GIGGLGITVEGPS---ESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQT--GDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMVTEEAYVPV----------SDMNGLGFK-PFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSG---SVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITD------------DSRRCSQVKLGSAADFLLDISETDL----SSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK--NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKF-ADEHVPGSPFTVKIS----------------------GEGRVKESITRTSRAPSV---------ATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPF 2157          

HSP 3 Score: 324.324 bits (830), Expect = 3.697e-88
Identity = 278/985 (28.22%), Postives = 446/985 (45.28%), Query Frame = 3
Query:  831 PGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIF--VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKP-EASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS--NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHG--NLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCD--PSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSIN----RVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKV--KVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAF 3728
            P +P   K+ P    +KV   GPG+ S  + A    +F +DA  AG G L + ITD  GK     + +  +K   Y  TY P   G Y I V Y   DIP SP+++   +T GD SK    GPGI    V       F++  + AG G+++C VL+P G + + +  + +    +Y + YTA + G + I +      I NSPF VMV+  +   +  ++G G +   + +     F +       G++  ++  P     + +I +         Y P++ G++E+ I Y    +  SP +  V    +  ++A+GPGL  GV  K A F  VT+  GE G L  +IEGPS+A+I C DN+DG+ T+ Y PT PG+Y++ +  + + IP SP+ A I  +++    S++K            L S  +F +D  E  +D+    AS    SG + P ++    N      + P   G H V +  +   V  SP  + V Q    +    +V G GL     +  + F +DT +AG+G  +LAVE   ++        + D +     V Y P   G VY  S ++   ++PGSPFT++I  E  + +      +            +N K I       + A  T PS   + + +   G  S+   + P + G + + V Y    +  SPF   V P  +    KV   G GLE G    P  F+I    AG G L +A+EGPS A+I   D+ +G+C V Y +  PG Y++ IKFND  +  SP+ +P+  P + A        LT  S+     +V+QP +F +  + A +  + A      G      +   E   P  Y + F+P E G H I++K     V G+PF   +    EP +     +           T  +  +F I+ + AG G + +++  P  + +      EG   +   YTP   G + I+V +
Sbjct: 1503 PRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHD--NKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQT-GDASKCLATGPGIAST-VKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEAD--VIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMVTEEAYVPVSDMNGLGFKPFDLVI----PFAVR-----KGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGE-GGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKI--TDDSRRCSQVK------------LGSAADFLLDISE--TDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVD-----IQTEDLEDGTCKVSYFPTVPG-VYIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLK-IPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARR------LTVMSLQESGLKVNQPASFAIRLNGA-KGKIDAKVHSPSGAVEECHVSELE---PDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRV---GEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEG---YKVMYTPMAPGNYLISVKY 2432          

HSP 4 Score: 303.138 bits (775), Expect = 1.013e-81
Identity = 373/1468 (25.41%), Postives = 601/1468 (40.94%), Query Frame = 3
Query:  786 AMMTYLSQFPNAKVNPGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDA---FSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSG-DPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTT-GVVGKAAI-FVTDTN--GELGSLGFSI---EGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASC--FTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIK-PEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNL--DGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFK-LPIRDPINTAN-VKCFGEPLTPGSINRVDQPITFTVDASRAG-----EAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVP--------VQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVK--EYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGK----VAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHN-IPGSPFIANIIGE-------------------PQRRSQIC-------------------------IGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVV 4928
            A M  L+     ++ P  P   K+ P    ++++V+GPGIE KD+    T +FTVD+      G  ++   I + +G   +  + +  D    Y+  YTP  KG + + V Y +  IP SPFKV +  T G  PS+V+ +GPG+++     +    F + T  AG G +   V  PS  + KIN +  ++   S   EY     G + +NI    A I  SPF V V    +   V ++G G+ S G+R      F +D+  AG   L V++L P    E V + +         Y PS+ G Y + + Y +  + RSPFK+ VLPT   S + A GPGL++ GV     + F  D    GE G L   I   EG  +  I   DN+DG+  + Y P   G Y + +   G+DIP SPY    + + +  D SK    GPG+    V       F +D    K+  K + +C   T  G E    +    +  Y   Y     G + ++V      +P SPF V V + +      + G G        P  F++       G +  E++   G      + ++ D  +  V Y P   G ++   I+Y G +IP SP    +  P       +   L   +  ++    +V   A    G+G +      PS  +   +   N DG+ + +Y P   G Y + V Y D  I  SPF  ++         +  G   +         F +D+      +L  +I+ PS     C      +    + +     G + + IK N   V  SP   + ++  I  A   K +G  L+ G    +   I  T DA   G     E P K            ++I++ E+   G   +++ PT  G + +  K A+  VPG+PF            VK+ GEG        T   P           ++ + E    D+   +++P   +   +I+  GK   C ++ P + G H ++V +    V   PF   V  +G+     +  G    E          +I T EAG G +S  +      G  K+ ++     +++ NG+  + Y   E   Y V IKF    IP   +    I P++    +  +   +S     +           P  F + ++     ++A V +PSG  E   V +       +R+ P E G+H ++V  +G  + GSP+K      G       V+AYG GL  G TG+ +EF I T  AG G LS+ IEGPSK ++ C++   G   V Y P+ PG+Y I +K+   N I GSPF A + G+                    +  ++ C                         +G  S   +  +    + L   V  P+   E   +K + N    +++  +E G++ + V     HI GSPF + V
Sbjct: 1199 AGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNAD--GTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAV--TEGCQPSRVQAQGPGLKE--AFTNKPNVFTVVTRGAGIGGLGITVEGPS--ESKINCRDNKDGSCS--AEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGS-GVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGE-GLLAVQITDQEGKPKRAI-VHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYR---IRATQTGDASKCLATGPGIAST-VKTGEEVGFVVDA---KTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMVTEEAYVPVSDMNGLGFKPFDLVIP--FAVR-----KGEITGEVHMPSGKTATPEIVDNKDGTV-TVRYAPTEVG-LHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDA----GEGGLDLAIEGPSKAEISCI--DNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAAD---------FLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSK------------VDIQT-EDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFT-----------VKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAV-----EGPSKAEITF----DDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQ-----------PASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEG-YKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2577          

HSP 5 Score: 285.034 bits (728), Expect = 3.588e-76
Identity = 307/1157 (26.53%), Postives = 493/1157 (42.61%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEG--KGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEG--KISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI--------------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYD--------GTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQ----CELTLKVPGTHHSDMRATVTNLYGTTEV--CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEI-----DFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +    P +F +D   AGQGD+ + + +P+       +  +      +  +Y P   G H +TV F    +   PF V V +  GDA+K   +    E +          +   AG G   I   +    E+ + K+ + L VE  + GN      Y P +   ++V I F G +IP   F  +  +  N           + +    R ETTD+      V+ +   + G+  +   +  P G+ E     D  +G     Y P   G + + +T  G  I  SP++      AG+ KV A+GPGL  G  G  A+F + +  +  G L  AIEGPS+A+I   D  +GSCDV Y+P  PG+Y++ I   D +I  SP++A I               G    +S   + + ++  +   +   + L    +   G+     +K   +     S+TP +   H I V   G +I  SP+++ +GQ       KV+VFG G+ + G+ +NE   FTVD  EAG G +S+ I+  ++   E  ++ D         T  V Y P   G Y I + +A++ +  SPF VK+  +PS    +    + E   +++ G +       T+   G   + +     +      V   +IID  D  +++K+ P + G   V+V +    IP SPF   V   +D    K+    N +++G      EF++ TR AG  G L + I  PS+  +         R++ +   K+   E G Y   + ++   +  SP+ +  +    D   V + G     +   +GKPA FT++    T     G L  T+ GP   E      +      ++ ++P + GE+ +N+  E    HIPGSPF+  I +   DP  V A G GL  G VG+     V+   +G G L +    D  +K ++  Q N++G Y   Y+P   G Y +T+KYGG                     E+  H  + +KV+          P   +   KV   G+  K         F VD+   +Q G D +   IA P     E  V       + + Y   EKG H + V + +  IP SPF V V
Sbjct:  242 LKPGAP----LKPKLNPKKARAYGRGIEPTGNMV--KQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEV----EDPQGKNTVELLVE--DKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIR-ETTDFK-----VDTK---AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS--HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKV--DPSHDASK---VKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKD---QEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTA--KFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-DPSKVKAHGPG--LEGGLVGKPAEFTID----TKGAGTGGLGLTVEGP--CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFE--EVHIPGSPFKADI-EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGG---------------------ELVPHFPARVKVE----------PAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAV 1322          

HSP 6 Score: 178.718 bits (452), Expect = 7.257e-44
Identity = 196/761 (25.76%), Postives = 321/761 (42.18%), Query Frame = 3
Query:  771 NVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAK-LVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDGVN-IPGSPFTIQIKPEI--------DISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            N D    +TYL   P         N K  PG+P T+K+  +  R          +  G  A+F +D       +L  +I   +G+     ++ +P+  N    ++ P   G + ++++     +  SP  + + ++  GD  + KV G G+ +      +   FI+ T DAG G IS  V  PS    K++ +       + +V Y     GV+ ++   +   +  SPF V +S     K  +T + R    +   VG   +  +      +  ++  + SP       +I  +  N     ++P + G++ + + Y    VT SPF+  V P        + A GPGL  G  G  A F +       G L  ++EGPS+A+I   D+++GS  + Y    PG Y V I  + E IP SPY+  ++  ++  D  ++ V    +Q+ G+ +N P  F I     K  I  +A   + SG      +S     KY   + P  +G H + V  +   V  SPFKV+V +P    NP  V   G GL   T    + F I+TT AG G L+V I        P  +  D     + + V Y P   G  Y  S++Y G N I GSPF  ++  +         + S + VE++    T     +  +   +A  + +KG G  KA     SSF     K+GS                  +K  G+  Y+ +Y   + G Y+L V + +  I  SPF++ V
Sbjct: 1847 NKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRC-------SQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPN--NHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSD--FIVDTRDAGYGGISLAVEGPS----KVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRA--PSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSD--DARRLTVMS--LQESGLKVNQPASFAIRLNGAKGKI--DAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEG------PSKVKMDCQETPEGYKVMYTPMAPG-NYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2577          
BLAST of Filamin vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 1306.58 bits (3380), Expect = 0.000e+0
Identity = 773/2009 (38.48%), Postives = 1143/2009 (56.89%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQ---DGSATICYWPTAPGEYAVHILCDGEDIPNSPYM--ANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQ-TTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG-EVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANIS-------GSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P T   NP+ VR YGPG+E    I    AEFTVD   AG+  L I   D  G+ ID++++   D    Y C+YTP     +TI V +   +IP SP++V I + S  P KVKV GPG+E++G+  +  T+F +   +AG G++S    C     S D++ ++  I   +  ++ V+Y     G ++I +  +S +I  SPF V V P  +A  V   G G+   G+  G    F + T+ AG   LNV+  SP   + +VK  +I  NY       Y P++ G  ++ + Y   P+ +SPF + V  P   S I   G  L   V VGK   F  DT G    G L  +I  PS   + C         ++T  + P   G YAV +  DG  +P SPY   A++ P     D SK+K +GPG+  EG  +  P EFTID     +          C   E  +  S  G+      Y P   G + V +  +   +P SPFK  +  P +P+ V   G GL           S+D + AG G L +E   + G     ++ N+ D   + V Y P T+G +Y  +++Y G  +P  P  ++++P +D S  KVF   ++   +F+E+   F V+++ +   G   +KA   +PS   +   V  N DG+Y   Y+P++ G ++++VTY+D+PI NSPF + V  GC PS+V   G GL+  FTN+PN FT+   GAG G LG+ +EGPS++KINC DN DG+C+ EY    PG YD+ I +    + GSPF++P++D ++ + VK  G  L  G   RV Q  +FTVD+S+AG APL+      +G   P+ +    +   G + +T+ P++ GP+ + +K+A+  +P +PF   +LP  +  KV   G G++  G  +  S+PV F ID  +AG+G + + +++ +       + D   G +   Y P   G++ I V +    +   P+ +   Q GDA+KC     G+   +    E    ++   AG+GK++C +  LT +G E ++++     IEN  +GT  I+Y+  +   Y++ ++FGGV IPN  F                +  T+  +    +       G  P +  +P ++    +   V  PSG   +  + DN +G+VT+RY P E G+HEM++   G  I  SP +F+      G V+AYGPGL +G     A FTIVT+DAG GGL LAIEGPSKAEI C DN++G+C VTY P +PGDYSI++K+ D +IPGSPF A I  + +R SQ+ +GS +D  L I+  D+S+LTAS++APSG++E C+LK++PN+++GISF PREVG H +++ ++G H+  SP  I+V Q+EIGDA + +V+G GL  G + EM+ F VDTR+AGYGG+SL++EGPSK +I+  D  DGTC+VSY P+ PG Y+++ K+A+EHV GSPF VKI+GE   ++ E I     A  +  VGS C+L LK+P  + SDM A VT+  G     EI+ +    + ++F+P+EMG+HTV V++R  H+ GSPFQFTVGP+ +GGAHKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI F+D K+GSCGV Y   EPG Y  SIKFND+HI  SP+           + V +  D+A        + +   VN P +  IR   + GK+ A +  PS   E   +  +E ++YA+RFIP E+G H I+V  +    H+ GSPF+V +G+  Q  +P +V A G GL  G  G ++ F +NT  +G G L+VTI+GPSKV++  QE  EGY+ +Y P APG Y I+VKYGG  HI GSPF A ++       GS N++S I V   +    +T      +++P  SS A KV   G G+ KA + Q ++F VD S+AG+++L +G+ GP + CEEVS+KH+G  Q+ + Y+V+E+G + L VKWGE++IPGSPF V V
Sbjct:  469 PATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMD--GTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS-HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGD-AVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNG--LENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-----DPSKVKAHGPGL--EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPC---EAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKD-GTYAVTYVPLTAG-MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQ--SFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGD---GTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG--VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTV--LTPDGTEAEADV-----IENE-DGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPF---------------TVMVTEEAYVPVSDMNG---LGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGE--GRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPY----------LVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDV--KFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETC----YSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2408          

HSP 2 Score: 874.389 bits (2258), Expect = 0.000e+0
Identity = 657/2105 (31.21%), Postives = 1000/2105 (47.51%), Query Frame = 3
Query:  645 LCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTD-----HDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGF-TNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSST---IP---GTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV----APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-------EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG--EVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII---------GEPQRRSQICIGSTSDVPLKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGI-SNEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            LCPDW  W P   + + +EAM  A+ WL VPQ+I PEE+I P+VDE ++MTYLSQFP AK+ PGAP+  KLNP K R YG GIE    +  Q A+FTVD  SAG+G++ + + D  G   + ++    DK   Y   Y P   G + +TV +A + I +SPF+V++DK  GD SKV  KGPG+E  G I +  TYF I T  AG G+I   V  P G K+ +   +  +    YR  Y   + G H + IF +   I  SPF V V    N      SGRG+Q  G+R+ +  +F +DT+ AG+G+L V +  P+  EE VK  +     +   Y PS PG Y + I +    + +SPF++ V P      + A+GPGL  G+VG++A FV ++ G E+GSLGF+IEGPS+AKIE  D  DGS  + YWP  PGEYAVHI+CD EDI +SPYMA I P+    +   ++ YGPG++K G  +N+  EFT+D  +  K+ +K  A      G  I + + +  +  Y C Y P+    H + V     ++P SP++V + Q S+P  V+V G G+  +      P +F++D T AG G+++V I  +   +       D D     +D F V Y P  +G  Y   + +    IP SPF +++ P  D SKV  E     +  +       F V  K     GK  +   F  P     G  VK      N D S++  Y+P   G   + VTY   PI  SPF + V    D SK+ +   GLE      +   FT+D  GA GQG L + I  PS   + C   L    T   +ST   IP   G Y + + ++   V GSP+ +    P + + VK  G  L  G + +   P  FT+D   AG   L          E P E K    +   G   ++++PT+ G + + I    + +PG+PF  +I    +P KV   G G+        G L+        +D SEAG G + L   +         I +   G +   Y P  AG + +T+ +    V + P  V+V    D ++  +       +D  +E                  +  +  R  PLT+ G   +K++++ P        + +N +GT  + Y+P E   ++V++ +  V IPN  FK    +         +    K  F +  N  T  T G            G   +   V  PS   ES +   DN +GS +  Y P   G +++N+T  G  I GSP++   ++     KV   GPGL  G R  +   FT+ +  AG   L + + GP      +   DN +G+  VTY P   G Y + +K+AD  IP SPF   ++               S   + ++  V   I+  D     L   +    GK +  I+    +    +++ P + G + I V   G  I  SP++I   Q   GDASK    G G+   + + E   F VD + AG G ++ ++  P  ++AE +  +N DGT  + YT ++PGTY+I +++    +  SPF V +T E    +          +D+  +G +    L +P      ++   V    G T   EI+D  DG  ++++ P E+GLH + +++   HIP SP QF V     G    V A G GL  G  +    F+I T +AG GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +K+ND HI  SPF   + +            D+    +  +G  A F ++  +T        L A+I  PS  +EP +++ +  N   I FIP+E GEHL+++       H+  SP  +++ Q    D       G GL  G   + + FIV+T ++G G +++ ++GPSKV + +++ E+G  +  Y P+ PG Y ++ K+  + H+ GSPFT  IS                      G+  V    T++S A  V         AT+  +   N+   +  +  +   +  P  +  E  +  MG+N   + ++ QE G H + VK+  +++ GSPF
Sbjct:   13 LCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQ--DGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAG-RYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTK---GAGKAPLNVQFNSP---LPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKL--NGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPC---LVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGK---PAEFTIDTKGAGTGGLGLTV------EGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLS--------VDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATT---------------DFTVDSR--PLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGA-----------GIGGLGITVEGPS---ESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQT--GDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMVTEEAYVPV----------SDMNGLGFK-PFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSG---SVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITD------------DSRRCSQVKLGSAADFLLDISETDL----SSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK--NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKF-ADEHVPGSPFTVKIS----------------------GEGRVKESITRTSRAPSV---------ATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPF 1988          

HSP 3 Score: 323.553 bits (828), Expect = 6.345e-88
Identity = 278/985 (28.22%), Postives = 446/985 (45.28%), Query Frame = 3
Query:  831 PGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIF--VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKP-EASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS--NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHG--NLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCD--PSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSIN----RVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKV--KVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAF 3728
            P +P   K+ P    +KV   GPG+ S  + A    +F +DA  AG G L + ITD  GK     + +  +K   Y  TY P   G Y I V Y   DIP SP+++   +T GD SK    GPGI    V       F++  + AG G+++C VL+P G + + +  + +    +Y + YTA + G + I +      I NSPF VMV+  +   +  ++G G +   + +     F +       G++  ++  P     + +I +         Y P++ G++E+ I Y    +  SP +  V    +  ++A+GPGL  GV  K A F  VT+  GE G L  +IEGPS+A+I C DN+DG+ T+ Y PT PG+Y++ +  + + IP SP+ A I  +++    S++K            L S  +F +D  E  +D+    AS    SG + P ++    N      + P   G H V +  +   V  SP  + V Q    +    +V G GL     +  + F +DT +AG+G  +LAVE   ++        + D +     V Y P   G VY  S ++   ++PGSPFT++I  E  + +      +            +N K I       + A  T PS   + + +   G  S+   + P + G + + V Y    +  SPF   V P  +    KV   G GLE G    P  F+I    AG G L +A+EGPS A+I   D+ +G+C V Y +  PG Y++ IKFND  +  SP+ +P+  P + A        LT  S+     +V+QP +F +  + A +  + A      G      +   E   P  Y + F+P E G H I++K     V G+PF   +    EP +     +           T  +  +F I+ + AG G + +++  P  + +      EG   +   YTP   G + I+V +
Sbjct: 1334 PRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHD--NKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQT-GDASKCLATGPGIAST-VKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEAD--VIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMVTEEAYVPVSDMNGLGFKPFDLVI----PFAVR-----KGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGE-GGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKI--TDDSRRCSQVK------------LGSAADFLLDISE--TDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVD-----IQTEDLEDGTCKVSYFPTVPG-VYIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLK-IPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARR------LTVMSLQESGLKVNQPASFAIRLNGA-KGKIDAKVHSPSGAVEECHVSELE---PDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRV---GEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEG---YKVMYTPMAPGNYLISVKY 2263          

HSP 4 Score: 301.982 bits (772), Expect = 2.292e-81
Identity = 371/1467 (25.29%), Postives = 600/1467 (40.90%), Query Frame = 3
Query:  786 AMMTYLSQFPNAKVNPGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDA---FSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTT-GVVGKAAI-FVTDTN--GELGSLGFSI---EGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASC--FTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIK-PEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNL--DGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFK-LPIRDPINTAN-VKCFGEPLTPGSINRVDQPITFTVDASRAG-----EAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVP--------VQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVK--EYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGK----VAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHN-IPGSPFIANIIGE-------------------PQRRSQIC-------------------------IGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVV 4928
            A M  L+     ++ P  P   K+ P    ++++V+GPGIE KD+    T +FTVD+      G  ++   I + +G   +  + +  D    Y+  YTP  KG + + V Y +  IP SPFKV + +    PS+V+ +GPG+++     +    F + T  AG G +   V  PS  + KIN +  ++   S   EY     G + +NI    A I  SPF V V    +   V ++G G+ S G+R      F +D+  AG   L V++L P    E V + +         Y PS+ G Y + + Y +  + RSPFK+ VLPT   S + A GPGL++ GV     + F  D    GE G L   I   EG  +  I   DN+DG+  + Y P   G Y + +   G+DIP SPY    + + +  D SK    GPG+    V       F +D    K+  K + +C   T  G E    +    +  Y   Y     G + ++V      +P SPF V V + +      + G G        P  F++       G +  E++   G      + ++ D  +  V Y P   G ++   I+Y G +IP SP    +  P       +   L   +  ++    +V   A    G+G +      PS  +   +   N DG+ + +Y P   G Y + V Y D  I  SPF  ++         +  G   +         F +D+      +L  +I+ PS     C      +    + +     G + + IK N   V  SP   + ++  I  A   K +G  L+ G    +   I  T DA   G     E P K            ++I++ E+   G   +++ PT  G + +  K A+  VPG+PF            VK+ GEG        T   P           ++ + E    D+   +++P   +   +I+  GK   C ++ P + G H ++V +    V   PF   V  +G+     +  G    E          +I T EAG G +S  +      G  K+ ++     +++ NG+  + Y   E   Y V IKF    IP   +    I P++    +  +   +S     +           P  F + ++     ++A V +PSG  E   V +       +R+ P E G+H ++V  +G  + GSP+K      G       V+AYG GL  G TG+ +EF I T  AG G LS+ IEGPSK ++ C++   G   V Y P+ PG+Y I +K+   N I GSPF A + G+                    +  ++ C                         +G  S   +  +    + L   V  P+   E   +K + N    +++  +E G++ + V     HI GSPF + V
Sbjct: 1030 AGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNAD--GTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGC-QPSRVQAQGPGLKE--AFTNKPNVFTVVTRGAGIGGLGITVEGPS--ESKINCRDNKDG--SCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGS-GVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGE-GLLAVQITDQEGKPKRAI-VHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYR---IRATQTGDASKCLATGPGIAST-VKTGEEVGFVVDA---KTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMVTEEAYVPVSDMNGLGFKPFDLVIP--FAVR-----KGEITGEVHMPSGKTATPEIVDNKDGTV-TVRYAPTEVG-LHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDA----GEGGLDLAIEGPSKAEISCI--DNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAAD---------FLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSK------------VDIQT-EDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFT-----------VKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAV-----EGPSKAEITF----DDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQ-----------PASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEG-YKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2408          

HSP 5 Score: 284.263 bits (726), Expect = 5.951e-76
Identity = 307/1157 (26.53%), Postives = 493/1157 (42.61%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEG--KGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEG--KISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI--------------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYD--------GTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQ----CELTLKVPGTHHSDMRATVTNLYGTTEV--CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEI-----DFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +    P +F +D   AGQGD+ + + +P+       +  +      +  +Y P   G H +TV F    +   PF V V +  GDA+K   +    E +          +   AG G   I   +    E+ + K+ + L VE  + GN      Y P +   ++V I F G +IP   F  +  +  N           + +    R ETTD+      V+ +   + G+  +   +  P G+ E     D  +G     Y P   G + + +T  G  I  SP++      AG+ KV A+GPGL  G  G  A+F + +  +  G L  AIEGPS+A+I   D  +GSCDV Y+P  PG+Y++ I   D +I  SP++A I               G    +S   + + ++  +   +   + L    +   G+     +K   +     S+TP +   H I V   G +I  SP+++ +GQ       KV+VFG G+ + G+ +NE   FTVD  EAG G +S+ I+  ++   E  ++ D         T  V Y P   G Y I + +A++ +  SPF VK+  +PS    +    + E   +++ G +       T+   G   + +     +      V   +IID  D  +++K+ P + G   V+V +    IP SPF   V   +D    K+    N +++G      EF++ TR AG  G L + I  PS+  +         R++ +   K+   E G Y   + ++   +  SP+ +  +    D   V + G     +   +GKPA FT++    T     G L  T+ GP   E      +      ++ ++P + GE+ +N+  E    HIPGSPF+  I +   DP  V A G GL  G VG+     V+   +G G L +    D  +K ++  Q N++G Y   Y+P   G Y +T+KYGG                     E+  H  + +KV+          P   +   KV   G+  K         F VD+   +Q G D +   IA P     E  V       + + Y   EKG H + V + +  IP SPF V V
Sbjct:   73 LKPGAP----LKPKLNPKKARAYGRGIEPTGNMV--KQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEV----EDPQGKNTVELLVE--DKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIR-ETTDFK-----VDTK---AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS--HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKV--DPSHDASK---VKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKD---QEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTA--KFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-DPSKVKAHGPG--LEGGLVGKPAEFTID----TKGAGTGGLGLTVEGP--CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFE--EVHIPGSPFKADI-EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGG---------------------ELVPHFPARVKVE----------PAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAV 1153          

HSP 6 Score: 177.948 bits (450), Expect = 1.213e-43
Identity = 196/761 (25.76%), Postives = 321/761 (42.18%), Query Frame = 3
Query:  771 NVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAK-LVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDGVN-IPGSPFTIQIKPEI--------DISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            N D    +TYL   P         N K  PG+P T+K+  +  R          +  G  A+F +D       +L  +I   +G+     ++ +P+  N    ++ P   G + ++++     +  SP  + + ++  GD  + KV G G+ +      +   FI+ T DAG G IS  V  PS    K++ +       + +V Y     GV+ ++   +   +  SPF V +S     K  +T + R    +   VG   +  +      +  ++  + SP       +I  +  N     ++P + G++ + + Y    VT SPF+  V P        + A GPGL  G  G  A F +       G L  ++EGPS+A+I   D+++GS  + Y    PG Y V I  + E IP SPY+  ++  ++  D  ++ V    +Q+ G+ +N P  F I     K  I  +A   + SG      +S     KY   + P  +G H + V  +   V  SPFKV+V +P    NP  V   G GL   T    + F I+TT AG G L+V I        P  +  D     + + V Y P   G  Y  S++Y G N I GSPF  ++  +         + S + VE++    T     +  +   +A  + +KG G  KA     SSF     K+GS                  +K  G+  Y+ +Y   + G Y+L V + +  I  SPF++ V
Sbjct: 1678 NKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRC-------SQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPN--NHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSD--FIVDTRDAGYGGISLAVEGPS----KVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRA--PSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSD--DARRLTVMS--LQESGLKVNQPASFAIRLNGAKGKI--DAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEG------PSKVKMDCQETPEGYKVMYTPMAPG-NYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2408          
BLAST of Filamin vs. Ensembl Human
Match: FLNB (filamin B [Source:HGNC Symbol;Acc:HGNC:3755])

HSP 1 Score: 1303.5 bits (3372), Expect = 0.000e+0
Identity = 781/2043 (38.23%), Postives = 1149/2043 (56.24%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQ---DGSATICYWPTAPGEYAVHILCDGEDIPNSPYM--ANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQ-TTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPL-------KACCKDNQGHEYPLEIKSR---------------------ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG-EVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNE-----TTDYTN-GMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANIS-------GSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P T   NP+ VR YGPG+E    I    AEFTVD   AG+  L I   D  G+ ID++++   D    Y C+YTP     +TI V +   +IP SP++V I + S  P KVKV GPG+E++G+  +  T+F +   +AG G++S    C     S D++ ++  I   +  ++ V+Y     G ++I +  +S +I  SPF V V P  +A  V   G G+   G+  G    F + T+ AG   LNV+  SP   + +VK  +I  NY       Y P++ G  ++ + Y   P+ +SPF + V  P   S I   G  L   V VGK   F  DT G    G L  +I  PS   + C         ++T  + P   G YAV +  DG  +P SPY   A++ P     D SK+K +GPG+  EG  +  P EFTID     +          C   E  +  S  G+      Y P   G + V +  +   +P SPFK  +  P +P+ V   G GL           S+D + AG G L +E   + G     ++ N+ D   + V Y P T+G +Y  +++Y G  +P  P  ++++P +D S  KVF   ++   +F+E+   F V+++ +   G   +KA   +PS   +   V  N DG+Y   Y+P++ G ++++VTY+D+PI NSPF + V  GC PS+V   G GL+  FTN+PN FT+   GAG G LG+ +EGPS++KINC DN DG+C+ EY    PG YD+ I +    + GSPF++P++D ++ + VK  G  L  G   RV Q  +FTVD+S+AG APL       +A   D+Q    PL+  S                       +   G + +T+ P++ GP+ + +K+A+  +P +PF   +LP  +  KV   G G++  G  +  S+PV F ID  +AG+G + + +++ +       + D   G +   Y P   G++ I V +    +   P+ +   Q GDA+KC     G+   +    E    ++   AG+GK++C +  LT +G E ++++     IEN  +GT  I+Y+  +   Y++ ++FGGV IPN  F     D      E   +      F  +  E      +D    G  P +  +P ++    +   V  PSG   +  + DN +G+VT+RY P E G+HEM++   G  I  SP +F+      G V+AYGPGL +G     A FTIVT+DAG GGL LAIEGPSKAEI C DN++G+C VTY P +PGDYSI++K+ D +IPGSPF A I  + +R SQ+ +GS +D  L I+  D+S+LTAS++APSG++E C+LK++PN+++GISF PREVG H +++ ++G H+  SP  I+V Q+EIGDA + +V+G GL  G + EM+ F VDTR+AGYGG+SL++EGPSK +I+  D  DGTC+VSY P+ PG Y+++ K+A+EHV GSPF VKI+GE   ++ E I     A  +  VGS C+L LK+P  + SDM A VT+  G     EI+ +    + ++F+P+EMG+HTV V++R  H+ GSPFQFTVGP+ +GGAHKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI F+D K+GSCGV Y   EPG Y  SIKFND+HI  SP+           + V +  D+A        + +   VN P +  IR   + GK+ A +  PS   E   +  +E ++YA+RFIP E+G H I+V  +    H+ GSPF+V +G+  Q  +P +V A G GL  G  G ++ F +NT  +G G L+VTI+GPSKV++  QE  EGY+ +Y P APG Y I+VKYGG  HI GSPF A ++       GS N++S I V   +    +T      +++P  SS A KV   G G+ KA + Q ++F VD S+AG+++L +G+ GP + CEEVS+KH+G  Q+ + Y+V+E+G + L VKWGE++IPGSPF V V
Sbjct:  638 PATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMD--GTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS-HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGD-AVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNG--LENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-----DPSKVKAHGPGL--EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPC---EAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKD-GTYAVTYVPLTAG-MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQ--SFTVDSSKAGLAPLEVRVLGPRADDTDSQSWRSPLKALSEFFKGDPKGDFNKTGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG--VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTV--LTPDGTEAEADV-----IENE-DGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGE--GRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPY----------LVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDV--KFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETC----YSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2632          

HSP 2 Score: 1074.31 bits (2777), Expect = 0.000e+0
Identity = 762/2330 (32.70%), Postives = 1135/2330 (48.71%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTD-----HDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGF-TNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSST---IP---GTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV----APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-------EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG--EVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCK---------------------------------DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVP------LKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGI-SNEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKII----------CQQEA----ADITQVGSQCELTLKVP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ + +   ++R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGLVW LILHYSISMP+WE E       KQTPKQR++ WI  ++P   + N   +W DG A+GALVDSCAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE+I P+VDE ++MTYLSQFP AK+ PGAP+  KLNP K R YG GIE    +  Q A+FTVD  SAG+G++ + + D  G   + ++    DK   Y   Y P   G + +TV +A + I +SPF+V++DK  GD SKV  KGPG+E  G I +  TYF I T  AG G+I   V  P G K+ +   +  +    YR  Y   + G H + IF +   I  SPF V V    N      SGRG+Q  G+R+ +  +F +DT+ AG+G+L V +  P+  EE VK  +     +   Y PS PG Y + I +    + +SPF++ V P      + A+GPGL  G+VG++A FV ++ G E+GSLGF+IEGPS+AKIE  D  DGS  + YWP  PGEYAVHI+CD EDI +SPYMA I P+    +   ++ YGPG++K G  +N+  EFT+D  +  K+ +K  A      G  I + + +  +  Y C Y P+    H + V     ++P SP++V + Q S+P  V+V G G+  +      P +F++D T AG G+++V I  +   +       D D     +D F V Y P  +G  Y   + +    IP SPF +++ P  D SKV  E     +  +       F V  K     GK  +   F  P     G  VK      N D S++  Y+P   G   + VTY   PI  SPF + V    D SK+ +   GLE      +   FT+D  GA GQG L + I  PS   + C   L    T   +ST   IP   G Y + + ++   V GSP+ +    P + + VK  G  L  G + +   P  FT+D   AG   L          E P E K    +   G   ++++PT+ G + + I    + +PG+PF  +I    +P KV   G G+        G L+        +D SEAG G + L   +         I +   G +   Y P  AG + +T+ +    V + P  V+V    D ++  +       +D  +E                  +  +  R  PLT+ G   +K++++ P        + +N +GT  + Y+P E   ++V++ +  V IPN  FK    +         +    K  F +  N  T  T G            G   +   V  PS   ES +   DN +GS +  Y P   G +++N+T  G  I GSP++   ++     KV   GPGL  G R  +   FT+ +  AG   L + + GP   +   +                                 DN +G+  VTY P   G Y + +K+AD  IP SPF   ++           G   S+  VP        I+  D     L   +    GK +  I+    +    +++ P + G + I V   G  I  SP++I   Q   GDASK    G G+   + + E   F VD + AG G ++ ++  P  ++AE +  +N DGT  + YT ++PGTY+I +++    +  SPF V  T      + E  +            +EA    +D+  +G +    L +P      ++   V    G T   EI+D  DG  ++++ P E+GLH + +++   HIP SP QF V     G    V A G GL  G  +    F+I T +AG GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +K+ND HI  SPF   + +            D+    +  +G  A F ++  +T        L A+I  PS  +EP +++ +  N   I FIP+E GEHL+++       H+  SP  +++ Q    D       G GL  G   + + FIV+T ++G G +++ ++GPSKV + +++ E+G  +  Y P+ PG Y ++ K+  + H+ GSPFT  IS                      G+  V    T++S A  V         AT+  +   N+   +  +  +   +  P  +  E  +  MG+N   + ++ QE G H + VK+  +++ GSPF
Sbjct:    4 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLD-RESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDD-DAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQ--DGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAG-RYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTK---GAGKAPLNVQFNSP---LPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKL--NGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPC---LVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGK---PAEFTIDTKGAGTGGLGLTV------EGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLS--------VDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATT---------------DFTVDSR--PLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGA-----------GIGGLGITVEGPS---ESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRADDTDSQSWRSPLKALSEFFKGDPKGDFNKTGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQT--GDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFK-PFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSG---SVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITD------------DSRRCSQVKLGSAADFLLDISETDL----SSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK--NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKF-ADEHVPGSPFTVKIS----------------------GEGRVKESITRTSRAPSV---------ATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPF 2212          

HSP 3 Score: 285.804 bits (730), Expect = 2.445e-76
Identity = 307/1157 (26.53%), Postives = 493/1157 (42.61%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEG--KGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEG--KISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI--------------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYD--------GTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQ----CELTLKVPGTHHSDMRATVTNLYGTTEV--CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEI-----DFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +    P +F +D   AGQGD+ + + +P+       +  +      +  +Y P   G H +TV F    +   PF V V +  GDA+K   +    E +          +   AG G   I   +    E+ + K+ + L VE  + GN      Y P +   ++V I F G +IP   F  +  +  N           + +    R ETTD+      V+ +   + G+  +   +  P G+ E     D  +G     Y P   G + + +T  G  I  SP++      AG+ KV A+GPGL  G  G  A+F + +  +  G L  AIEGPS+A+I   D  +GSCDV Y+P  PG+Y++ I   D +I  SP++A I               G    +S   + + ++  +   +   + L    +   G+     +K   +     S+TP +   H I V   G +I  SP+++ +GQ       KV+VFG G+ + G+ +NE   FTVD  EAG G +S+ I+  ++   E  ++ D         T  V Y P   G Y I + +A++ +  SPF VK+  +PS    +    + E   +++ G +       T+   G   + +     +      V   +IID  D  +++K+ P + G   V+V +    IP SPF   V   +D    K+    N +++G      EF++ TR AG  G L + I  PS+  +         R++ +   K+   E G Y   + ++   +  SP+ +  +    D   V + G     +   +GKPA FT++    T     G L  T+ GP   E      +      ++ ++P + GE+ +N+  E    HIPGSPF+  I +   DP  V A G GL  G VG+     V+   +G G L +    D  +K ++  Q N++G Y   Y+P   G Y +T+KYGG                     E+  H  + +KV+          P   +   KV   G+  K         F VD+   +Q G D +   IA P     E  V       + + Y   EKG H + V + +  IP SPF V V
Sbjct:  242 LKPGAP----LKPKLNPKKARAYGRGIEPTGNMV--KQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEV----EDPQGKNTVELLVE--DKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIR-ETTDFK-----VDTK---AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS--HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKV--DPSHDASK---VKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKD---QEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTA--KFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-DPSKVKAHGPG--LEGGLVGKPAEFTID----TKGAGTGGLGLTVEGP--CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFE--EVHIPGSPFKADI-EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGG---------------------ELVPHFPARVKVE----------PAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAV 1322          
BLAST of Filamin vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 1170.61 bits (3027), Expect = 0.000e+0
Identity = 766/2259 (33.91%), Postives = 1190/2259 (52.68%), Query Frame = 3
Query:  126 DDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKV-TIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIR----VGDKAEFFIDTQNAGNGKLNVKLLSP-EKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIM-------PSNEK-TDVSKIKVYGPGVQKEGVALNSPNEFT-IDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSAT-RYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQT-TIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVD----VNGSPFKLPI---RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPF---LFNILPKSEPDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXX----XXXXXXXXXXEGKGVFCCQYTPTD-AGKHCITVAFNDSPVK-NCPFIVEVIQVGDANKCFIEDGV--KEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQ--NVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPA--AFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQ-YAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVI-GQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKS---MVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVD 6764
            DDA+WKIIQ+NTFTRWV  HL+KA ++I  L+ DFSDG++L+ L +VLS       NK+  FR+QKLENV++ L F + +E +K+INIDS+ IVD   KLILGLVW LILHYSISM   + +       ++TPKQ++++WI  R+P   + N T+DWNDG A+GALV+S APG   DW  W P DAL +T++AM +A+  L V  LI P EMI P +DE ++MTYLSQFP  K     PI  K    KV+     ++ K L      EF +     G     ++I D  G+ I + ++++ DK+N YK  +TP   G   I V  A  D+    F+  TI + S     V +           V     F +   DA  G +  +V+ P+G + ++   +   SP  +  EY     G+HS+N+F     +  SPF +   P+++ K   V GRGI   GIR    VG   E     +N  N  +++++L P + S   V +   + +         K    +L++            KI+V P  +S I AFG GL  G+V +  +F  + NGE   L F++EGPS+A+I C +  DGSA + Y PT  G Y V +L DG+ I +SP++  +        PS  + T + + KVY  G   E +          +D +     + PE +  +    EI     + G  +Y  +  P     HK+ VS    SVP +PF VKV +P++ + +++ G G+        P  F+ID T AG G + V + D+ G  +   + ++ D   F V Y     G  Y  ++ + G  I  SP  I +KP +D+S + VE L+   +   S +R  +N   ++ K KG    +  + +  +    +K N DG+YS      + G + L + ++++P+K +   +EV+ G D +K   +G GLE     +   F +DLDGAG+G L + + GP+ A+    D  +G C+VEY +  PG Y++ IKF   +    V GSPFK  +   +DP +   +    +P       R++QPI F +D S+  + P+KA    +     P  + SR  + P  +++ FVP+     +I I+   I+  G      L  +LP+ EP  +K++ +    + T   +T +   + H+       G+++   S          L      E  G++   + PTD AG++C+    N   V    P + E  ++G       E+ V   E    +   +   +  +A + K    I  L    +      +   ++N       I ++  +L    +D+ +GG  + + +++           E   I+  +++    + +  D     Y  +F +   LG Q  ++EAIV  P+  +E A + DN +G++ ++Y P+  G HE+++  +G Q+QG+P KF+ +  G G    YGPGL +   G PA FT+  K + A  LS++IEGP+K++I   DN++G+C   + P +PG+Y + +K     +  SPF   ++GE Q+RS + +GSTS+V L I   ++  ++AS+++P G EE C ++ +    LG+SFTPRE G H I V + G  +  +PFKI V + ++GDASKV V G G   GI+ + N   VDT +AGYGGLS+S++GPSKAE+ C++   G  +V YTP+EPG Y I IK+A+ HV  SP  V+ TG+ + ++++ I    E   I     +  L LK+  T   D+ A + +  G T+  E+ DL   +Y +KF PK  G+HT+ V +++ H+ GSPFQFTVG   +GGAHKV A+G G+  G T   N F+IY REAG G +++ IEGPSKA ++F+D  DG+C V Y V  PGEY+ ++KFND HI +SPF++ +        +   V    LA+    G PA  AFT       T R+ G L A +V P+   +   I  IE  + YA+RF+PKE+G H I+VT  +    +  SPFR+ + G+   DP  + A GDGL+ G  G+K  F++NT N+G G L V +DGPSK  L + E E+GY+  Y P APG Y  +VKY G  H  GSPF   + G     +    ++ S++K+D V K+    V  +P     A KV   G G+ K    +   F +D   AG ++L VG+   K  CEEV V+H G   ++ +Y + ++ + ++ +K+G+K IPGSPF ++
Sbjct:   20 DDAEWKIIQQNTFTRWVKNHLQKAGETIESLETDFSDGLKLIALAQVLSHKNVGKFNKKVAFRSQKLENVSLALNFFQNEENIKIINIDSTHIVDHNKKLILGLVWTLILHYSISMGWIQEKREDGDNKEETPKQKLLNWIRNRLPGMPISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPEIDEMSVMTYLSQFPATK-----PIIMK---PKVQATISNLD-KILQVNDPREFDLKLSRDGF-KPKVSIRDEDGQDIHLSLKKVEDKENAYKVKFTPTKIGF--IHVDVAANDV--HTFETQTIPEASVICQVVPIARLLDYNKTAKVGDDVKFAVV--DAIEGPVEAIVVDPTGKEHRMV-ILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKNSFK---VWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIESHKIHVAPESSSKIRAFGAGLEGGIVNEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVG---EKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREI-----TPGLFEYTLI--PDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGS-FTVKYTAQRPG-AYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDP-SQITISGLDQPNY-----RLNQPINFVIDTSKTKDLPVKATVPSDFAQLQP--VVSRSPSNPRHHNVRFVPSGKPNVSIPIE---IIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSF-PTDMAGEYCVVFYINGQEVAARVPVMAE--KIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYE------AIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVR-DLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAP------ATGEVRKLELAQFHGQGIPAGKAFTFT---VLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVT--LDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGY--NETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAIE 2205          

HSP 2 Score: 80.1073 bits (196), Expect = 2.235e-14
Identity = 166/776 (21.39%), Postives = 304/776 (39.18%), Query Frame = 3
Query: 4536 AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSP--FIANIIGE-------PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIEC--RDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI--TGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQF-----TVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIA--IEGPSKAEIDFEDRKDGS--CGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNE-KQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQ--YAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPG---MVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSK----VQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            AEI+  DN +G+  V Y P + G + + I      + G+P  F  +  G+       P  ++ + +G  +   +         L+ S+  P+  +    +    +     ++ P   G + ++V   G  +  SPF+++V    +G+  K       L  G ++E+ +  +  +E    G+S SI+ P   E  C  R    G   VS+TP E G ++I +K   + V  +PF +K+  T    A  +E +    +A  IT   +  EL +      +  +  +V         C+  ++  G   + + P E G++ + ++  + H+  SP        + G ++      V   G  L         E  ++ +      + I   +  P     D E R  G     +K+     G +  S+ + D H+  SPF+  V    +     V + G   +  E   G   AF + + +       G +  TI GPS+    A ++  + N     + +     GE+++ V  +  ++HIP SPF+V I     +     +    G G+ +G   K   F V T +   G L   +  P+     + +   E+ E Y   ++P   G + I V       + G+P                  ++S  ++   GK +    PT  S +      G G+ K T  Q   F ++ + AG  IL V + GP     +      G   + + Y     G ++  VK+   + PGSPF + V
Sbjct: 1380 AEII--DNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKGSQAKELSVSIEGPA--KSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLV----MGEGQK----RSHLSVGSTSEV-ALPITQQE--LKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVE-VSGSGKAKGITLQAN--ELLVDTSKAGYGGLSVSVQGPSKAELTCK--EVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLP------DQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGE--TGTFNAFNIYHREAGV----GAVAVTIEGPSK----ATLEFKDHNDGNCHVDYKVATPGEYVVAV--KFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAG---KAFTFTVLT-HRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVT------LDGAPM-----------------RESPFRLRVGGKDLCD--PTAISAS------GDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG---YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPV 2078          
BLAST of Filamin vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 1169.45 bits (3024), Expect = 0.000e+0
Identity = 766/2259 (33.91%), Postives = 1188/2259 (52.59%), Query Frame = 3
Query:  126 DDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKV-TIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIR----VGDKAEFFIDTQNAGNGKLNVKLLSP-EKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIM-------PSNEK-TDVSKIKVYGPGVQKEGVALNSPNEFT-IDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSAT-RYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQT-TIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVD----VNGSPFKLPI---RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPF---LFNILPKSEPDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXX----XXXXXXXXXXEGKGVFCCQYTPTD-AGKHCITVAFNDSPVK-NCPFIVEVIQVGDANKCFIEDGV--KEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQ--NVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPA--AFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQ-YAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVI-GQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKS---MVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVD 6764
            DDA+WKIIQ+NTFTRWV  HL+KA ++I  L+ DFSDG++L+ L +VLS       NK+  FR+QKLENV++ L F + +E +K+INIDS+ IVD   KLILGLVW LILHYSISM   + +       ++TPKQ++++WI  R+P   + N T+DWNDG A+GALV+S APG   DW  W P DAL +T++AM +A+  L V  LI P EMI P +DE ++MTYLSQFP  K     PI  K    KV+     ++ K L      EF +     G     ++I D  G+ I + ++++ DK+N YK  +TP   G   I V  A  D+    F+  TI + S     V +           V     F +   DA  G +  +V+ P+G + ++   +   SP  +  EY     G+HS+N+F     +  SPF +   P+++ K   V GRGI   GIR    VG   E     +N  N  +++++L P + S   V +   + +         K    +L++            KI+V P  +S I AFG GL  G+V +  +F  + NGE   L F++EGPS+A+I C +  DGSA + Y PT  G Y V +L DG+ I +SP++  +        PS  + T + + KVY  G   E +          +D +     + PE +  +    EI     + G  +Y  +  P     HK+ VS    SVP +PF VKV +P++ + +++ G G+        P  F+ID T AG G + V + D+ G  +   + ++ D   F V Y     G  Y  ++ + G  I  SP  I +KP +D+S + VE L+   +   S +R  +N   ++ K KG    +  + +  +    +K N DG+YS      + G + L + ++++P+K +   +EV+ G D +K   +G GLE     +   F +DLDGAG+G L + + GP+ A+    D  +G C+VEY +  PG Y++ IKF   +    V GSPFK  +   +DP +   +    +P       R++QPI F +D S+  + P+KA    +     P  + SR  + P  +++ FVP+     +I I+   I+  G      L  +LP+ EP  +K++ +    + T   +T +   + H+       G+++   S          L      E  G++   + PTD AG++C+    N   V    P + E  ++G       E+ V   E    +   +   +  +A + K    I  L    +      +   ++N       I ++  +L    +D+ +GG  + + +++           E   I+  +++    + +  D     Y    R    LG Q  ++EAIV  P+  +E A + DN +G++ ++Y P+  G HE+++  +G Q+QG+P KF+ +  G G    YGPGL +   G PA FT+  K + A  LS++IEGP+K++I   DN++G+C   + P +PG+Y + +K     +  SPF   ++GE Q+RS + +GSTS+V L I   ++  ++AS+++P G EE C ++ +    LG+SFTPRE G H I V + G  +  +PFKI V + ++GDASKV V G G   GI+ + N   VDT +AGYGGLS+S++GPSKAE+ C++   G  +V YTP+EPG Y I IK+A+ HV  SP  V+ TG+ + ++++ I    E   I     +  L LK+  T   D+ A + +  G T+  E+ DL   +Y +KF PK  G+HT+ V +++ H+ GSPFQFTVG   +GGAHKV A+G G+  G T   N F+IY REAG G +++ IEGPSKA ++F+D  DG+C V Y V  PGEY+ ++KFND HI +SPF++ +        +   V    LA+    G PA  AFT       T R+ G L A +V P+   +   I  IE  + YA+RF+PKE+G H I+VT  +    +  SPFR+ + G+   DP  + A GDGL+ G  G+K  F++NT N+G G L V +DGPSK  L + E E+GY+  Y P APG Y  +VKY G  H  GSPF   + G     +    ++ S++K+D V K+    V  +P     A KV   G G+ K    +   F +D   AG ++L VG+   K  CEEV V+H G   ++ +Y + ++ + ++ +K+G+K IPGSPF ++
Sbjct:   20 DDAEWKIIQQNTFTRWVKNHLQKAGETIESLETDFSDGLKLIALAQVLSHKNVGKFNKKVAFRSQKLENVSLALNFFQNEENIKIINIDSTHIVDHNKKLILGLVWTLILHYSISMGWIQEKREDGDNKEETPKQKLLNWIRNRLPGMPISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPEIDEMSVMTYLSQFPATK-----PIIMK---PKVQATISNLD-KILQVNDPREFDLKLSRDGF-KPKVSIRDEDGQDIHLSLKKVEDKENAYKVKFTPTKIGF--IHVDVAANDV--HTFETQTIPEASVICQVVPIARLLDYNKTAKVGDDVKFAVV--DAIEGPVEAIVVDPTGKEHRMV-ILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKNSFK---VWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIESHKIHVAPESSSKIRAFGAGLEGGIVNEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVG---EKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREI-----TPGLFEYTLI--PDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGS-FTVKYTAQRPG-AYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDP-SQITISGLDQPNY-----RLNQPINFVIDTSKTKDLPVKATVPSDFAQLQP--VVSRSPSNPRHHNVRFVPSGKPNVSIPIE---IIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSF-PTDMAGEYCVVFYINGQEVAARVPVMAE--KIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYE------AIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFNVR---DLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAP------ATGEVRKLELAQFHGQGIPAGKAFTFT---VLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVT--LDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGY--NETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAIE 2203          

HSP 2 Score: 80.1073 bits (196), Expect = 2.089e-14
Identity = 166/776 (21.39%), Postives = 304/776 (39.18%), Query Frame = 3
Query: 4536 AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSP--FIANIIGE-------PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIEC--RDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI--TGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQF-----TVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIA--IEGPSKAEIDFEDRKDGS--CGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNE-KQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQ--YAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPG---MVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSK----VQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            AEI+  DN +G+  V Y P + G + + I      + G+P  F  +  G+       P  ++ + +G  +   +         L+ S+  P+  +    +    +     ++ P   G + ++V   G  +  SPF+++V    +G+  K       L  G ++E+ +  +  +E    G+S SI+ P   E  C  R    G   VS+TP E G ++I +K   + V  +PF +K+  T    A  +E +    +A  IT   +  EL +      +  +  +V         C+  ++  G   + + P E G++ + ++  + H+  SP        + G ++      V   G  L         E  ++ +      + I   +  P     D E R  G     +K+     G +  S+ + D H+  SPF+  V    +     V + G   +  E   G   AF + + +       G +  TI GPS+    A ++  + N     + +     GE+++ V  +  ++HIP SPF+V I     +     +    G G+ +G   K   F V T +   G L   +  P+     + +   E+ E Y   ++P   G + I V       + G+P                  ++S  ++   GK +    PT  S +      G G+ K T  Q   F ++ + AG  IL V + GP     +      G   + + Y     G ++  VK+   + PGSPF + V
Sbjct: 1378 AEII--DNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKGSQAKELSVSIEGPA--KSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLV----MGEGQK----RSHLSVGSTSEV-ALPITQQE--LKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVE-VSGSGKAKGITLQAN--ELLVDTSKAGYGGLSVSVQGPSKAELTCK--EVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLP------DQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGE--TGTFNAFNIYHREAGV----GAVAVTIEGPSK----ATLEFKDHNDGNCHVDYKVATPGEYVVAV--KFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAG---KAFTFTVLT-HRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVT------LDGAPM-----------------RESPFRLRVGGKDLCD--PTAISAS------GDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG---YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPV 2076          
BLAST of Filamin vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 1166.37 bits (3016), Expect = 0.000e+0
Identity = 766/2261 (33.88%), Postives = 1190/2261 (52.63%), Query Frame = 3
Query:  126 DDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKH--VKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKV-TIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIR----VGDKAEFFIDTQNAGNGKLNVKLLSP-EKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIM-------PSNEK-TDVSKIKVYGPGVQKEGVALNSPNEFT-IDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSAT-RYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQT-TIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVD----VNGSPFKLPI---RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPF---LFNILPKSEPDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXX----XXXXXXXXXXEGKGVFCCQYTPTD-AGKHCITVAFNDSPVK-NCPFIVEVIQVGDANKCFIEDGV--KEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQ--NVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPA--AFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQ-YAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVI-GQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKS---MVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVD 6764
            DDA+WKIIQ+NTFTRWV  HL+KA ++I  L+ DFSDG++L+ L +VLS       NK+  FR+QKLENV++ L F + +E +K+INIDS+ IVD   KLILGLVW LILHYSISM   + +       ++TPKQ++++WI  R+P     + N T+DWNDG A+GALV+S APG   DW  W P DAL +T++AM +A+  L V  LI P EMI P +DE ++MTYLSQFP  K     PI  K    KV+     ++ K L      EF +     G     ++I D  G+ I + ++++ DK+N YK  +TP   G   I V  A  D+    F+  TI + S     V +           V     F +   DA  G +  +V+ P+G + ++   +   SP  +  EY     G+HS+N+F     +  SPF +   P+++ K   V GRGI   GIR    VG   E     +N  N  +++++L P + S   V +   + +         K    +L++            KI+V P  +S I AFG GL  G+V +  +F  + NGE   L F++EGPS+A+I C +  DGSA + Y PT  G Y V +L DG+ I +SP++  +        PS  + T + + KVY  G   E +          +D +     + PE +  +    EI     + G  +Y  +  P     HK+ VS    SVP +PF VKV +P++ + +++ G G+        P  F+ID T AG G + V + D+ G  +   + ++ D   F V Y     G  Y  ++ + G  I  SP  I +KP +D+S + VE L+   +   S +R  +N   ++ K KG    +  + +  +    +K N DG+YS      + G + L + ++++P+K +   +EV+ G D +K   +G GLE     +   F +DLDGAG+G L + + GP+ A+    D  +G C+VEY +  PG Y++ IKF   +    V GSPFK  +   +DP +   +    +P       R++QPI F +D S+  + P+KA    +     P  + SR  + P  +++ FVP+     +I I+   I+  G      L  +LP+ EP  +K++ +    + T   +T +   + H+       G+++   S          L      E  G++   + PTD AG++C+    N   V    P + E  ++G       E+ V   E    +   +   +  +A + K    I  L    +      +   ++N       I ++  +L    +D+ +GG  + + +++           E   I+  +++    + +  D     Y  +F +   LG Q  ++EAIV  P+  +E A + DN +G++ ++Y P+  G HE+++  +G Q+QG+P KF+ +  G G    YGPGL +   G PA FT+  K + A  LS++IEGP+K++I   DN++G+C   + P +PG+Y + +K     +  SPF   ++GE Q+RS + +GSTS+V L I   ++  ++AS+++P G EE C ++ +    LG+SFTPRE G H I V + G  +  +PFKI V + ++GDASKV V G G   GI+ + N   VDT +AGYGGLS+S++GPSKAE+ C++   G  +V YTP+EPG Y I IK+A+ HV  SP  V+ TG+ + ++++ I    E   I     +  L LK+  T   D+ A + +  G T+  E+ DL   +Y +KF PK  G+HT+ V +++ H+ GSPFQFTVG   +GGAHKV A+G G+  G T   N F+IY REAG G +++ IEGPSKA ++F+D  DG+C V Y V  PGEY+ ++KFND HI +SPF++ +        +   V    LA+    G PA  AFT       T R+ G L A +V P+   +   I  IE  + YA+RF+PKE+G H I+VT  +    +  SPFR+ + G+   DP  + A GDGL+ G  G+K  F++NT N+G G L V +DGPSK  L + E E+GY+  Y P APG Y  +VKY G  H  GSPF   + G     +    ++ S++K+D V K+    V  +P     A KV   G G+ K    +   F +D   AG ++L VG+   K  CEEV V+H G   ++ +Y + ++ + ++ +K+G+K IPGSPF ++
Sbjct:   20 DDAEWKIIQQNTFTRWVKNHLQKAGETIESLETDFSDGLKLIALAQVLSHKNVGKFNKKVAFRSQKLENVSLALNFFQNEENIKIINIDSTHIVDHNKKLILGLVWTLILHYSISMGWIQEKREDGDNKEETPKQKLLNWIRNRLPVSGMPISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPEIDEMSVMTYLSQFPATK-----PIIMK---PKVQATISNLD-KILQVNDPREFDLKLSRDGF-KPKVSIRDEDGQDIHLSLKKVEDKENAYKVKFTPTKIGF--IHVDVAANDV--HTFETQTIPEASVICQVVPIARLLDYNKTAKVGDDVKFAVV--DAIEGPVEAIVVDPTGKEHRMV-ILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKNSFK---VWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIESHKIHVAPESSSKIRAFGAGLEGGIVNEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVG---EKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREI-----TPGLFEYTLI--PDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGS-FTVKYTAQRPG-AYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDP-SQITISGLDQPNY-----RLNQPINFVIDTSKTKDLPVKATVPSDFAQLQP--VVSRSPSNPRHHNVRFVPSGKPNVSIPIE---IIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSF-PTDMAGEYCVVFYINGQEVAARVPVMAE--KIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYE------AIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVR-DLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAP------ATGEVRKLELAQFHGQGIPAGKAFTFT---VLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVT--LDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGY--NETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAIE 2207          

HSP 2 Score: 80.1073 bits (196), Expect = 2.254e-14
Identity = 166/776 (21.39%), Postives = 304/776 (39.18%), Query Frame = 3
Query: 4536 AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSP--FIANIIGE-------PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIEC--RDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI--TGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQF-----TVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIA--IEGPSKAEIDFEDRKDGS--CGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNE-KQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQ--YAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPG---MVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSK----VQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            AEI+  DN +G+  V Y P + G + + I      + G+P  F  +  G+       P  ++ + +G  +   +         L+ S+  P+  +    +    +     ++ P   G + ++V   G  +  SPF+++V    +G+  K       L  G ++E+ +  +  +E    G+S SI+ P   E  C  R    G   VS+TP E G ++I +K   + V  +PF +K+  T    A  +E +    +A  IT   +  EL +      +  +  +V         C+  ++  G   + + P E G++ + ++  + H+  SP        + G ++      V   G  L         E  ++ +      + I   +  P     D E R  G     +K+     G +  S+ + D H+  SPF+  V    +     V + G   +  E   G   AF + + +       G +  TI GPS+    A ++  + N     + +     GE+++ V  +  ++HIP SPF+V I     +     +    G G+ +G   K   F V T +   G L   +  P+     + +   E+ E Y   ++P   G + I V       + G+P                  ++S  ++   GK +    PT  S +      G G+ K T  Q   F ++ + AG  IL V + GP     +      G   + + Y     G ++  VK+   + PGSPF + V
Sbjct: 1382 AEII--DNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKGSQAKELSVSIEGPA--KSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLV----MGEGQK----RSHLSVGSTSEV-ALPITQQE--LKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVE-VSGSGKAKGITLQAN--ELLVDTSKAGYGGLSVSVQGPSKAELTCK--EVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLP------DQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGE--TGTFNAFNIYHREAGV----GAVAVTIEGPSK----ATLEFKDHNDGNCHVDYKVATPGEYVVAV--KFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAG---KAFTFTVLT-HRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVT------LDGAPM-----------------RESPFRLRVGGKDLCD--PTAISAS------GDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG---YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPV 2080          
BLAST of Filamin vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 1165.21 bits (3013), Expect = 0.000e+0
Identity = 766/2261 (33.88%), Postives = 1188/2261 (52.54%), Query Frame = 3
Query:  126 DDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKH--VKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKV-TIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIR----VGDKAEFFIDTQNAGNGKLNVKLLSP-EKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIM-------PSNEK-TDVSKIKVYGPGVQKEGVALNSPNEFT-IDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSAT-RYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQT-TIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVD----VNGSPFKLPI---RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPF---LFNILPKSEPDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXX----XXXXXXXXXXEGKGVFCCQYTPTD-AGKHCITVAFNDSPVK-NCPFIVEVIQVGDANKCFIEDGV--KEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQ--NVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPA--AFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQ-YAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVI-GQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKS---MVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVD 6764
            DDA+WKIIQ+NTFTRWV  HL+KA ++I  L+ DFSDG++L+ L +VLS       NK+  FR+QKLENV++ L F + +E +K+INIDS+ IVD   KLILGLVW LILHYSISM   + +       ++TPKQ++++WI  R+P     + N T+DWNDG A+GALV+S APG   DW  W P DAL +T++AM +A+  L V  LI P EMI P +DE ++MTYLSQFP  K     PI  K    KV+     ++ K L      EF +     G     ++I D  G+ I + ++++ DK+N YK  +TP   G   I V  A  D+    F+  TI + S     V +           V     F +   DA  G +  +V+ P+G + ++   +   SP  +  EY     G+HS+N+F     +  SPF +   P+++ K   V GRGI   GIR    VG   E     +N  N  +++++L P + S   V +   + +         K    +L++            KI+V P  +S I AFG GL  G+V +  +F  + NGE   L F++EGPS+A+I C +  DGSA + Y PT  G Y V +L DG+ I +SP++  +        PS  + T + + KVY  G   E +          +D +     + PE +  +    EI     + G  +Y  +  P     HK+ VS    SVP +PF VKV +P++ + +++ G G+        P  F+ID T AG G + V + D+ G  +   + ++ D   F V Y     G  Y  ++ + G  I  SP  I +KP +D+S + VE L+   +   S +R  +N   ++ K KG    +  + +  +    +K N DG+YS      + G + L + ++++P+K +   +EV+ G D +K   +G GLE     +   F +DLDGAG+G L + + GP+ A+    D  +G C+VEY +  PG Y++ IKF   +    V GSPFK  +   +DP +   +    +P       R++QPI F +D S+  + P+KA    +     P  + SR  + P  +++ FVP+     +I I+   I+  G      L  +LP+ EP  +K++ +    + T   +T +   + H+       G+++   S          L      E  G++   + PTD AG++C+    N   V    P + E  ++G       E+ V   E    +   +   +  +A + K    I  L    +      +   ++N       I ++  +L    +D+ +GG  + + +++           E   I+  +++    + +  D     Y    R    LG Q  ++EAIV  P+  +E A + DN +G++ ++Y P+  G HE+++  +G Q+QG+P KF+ +  G G    YGPGL +   G PA FT+  K + A  LS++IEGP+K++I   DN++G+C   + P +PG+Y + +K     +  SPF   ++GE Q+RS + +GSTS+V L I   ++  ++AS+++P G EE C ++ +    LG+SFTPRE G H I V + G  +  +PFKI V + ++GDASKV V G G   GI+ + N   VDT +AGYGGLS+S++GPSKAE+ C++   G  +V YTP+EPG Y I IK+A+ HV  SP  V+ TG+ + ++++ I    E   I     +  L LK+  T   D+ A + +  G T+  E+ DL   +Y +KF PK  G+HT+ V +++ H+ GSPFQFTVG   +GGAHKV A+G G+  G T   N F+IY REAG G +++ IEGPSKA ++F+D  DG+C V Y V  PGEY+ ++KFND HI +SPF++ +        +   V    LA+    G PA  AFT       T R+ G L A +V P+   +   I  IE  + YA+RF+PKE+G H I+VT  +    +  SPFR+ + G+   DP  + A GDGL+ G  G+K  F++NT N+G G L V +DGPSK  L + E E+GY+  Y P APG Y  +VKY G  H  GSPF   + G     +    ++ S++K+D V K+    V  +P     A KV   G G+ K    +   F +D   AG ++L VG+   K  CEEV V+H G   ++ +Y + ++ + ++ +K+G+K IPGSPF ++
Sbjct:   20 DDAEWKIIQQNTFTRWVKNHLQKAGETIESLETDFSDGLKLIALAQVLSHKNVGKFNKKVAFRSQKLENVSLALNFFQNEENIKIINIDSTHIVDHNKKLILGLVWTLILHYSISMGWIQEKREDGDNKEETPKQKLLNWIRNRLPVSGMPISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPEIDEMSVMTYLSQFPATK-----PIIMK---PKVQATISNLD-KILQVNDPREFDLKLSRDGF-KPKVSIRDEDGQDIHLSLKKVEDKENAYKVKFTPTKIGF--IHVDVAANDV--HTFETQTIPEASVICQVVPIARLLDYNKTAKVGDDVKFAVV--DAIEGPVEAIVVDPTGKEHRMV-ILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKNSFK---VWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIESHKIHVAPESSSKIRAFGAGLEGGIVNEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVG---EKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREI-----TPGLFEYTLI--PDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGS-FTVKYTAQRPG-AYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDP-SQITISGLDQPNY-----RLNQPINFVIDTSKTKDLPVKATVPSDFAQLQP--VVSRSPSNPRHHNVRFVPSGKPNVSIPIE---IIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSF-PTDMAGEYCVVFYINGQEVAARVPVMAE--KIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYE------AIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFNVR---DLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAP------ATGEVRKLELAQFHGQGIPAGKAFTFT---VLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVT--LDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGY--NETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAIE 2205          

HSP 2 Score: 80.4925 bits (197), Expect = 2.037e-14
Identity = 166/776 (21.39%), Postives = 304/776 (39.18%), Query Frame = 3
Query: 4536 AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSP--FIANIIGE-------PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIEC--RDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI--TGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQF-----TVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIA--IEGPSKAEIDFEDRKDGS--CGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNE-KQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQ--YAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPG---MVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSK----VQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            AEI+  DN +G+  V Y P + G + + I      + G+P  F  +  G+       P  ++ + +G  +   +         L+ S+  P+  +    +    +     ++ P   G + ++V   G  +  SPF+++V    +G+  K       L  G ++E+ +  +  +E    G+S SI+ P   E  C  R    G   VS+TP E G ++I +K   + V  +PF +K+  T    A  +E +    +A  IT   +  EL +      +  +  +V         C+  ++  G   + + P E G++ + ++  + H+  SP        + G ++      V   G  L         E  ++ +      + I   +  P     D E R  G     +K+     G +  S+ + D H+  SPF+  V    +     V + G   +  E   G   AF + + +       G +  TI GPS+    A ++  + N     + +     GE+++ V  +  ++HIP SPF+V I     +     +    G G+ +G   K   F V T +   G L   +  P+     + +   E+ E Y   ++P   G + I V       + G+P                  ++S  ++   GK +    PT  S +      G G+ K T  Q   F ++ + AG  IL V + GP     +      G   + + Y     G ++  VK+   + PGSPF + V
Sbjct: 1380 AEII--DNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKGSQAKELSVSIEGPA--KSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLV----MGEGQK----RSHLSVGSTSEV-ALPITQQE--LKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVE-VSGSGKAKGITLQAN--ELLVDTSKAGYGGLSVSVQGPSKAELTCK--EVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLP------DQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGE--TGTFNAFNIYHREAGV----GAVAVTIEGPSK----ATLEFKDHNDGNCHVDYKVATPGEYVVAV--KFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAG---KAFTFTVLT-HRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVT------LDGAPM-----------------RESPFRLRVGGKDLCD--PTAISAS------GDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG---YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPV 2078          
BLAST of Filamin vs. Ensembl Celegans
Match: fln-1 (FiLamiN (Actin binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PM09])

HSP 1 Score: 1024.62 bits (2648), Expect = 0.000e+0
Identity = 696/2130 (32.68%), Postives = 1099/2130 (51.60%), Query Frame = 3
Query:  513 KQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKV-TIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIR----VGDKAEFFIDTQNAGNGKLNVKLLSP-EKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIM-------PSNEK-TDVSKIKVYGPGVQKEGVALNSPNEFT-IDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSAT-RYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQT-TIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVD----VNGSPFKLPI---RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPF---LFNILPKSEPDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXX----XXXXXXXXXXXEGKGVFCCQYTPTD-AGKHCITVAFNDSPVK-NCPFIVEVIQVGDANKCFIEDGV--KEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQ--NVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPA--AFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQ-YAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVI-GQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKS---MVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVD 6764
            ++TPKQ++++WI  R+P   + N T+DWNDG A+GALV+S APG   DW  W P DAL +T++AM +A+  L V  LI P EMI P +DE ++MTYLSQFP  K     PI  K    KV+     ++ K L      EF +     G     ++I D  G+ I + ++++ DK+N YK  +TP   G   I V  A  D+    F+  TI + S     V +           V     F +   DA  G +  +V+ P+G + ++   +   SP  +  EY     G+HS+N+F     +  SPF +   P+++ K   V GRGI   GIR    VG   E     +N  N  +++++L P + S   V +   + +         K    +L++            KI+V P  +S I AFG GL  G+V +  +F  + NGE   L F++EGPS+A+I C +  DGSA + Y PT  G Y V +L DG+ I +SP++  +        PS  + T + + KVY  G   E +          +D +     + PE +  +    EI     + G  +Y  +  P     HK+ VS    SVP +PF VKV +P++ + +++ G G+        P  F+ID T AG G + V + D+ G  +   + ++ D   F V Y     G  Y  ++ + G  I  SP  I +KP +D+S + VE L+   +   S +R  +N   ++ K KG    +  + +  +    +K N DG+YS      + G + L + ++++P+K +   +EV+ G D +K   +G GLE     +   F +DLDGAG+G L + + GP+ A+    D  +G C+VEY +  PG Y++ IKF   +    V GSPFK  +   +DP +   +    +P       R++QPI F +D S+  + P+KA    +     P  + SR  + P  +++ FVP+     +I I+   I+  G      L  +LP+ EP  +K++ +    + T   +T +   + H+       G+++   S          L      E  G++   + PTD AG++C+    N   V    P + E  ++G       E+ V   E    +   +   +  +A + K    I  L    +      +   ++N       I ++  +L    +D+ +GG  + + +++           E   I+  +++    + +  D     Y  +F +   LG Q  ++EAIV  P+  +E A + DN +G++ ++Y P+  G HE+++  +G Q+QG+P KF+ +  G G    YGPGL +   G PA FT+  K + A  LS++IEGP+K++I   DN++G+C   + P +PG+Y + +K     +  SPF   ++GE Q+RS + +GSTS+V L I   ++  ++AS+++P G EE C ++ +    LG+SFTPRE G H I V + G  +  +PFKI V + ++GDASKV V G G   GI+ + N   VDT +AGYGGLS+S++GPSKAE+ C++   G  +V YTP+EPG Y I IK+A+ HV  SP  V+ TG+ + ++++ I    E   I     +  L LK+  T   D+ A + +  G T+  E+ DL   +Y +KF PK  G+HT+ V +++ H+ GSPFQFTVG   +GGAHKV A+G G+  G T   N F+IY REAG G +++ IEGPSKA ++F+D  DG+C V Y V  PGEY+ ++KFND HI +SPF++ +        +   V    LA+    G PA  AFT       T R+ G L A +V P+   +   I  IE  + YA+RF+PKE+G H I+VT  +    +  SPFR+ + G+   DP  + A GDGL+ G  G+K  F++NT N+G G L V +DGPSK  L + E E+GY+  Y P APG Y  +VKY G  H  GSPF   + G     +    ++ S++K+D V K+    V  +P     A KV   G G+ K    +   F +D   AG ++L VG+   K  CEEV V+H G   ++ +Y + ++ + ++ +K+G+K IPGSPF ++
Sbjct:   15 EETPKQKLLNWIRNRLPGMPISNFTSDWNDGVALGALVNSMAPGALEDWENWSPNDALENTEKAMKSAQDLLKVAPLIAPAEMIHPEIDEMSVMTYLSQFPATK-----PIIMK---PKVQATISNLD-KILQVNDPREFDLKLSRDGF-KPKVSIRDEDGQDIHLSLKKVEDKENAYKVKFTPTKIGF--IHVDVAANDV--HTFETQTIPEASVICQVVPIARLLDYNKTAKVGDDVKFAVV--DAIEGPVEAIVVDPTGKEHRMV-ILDGTSPGEHSFEYKIPCIGLHSVNVFHKKLPLTGSPFPLRGKPKNSFK---VWGRGIAPEGIRKNDVVGVHVESLDPEENIANANISLEVLKPSDGSHLPVSVGYNDESQSMDFEYSPKQAPDDLEVLVKVAGEVIESHKIHVAPESSSKIRAFGAGLEGGIVNEPCVFDVEMNGESKDLSFAVEGPSKAEIGCQERPDGSAILSYTPTVAGVYKVGVLADGKHIQDSPFVLRVTEPIEGLKPSATRVTGIDESKVYNVG---EKIPFRVDTRLCGVDLVPKVEILDPELNPISYGAREI-----TPGLFEYTLI--PDAPIKHKIDVSVAGVSVPGAPFSVKVKEPTDASKLKIFGPGVDGPVYSKEPTRFTIDATQAGPGAVEVALRDDQGENVDLDVLDNQDGS-FTVKYTAQRPG-AYQLNVVFAGEEI--SPIEINVKPNVDVSGIRVEGLENENLLIGSHLRPTINIGKLEPKSKGL--QLIDEVNGKRYNVPMKINPDGTYSTDTPLMEVGEHKLQLLFDEIPVKEA--VVEVIKGTDVNKCKAYGPGLEQAVVGEKAVFELDLDGAGEGALSMEMRGPAKAESRIQDRGNGKCSVEYVAKAPGDYEMAIKFGKDEQKEHVKGSPFKAVVDYKKDP-SQITISGLDQPNY-----RLNQPINFVIDTSKTKDLPVKATVPSDFAQLQP--VVSRSPSNPRHHNVRFVPSGKPNVSIPIE---IIYDGLKIDEKLVKVLPEVEPQLIKILHDKKKDSLTTTPITTNASHEGHVPFDVRDCGNVKKIESRVFGPDGKERLNHVRSTEQNGIYDVSF-PTDMAGEYCVVFYINGQEVAARVPVMAE--KIGRKEDVIKEEIVFHPEIAEHSPTVLTYNHPIDAKKKKAHPAIQVLAAKPDAVRLEHIQELVDNGHRVADRIVFTATKLGTNTLDVFYGGEHVDHVEYE------AIGKLEYERIQAERAKVVVEKEDDVDKYEKQYKFQFNVR-DLGYQPKDLEAIVMPPTQKKEVAEIIDNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAVVGEPATFTVCAKGSQAKELSVSIEGPAKSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLVMGEGQKRSHLSVGSTSEVALPITQQELKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVEVSGSGKAKGITLQANELLVDTSKAGYGGLSVSVQGPSKAELTCKEVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLPDQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGETGTFNAFNIYHREAGVGAVAVTIEGPSKATLEFKDHNDGNCHVDYKVATPGEYVVAVKFNDQHIPDSPFKVYIAP------ATGEVRKLELAQFHGQGIPAGKAFTFT---VLTHRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVT--LDGAPMRESPFRLRVGGKDLCDPTAISASGDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKGYKVRYTPLAPGSYFASVKYNG-IHAPGSPFKIPVEGKELGGNGY--NETSHVKIDAVAKTSKGTVAVVPEYQGDAAKVTAKGAGLNKFFPGRPAAFQIDTGLAGTNLLMVGVVTTKGPCEEVVVRHQGSGHYVCSYRIPDRVKGFVFIKYGDKEIPGSPFAIE 2071          

HSP 2 Score: 80.4925 bits (197), Expect = 1.898e-14
Identity = 166/776 (21.39%), Postives = 304/776 (39.18%), Query Frame = 3
Query: 4536 AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSP--FIANIIGE-------PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIEC--RDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI--TGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQF-----TVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIA--IEGPSKAEIDFEDRKDGS--CGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNE-KQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQ--YAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPG---MVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSK----VQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            AEI+  DN +G+  V Y P + G + + I      + G+P  F  +  G+       P  ++ + +G  +   +         L+ S+  P+  +    +    +     ++ P   G + ++V   G  +  SPF+++V    +G+  K       L  G ++E+ +  +  +E    G+S SI+ P   E  C  R    G   VS+TP E G ++I +K   + V  +PF +K+  T    A  +E +    +A  IT   +  EL +      +  +  +V         C+  ++  G   + + P E G++ + ++  + H+  SP        + G ++      V   G  L         E  ++ +      + I   +  P     D E R  G     +K+     G +  S+ + D H+  SPF+  V    +     V + G   +  E   G   AF + + +       G +  TI GPS+    A ++  + N     + +     GE+++ V  +  ++HIP SPF+V I     +     +    G G+ +G   K   F V T +   G L   +  P+     + +   E+ E Y   ++P   G + I V       + G+P                  ++S  ++   GK +    PT  S +      G G+ K T  Q   F ++ + AG  IL V + GP     +      G   + + Y     G ++  VK+   + PGSPF + V
Sbjct: 1246 AEII--DNLDGTILVKYTPKVHGSHELSILQNGAQLQGTPIKFYVDAYGDGWATVYGPGLQNAV-VGEPATFTVCAKGSQAKELSVSIEGPA--KSQIKIHDNKDGTCSAAWVPPVPGEYKVHVKLGGKAVKDSPFRVLV----MGEGQK----RSHLSVGSTSEV-ALPITQQE--LKGISASIKSPGGIEEPCFVRLLDGGRLGVSFTPREAGEHLITVKRDGKLVPKAPFKIKVDKTQVGDASKVE-VSGSGKAKGITLQAN--ELLVDTSKAGYGGLSVSVQGPSKAELTCK--EVKSGLIKVLYTPTEPGVYAIAIKFADHHVKDSPLTVQCTGKSAGRVIQTIQKDVEQHGICLP------DQESHLFLKLLNTSPMDITARLMDPKGHTDDIEMRDLGQQYYQLKFTPKMEGIHTLSVMYKDAHVNGSPFQFTVGSFSEGGAHKVRAAGQGVVRGE--TGTFNAFNIYHREAGV----GAVAVTIEGPSK----ATLEFKDHNDGNCHVDYKVATPGEYVVAV--KFNDQHIPDSPFKVYIAPATGEVRKLELAQFHGQGIPAG---KAFTFTVLT-HRAKGHLEAKVVTPNNEVDTIDIVPIEDGESYAMRFVPKETGNHFIHVT------LDGAPM-----------------RESPFRLRVGGKDLCD--PTAISAS------GDGLVKGTTGQKCEFVINTANAGAGILTVQMDGPSKATLDAYELEKG---YKVRYTPLAPGSYFASVKYNGIHAPGSPFKIPV 1944          
BLAST of Filamin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0089471)

HSP 1 Score: 1818.51 bits (4709), Expect = 0.000e+0
Identity = 968/2246 (43.10%), Postives = 1406/2246 (62.60%), Query Frame = 3
Query:  111 ERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSK-VHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSK--IKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKP-EASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPA-YFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDA---KGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGP-HAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTP-SVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFR------LPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDV--PLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSD---GKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTV------GKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            ER+LA+DAQWK IQ+NTFTRW N HLK  ++SIN+L+ D SDG+RL+ LIEVLS+ +    NKR  FR+QKLENV++ L+FL++ EG+K++NIDSSDIVDC+LKLILGL+W LILHYSISMP+W+GED K ++ S  TPKQR+++WI  ++P+  + N T DW  G A+GALVD+CAPGLCPDW  W P DA+ +  EAM  A+ WLNV QLIKPEE+++PNVDE++MMTYLSQ+PN+K+  GAP+  K NPN+VR YGPGIE    + G  A FTV+ FSAG+G++D+ I    G++    +    DK   Y  +Y P  +G++ + V+++ +DIP+SPF V ++  +GD SKVKV GPGI+ NGV +   T+F I  +DAG G    +++ P+  K  +  K+ Q    ++R EY     G+HS+N+F +   I NSPF V V+P S+A+ V  SGRG+Q+ G+RVGD A+F I T+ AG G+  V+++ P    ++V  ++++ N +EC Y P+K G Y + + +    V +SPF++ V P K S I A+GPGL++GV+G  A FV +TNGE G+LGF++ GPS+A+IEC DN DGSA + Y PTA GEYAVHILCD EDIP SP++A I+P   +TD     +K  GPG++K GV +N P  FT+D    K+   P +       G ++PV + +  +   +  Y P +   H V V+    S P SP +V V  P +   V+  G  L    R   A +F++D   AG   L V+I  E   I       D + + + V   P + G  Y  ++ Y G  +P     + ++  +D+SK+ V+ L+ ++   +   F+V+   + +    GK +  AIF          +V+   D  +   Y+P++AG + +++ Y+++P+  SPF + V  GCDP++   +G GLE G TNQ N FT++  GAG G L LAIEGPS+AK+ CTDN DG+C V+Y +T PG YDI I+F D  + GSPF++ + + ++ + VK +G  +  G + R   P  F VD   AG   +     +++G   P++    E+    IY + +VP + G     ++K + + VP +PF+  + PKSEP KVKV G          TP S+P +F ID  +AGQ DI +++ NP    +   + +   G +   + P + G +  ++ + D  ++  PF +E    G+A KC + +   +     +++ + ++  EAG+G ++C+I     +  V  ++     IE   +G   I Y+ N+  +Y +++KFGG  IPNG F  K ++          IE+  ++    +   ++  NG   + +R      LP+     NV A V  PSG  +  ++ DN +G+V+++Y+PRE G HE+ V  +G  +QGSP+KF  ++   G V AYGPGL+HG TG PA FTI TK A AGGL++A+EGPSKA+I   DN++G+  V Y P  PG+Y + ++F D +I GSP+ A I GE ++R+QI +GS S+V  P  I + D+  L AS++APSG EE C LK+MP  N+GISFTPRE+G H ++V + G HI  SPFK+ V + E+GDA KV+V G GLK G ++  N F+VDTR AG+GGLS+SIEGPSKAEI+C D  DGT  +SY P+EPG Y++N+K+A+ HV GSPF VK+ GE S +  EKI  +++A  IT++GSQC+LT K+PG    D+ A VT+    TE  EI +++DG Y++ F+PKE+G+HTV V++  MHIPGSPFQFTVGP+ D G+H V A G+GL+ G      EF+++TREAG G L+I++EGPSKA+I+F+DRKDGSC V Y VTEPGEY   +KFND HI +SPF++ V+    D   +         +++  G   A   + P    +R +   G+L A IV PS T++   IQ I+   Y++RF P+E+G H I+V  +    HIP SPFR+ +G+  ADP  VHA G+GL     G K  FI+NT N+G G L V+IDGPSKV +   E EEGY+  Y P  PGE+ ITVKY  N HI GSPF  N +G  +  ++    + S + V+TV      GK+    +PT  S A KV   G+G+KKA + + N F++ A+ AGN+IL+VG+ GPK  CEE  VKH G N + + YLV+++G++ L++KWGE++IPGSPF +DV
Sbjct:    4 ERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGHTPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILP---RTDFHPELVKASGPGLEKNGVTINQPTSFTVD--PSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKG-AYTTTMTYGGQRVPLGEKVV-VEQTVDVSKIKVDGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSC-AIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQV-RESVPTFFNVDVGEAGPGRIAVKLTNSEG--IPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDV-----IEK--DGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQ-QTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLE-------VQQFPQGNIQA---DAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHV--KFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATG--DKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2210          
BLAST of Filamin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0303364)

HSP 1 Score: 1816.2 bits (4703), Expect = 0.000e+0
Identity = 968/2247 (43.08%), Postives = 1406/2247 (62.57%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSK-VHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSK--IKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKP-EASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPA-YFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDA---KGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGP-HAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTP-SVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFR------LPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDV--PLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSD---GKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTV------GKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
             ER+LA+DAQWK IQ+NTFTRW N HLK  ++SIN+L+ D SDG+RL+ LIEVLS+ +    NKR  FR+QKLENV++ L+FL++ EG+K++NIDSSDIVDC+LKLILGL+W LILHYSISMP+W+GED K ++ S  TPKQR+++WI  ++P+  + N T DW  G A+GALVD+CAPGLCPDW  W P DA+ +  EAM  A+ WLNV QLIKPEE+++PNVDE++MMTYLSQ+PN+K+  GAP+  K NPN+VR YGPGIE    + G  A FTV+ FSAG+G++D+ I    G++    +    DK   Y  +Y P  +G++ + V+++ +DIP+SPF V ++  +GD SKVKV GPGI+ NGV +   T+F I  +DAG G    +++ P+  K  +  K+ Q    ++R EY     G+HS+N+F +   I NSPF V V+P S+A+ V  SGRG+Q+ G+RVGD A+F I T+ AG G+  V+++ P    ++V  ++++ N +EC Y P+K G Y + + +    V +SPF++ V P K S I A+GPGL++GV+G  A FV +TNGE G+LGF++ GPS+A+IEC DN DGSA + Y PTA GEYAVHILCD EDIP SP++A I+P   +TD     +K  GPG++K GV +N P  FT+D    K+   P +       G ++PV + +  +   +  Y P +   H V V+    S P SP +V V  P +   V+  G  L    R   A +F++D   AG   L V+I  E   I       D + + + V   P + G  Y  ++ Y G  +P     + ++  +D+SK+ V+ L+ ++   +   F+V+   + +    GK +  AIF          +V+   D  +   Y+P++AG + +++ Y+++P+  SPF + V  GCDP++   +G GLE G TNQ N FT++  GAG G L LAIEGPS+AK+ CTDN DG+C V+Y +T PG YDI I+F D  + GSPF++ + + ++ + VK +G  +  G + R   P  F VD   AG   +     +++G   P++    E+    IY + +VP + G     ++K + + VP +PF+  + PKSEP KVKV G          TP S+P +F ID  +AGQ DI +++ NP    +   + +   G +   + P + G +  ++ + D  ++  PF +E    G+A KC + +   +     +++ + ++  EAG+G ++C+I     +  V  ++     IE   +G   I Y+ N+  +Y +++KFGG  IPNG F  K ++          IE+  ++    +   ++  NG   + +R      LP+     NV A V  PSG  +  ++ DN +G+V+++Y+PRE G HE+ V  +G  +QGSP+KF  ++   G V AYGPGL+HG TG PA FTI TK A AGGL++A+EGPSKA+I   DN++G+  V Y P  PG+Y + ++F D +I GSP+ A I GE ++R+QI +GS S+V  P  I + D+  L AS++APSG EE C LK+MP  N+GISFTPRE+G H ++V + G HI  SPFK+ V + E+GDA KV+V G GLK G ++  N F+VDTR AG+GGLS+SIEGPSKAEI+C D  DGT  +SY P+EPG Y++N+K+A+ HV GSPF VK+ GE S +  EKI  +++A  IT++GSQC+LT K+PG    D+ A VT+    TE  EI +++DG Y++ F+PKE+G+HTV V++  MHIPGSPFQFTVGP+ D G+H V A G+GL+ G      EF+++TREAG G L+I++EGPSKA+I+F+DRKDGSC V Y VTEPGEY   +KFND HI +SPF++ V+    D   +         +++  G   A   + P    +R +   G+L A IV PS T++   IQ I+   Y++RF P+E+G H I+V  +    HIP SPFR+ +G+  ADP  VHA G+GL     G K  FI+NT N+G G L V+IDGPSKV +   E EEGY+  Y P  PGE+ ITVKY  N HI GSPF  N +G  +  ++    + S + V+TV      GK+    +PT  S A KV   G+G+KKA + + N F++ A+ AGN+IL+VG+ GPK  CEE  VKH G N + + YLV+++G++ L++KWGE++IPGSPF +DV
Sbjct:   33 AERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGHTPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILP---RTDFHPELVKASGPGLEKNGVTINQPTSFTVD--PSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKG-AYTTTMTYGGQRVPLGEKVV-VEQTVDVSKIKVDGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSC-AIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQV-RESVPTFFNVDVGEAGPGRIAVKLTNSEG--IPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDV-----IEK--DGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQ-QTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLE-------VQQFPQGNIQA---DAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHV--KFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATG--DKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2240          
BLAST of Filamin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0290014)

HSP 1 Score: 1285.01 bits (3324), Expect = 0.000e+0
Identity = 803/2275 (35.30%), Postives = 1207/2275 (53.05%), Query Frame = 3
Query:  111 ERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSK-VHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSK--IKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKP-EASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPA-YFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPI-NTANVKCFGEPLTPGSINRVDQPITFTVDASRAG----EAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFC-CQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXX--XXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVE---IENNGNGTQSIYYSPNELSEYLV-DIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQ-NVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG---KVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKD--NENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQI------------------CIGSTSDVPLK---INNLDIST----LTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSD----MRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ-QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQ--QSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            ER+LA+DAQWK IQ+NTFTRW N HLK  ++SIN+L+ D SDG+RL+ LIEVLS+ +    NKR  FR+QKLENV++ L+FL++ EG+K++NIDSSDIVDC+LKLILGL+W LILHYSISMP+W+GED K ++ S  TPKQR+++WI  ++P+  + N T DW  G A+GALVD+CAPGLCPDW  W P DA+ +  EAM  A+ WLNV QLIKPEE+++PNVDE++MMTYLSQ+PN+K+  GAP+  K NPN+VR YGPGIE    + G  A FTV+ FSAG+G++D+ I    G++    +    DK   Y  +Y P  +G++ + V+++ +DIP+SPF V ++  +GD SKVKV GPGI+ NGV +   T+F I  +DAG G    +++ P+  K  +  K+ Q    ++R EY     G+HS+N+F +   I NSPF V V+P S+A+ V  SGRG+Q+ G+RVGD A+F I T+ AG G+  V+++ P    ++V  ++++ N +EC Y P+K G Y + + +    V +SPF++ V P K S I A+GPGL++GV+G  A FV +TNGE G+LGF++ GPS+A+IEC DN DGSA + Y PTA GEYAVHILCD EDIP SP++A I+P   +TD     +K  GPG++K GV +N P  FT+D    K+   P +       G ++PV + +  +   +  Y P +   H V V+    S P SP +V V  P +   V+  G  L    R   A +F++D   AG   L V+I  E   I       D + + + V   P + G  Y  ++ Y G  +P     + ++  +D+SK+ V+ L+ T    S  +F +    +    K  +    T PS  +  + +    +G +  +++P   G Y+L + +   PI   PF ++ + G D +KV  FG GLE G   QP  F ID  GAGQG LG+ +EGP +A INC DN DGTC V Y  T  G Y + I FN+  + GSPF+ P+  P+ N  N +  G  + P  +  ++    F VD S+ G       L     D  GH  P +I   +     I+ I + P E G H IE+ + NI VPG+PF+ N+    +P + K  G G+      LT +   +F ++   AG G + L++  P +  +      +G    C   Y  TD G++ IT+ F D  +   PF V V +  D +K  +     E+  +         ++  EAG G+I+ ++     N E      +PV+   +E+ GN   +++Y P +    L   +KF  V +P   F               E  K K +  + + +T        P EF +      Q ++   +  P G      + + + G+  + + P E G ++ ++     +I+GSP+K  A   G     K+    P +    +G  +   +  ++AG G ++  I   + +EIV  D   ++G  D+ Y    PGDY I +KF   +IP   F    +   ++ S                     +   S++  +      L + T    +TA VR PSGK +  +++   +  + + + PRE G+H + V  +G  + GSPFK  V     G    V  +G GL  G++ E  +FT+ T+ A  GGL++++EGPSKA+I   DN DGT  V Y P+ PG Y +++++ ++H+ GSP+  KITGE   +            +   VGS  E+T+  PG    D    + A++    G  E C +  +  G+  I F P+E+G H V V+    HI  SPF+ TV     G A KV  SG GLK G T   N FS+ TR AG GGLS++IEGPSKAEI   D+ DG+  + Y  TEPG YI ++KF D H+  SPF + V  +  +        +        IG     T   P  T+      L A +  PS   E A IQ +E   YA+ F+PKE G H ++V    +  HIPGSPF+  +G  + +   +V A G GL  G VG+   F V T  +G G L ++++GPSK  +  ++ ++G  +  Y  + PGEY++ +K+  + HI  SPF   +S    D+ ++ V Q  Q N++ D   + MV     +  +  K                                  I  P    ++  ++ +    + + +  +E G H + VK+   +IP SPF + V
Sbjct:    4 ERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGHTPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILP---RTDFHPELVKASGPGLEKNGVTINQPTSFTVD--PSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKG-AYTTTMTYGGQRVPLGEKVV-VEQTVDVSKIKVDGLEPTAPLNSLQQFRIITHGLP---KADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQ-PLIVPVPNLKNTRVSGIGIQPHGV-IMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKI--VQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKG---LT-NQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGS---CDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLT----NSE-----GIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPF-------VMTVFPKSEPTKVKVKGVNEKKKTP----ASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQ--TSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG---YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKR------------NQISVGSCSEVTM--PGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSF----DLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSV--RYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF-NDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAK----------------------------------IVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV 2175          

HSP 2 Score: 1204.12 bits (3114), Expect = 0.000e+0
Identity = 739/2018 (36.62%), Postives = 1121/2018 (55.55%), Query Frame = 3
Query:  831 PGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSN--AKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEG-PSEAKIEC----CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPV-VISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTT---IFQESFIRFVVNAKAIDA---KGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGP-HAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTP-SVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFR------LPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDV--PLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDG---KLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTV------GKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P +P   K+ P     KVR  G G+++  +  G  A+F +    AG G  ++ +    G   +V   ++    N Y+C Y P  +G Y I V +A +++ +SPF+V +       S +   GPG+     ++     F++ T +  TG +   V  PS    +   +       S  V+Y     G ++++I   +  I  SPF   + PR++   +LV  SG G++ NG+ +     F +D   AGN  L+V +     ++  V++        +  Y P+    + +++NY  +    SP ++ V +P   + + AFGP L  GV   AA        E G     ++    E KIE      DN+D + ++   P + G Y   +   G+ +P    +   +   +  DVSKIKV G    +    LNS  +F I      K+D+    +  + SGN I   +I +A  + +   + P   G + + +      +   PF+++    S+ N V+  G GL       PA F IDT  AG G L V +    G         D      +V Y P  +G  Y  +I ++  +I GSPF   I P  ++    V  +      +   +   F+V+   + +    GK +  AIF          +V+   D  +   Y+P++AG + +++ Y+++P+  SPF + V  GCDP++   +G GLE G TNQ N FT++  GAG G L LAIEGPS+AK+ CTDN DG+C V+Y +T PG YDI I+F D  + GSPF++ + + ++ + VK +G  +  G + R   P  F VD   AG   +     +++G   P++    E+    IY + +VP + G     ++K + + VP +PF+  + PKSEP KVKV G          TP S+P +F ID  +AGQ DI +++ NP    +   + +   G +   + P + G +  ++ + D  ++  PF +E    G+A KC + +   +     +++ + ++  EAG+G ++C+I     +  V  ++     IE +G     I Y+ N+  +Y +++KFGG  IPNG F  K ++          IE+  ++    +   ++  NG   + +R      LP+     NV A V  PSG  +  ++ DN +G+V+++Y+PRE G HE+ V  +G  +QGSP+KF  ++   G V AYGPGL+HG TG PA FTI TK A AGGL++A+EGPSKA+I   DN++G+  V Y P  PG+Y + ++F D +I GSP+ A I GE ++R+QI +GS S+V  P  I + D+  L AS++APSG EE C LK+MP  N+GISFTPRE+G H ++V + G HI  SPFK+ V + E+GDA KV+V G GLK G ++  N F+VDTR AG+GGLS+SIEGPSKAEI+C D  DGT  +SY P+EPG Y++N+K+A+ HV GSPF VK+ GE S +  EKI  +++A  IT++GSQC+LT K+PG    D+ A VT+    TE  EI +++DG Y++ F+PKE+G+HTV V++  MHIPGSPFQFTVGP+ D G+H V A G+GL+ G      EF+++TREAG G L+I++EGPSKA+I+F+DRKDGSC V Y VTEPGEY   +KFND HI +SPF++ V+    D   +         +++  G   A   + P    +R +G   +L A IV PS T++   IQ I+   Y++RF P+E+G H I+V  +    HIP SPFR+ +G+  ADP  VHA G+GL     G K  FI+NT N+G G L V+IDGPSKV +   E EEGY+  Y P  PGE+ ITVKY  N HI GSPF  N +G  +  ++    + S + V+TV      GK+    +PT  S A KV   G+G+KKA + + N F++ A+ AGN+IL+VG+ GPK  CEE  VKH G N + + YLV+++G++ L++KWGE++IPGSPF +DV
Sbjct:  439 PNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKV--DGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKK--ESSIVAYGPGLSSG--VIGYPAAFVVET-NGETGALGFTVAGPS----QAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVP----LGEKVVVEQTVDVSKIKVDG---LEPTAPLNSLQQFRIITHGLPKADLA--VTITSPSGNRIKAHIIPTA--EGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVE---GPCEAAINCRDNGDGTCNVAYLPTEAGD-YTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSC-AIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQV-RESVPTFFNVDVGEAGPGRIAVKLTNSEG--IPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDV-----IEKDG--FFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQ-QTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLE-------VQQFPQGNIQA---DAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHV--KFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKYN-NMHIVGSPFKVNATG--DKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2399          
BLAST of Filamin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0337100)

HSP 1 Score: 1285.01 bits (3324), Expect = 0.000e+0
Identity = 803/2275 (35.30%), Postives = 1207/2275 (53.05%), Query Frame = 3
Query:  111 ERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSK-VHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSK--IKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKP-EASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPA-YFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPI-NTANVKCFGEPLTPGSINRVDQPITFTVDASRAG----EAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFC-CQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXX--XXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVE---IENNGNGTQSIYYSPNELSEYLV-DIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQ-NVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG---KVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKD--NENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQI------------------CIGSTSDVPLK---INNLDIST----LTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSD----MRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ-QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQ--QSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            ER+LA+DAQWK IQ+NTFTRW N HLK  ++SIN+L+ D SDG+RL+ LIEVLS+ +    NKR  FR+QKLENV++ L+FL++ EG+K++NIDSSDIVDC+LKLILGL+W LILHYSISMP+W+GED K ++ S  TPKQR+++WI  ++P+  + N T DW  G A+GALVD+CAPGLCPDW  W P DA+ +  EAM  A+ WLNV QLIKPEE+++PNVDE++MMTYLSQ+PN+K+  GAP+  K NPN+VR YGPGIE    + G  A FTV+ FSAG+G++D+ I    G++    +    DK   Y  +Y P  +G++ + V+++ +DIP+SPF V ++  +GD SKVKV GPGI+ NGV +   T+F I  +DAG G    +++ P+  K  +  K+ Q    ++R EY     G+HS+N+F +   I NSPF V V+P S+A+ V  SGRG+Q+ G+RVGD A+F I T+ AG G+  V+++ P    ++V  ++++ N +EC Y P+K G Y + + +    V +SPF++ V P K S I A+GPGL++GV+G  A FV +TNGE G+LGF++ GPS+A+IEC DN DGSA + Y PTA GEYAVHILCD EDIP SP++A I+P   +TD     +K  GPG++K GV +N P  FT+D    K+   P +       G ++PV + +  +   +  Y P +   H V V+    S P SP +V V  P +   V+  G  L    R   A +F++D   AG   L V+I  E   I       D + + + V   P + G  Y  ++ Y G  +P     + ++  +D+SK+ V+ L+ T    S  +F +    +    K  +    T PS  +  + +    +G +  +++P   G Y+L + +   PI   PF ++ + G D +KV  FG GLE G   QP  F ID  GAGQG LG+ +EGP +A INC DN DGTC V Y  T  G Y + I FN+  + GSPF+ P+  P+ N  N +  G  + P  +  ++    F VD S+ G       L     D  GH  P +I   +     I+ I + P E G H IE+ + NI VPG+PF+ N+    +P + K  G G+      LT +   +F ++   AG G + L++  P +  +      +G    C   Y  TD G++ IT+ F D  +   PF V V +  D +K  +     E+  +         ++  EAG G+I+ ++     N E      +PV+   +E+ GN   +++Y P +    L   +KF  V +P   F               E  K K +  + + +T        P EF +      Q ++   +  P G      + + + G+  + + P E G ++ ++     +I+GSP+K  A   G     K+    P +    +G  +   +  ++AG G ++  I   + +EIV  D   ++G  D+ Y    PGDY I +KF   +IP   F    +   ++ S                     +   S++  +      L + T    +TA VR PSGK +  +++   +  + + + PRE G+H + V  +G  + GSPFK  V     G    V  +G GL  G++ E  +FT+ T+ A  GGL++++EGPSKA+I   DN DGT  V Y P+ PG Y +++++ ++H+ GSP+  KITGE   +            +   VGS  E+T+  PG    D    + A++    G  E C +  +  G+  I F P+E+G H V V+    HI  SPF+ TV     G A KV  SG GLK G T   N FS+ TR AG GGLS++IEGPSKAEI   D+ DG+  + Y  TEPG YI ++KF D H+  SPF + V  +  +        +        IG     T   P  T+      L A +  PS   E A IQ +E   YA+ F+PKE G H ++V    +  HIPGSPF+  +G  + +   +V A G GL  G VG+   F V T  +G G L ++++GPSK  +  ++ ++G  +  Y  + PGEY++ +K+  + HI  SPF   +S    D+ ++ V Q  Q N++ D   + MV     +  +  K                                  I  P    ++  ++ +    + + +  +E G H + VK+   +IP SPF + V
Sbjct:    4 ERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGHTPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILP---RTDFHPELVKASGPGLEKNGVTINQPTSFTVD--PSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKG-AYTTTMTYGGQRVPLGEKVV-VEQTVDVSKIKVDGLEPTAPLNSLQQFRIITHGLP---KADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQ-PLIVPVPNLKNTRVSGIGIQPHGV-IMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKI--VQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKG---LT-NQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGS---CDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLT----NSE-----GIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPF-------VMTVFPKSEPTKVKVKGVNEKKKTP----ASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQ--TSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG---YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKR------------NQISVGSCSEVTM--PGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSF----DLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSV--RYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF-NDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAK----------------------------------IVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV 2175          

HSP 2 Score: 1204.12 bits (3114), Expect = 0.000e+0
Identity = 739/2018 (36.62%), Postives = 1121/2018 (55.55%), Query Frame = 3
Query:  831 PGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSN--AKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEG-PSEAKIEC----CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPV-VISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTT---IFQESFIRFVVNAKAIDA---KGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGP-HAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTP-SVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFR------LPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDV--PLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDG---KLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTV------GKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P +P   K+ P     KVR  G G+++  +  G  A+F +    AG G  ++ +    G   +V   ++    N Y+C Y P  +G Y I V +A +++ +SPF+V +       S +   GPG+     ++     F++ T +  TG +   V  PS    +   +       S  V+Y     G ++++I   +  I  SPF   + PR++   +LV  SG G++ NG+ +     F +D   AGN  L+V +     ++  V++        +  Y P+    + +++NY  +    SP ++ V +P   + + AFGP L  GV   AA        E G     ++    E KIE      DN+D + ++   P + G Y   +   G+ +P    +   +   +  DVSKIKV G    +    LNS  +F I      K+D+    +  + SGN I   +I +A  + +   + P   G + + +      +   PF+++    S+ N V+  G GL       PA F IDT  AG G L V +    G         D      +V Y P  +G  Y  +I ++  +I GSPF   I P  ++    V  +      +   +   F+V+   + +    GK +  AIF          +V+   D  +   Y+P++AG + +++ Y+++P+  SPF + V  GCDP++   +G GLE G TNQ N FT++  GAG G L LAIEGPS+AK+ CTDN DG+C V+Y +T PG YDI I+F D  + GSPF++ + + ++ + VK +G  +  G + R   P  F VD   AG   +     +++G   P++    E+    IY + +VP + G     ++K + + VP +PF+  + PKSEP KVKV G          TP S+P +F ID  +AGQ DI +++ NP    +   + +   G +   + P + G +  ++ + D  ++  PF +E    G+A KC + +   +     +++ + ++  EAG+G ++C+I     +  V  ++     IE +G     I Y+ N+  +Y +++KFGG  IPNG F  K ++          IE+  ++    +   ++  NG   + +R      LP+     NV A V  PSG  +  ++ DN +G+V+++Y+PRE G HE+ V  +G  +QGSP+KF  ++   G V AYGPGL+HG TG PA FTI TK A AGGL++A+EGPSKA+I   DN++G+  V Y P  PG+Y + ++F D +I GSP+ A I GE ++R+QI +GS S+V  P  I + D+  L AS++APSG EE C LK+MP  N+GISFTPRE+G H ++V + G HI  SPFK+ V + E+GDA KV+V G GLK G ++  N F+VDTR AG+GGLS+SIEGPSKAEI+C D  DGT  +SY P+EPG Y++N+K+A+ HV GSPF VK+ GE S +  EKI  +++A  IT++GSQC+LT K+PG    D+ A VT+    TE  EI +++DG Y++ F+PKE+G+HTV V++  MHIPGSPFQFTVGP+ D G+H V A G+GL+ G      EF+++TREAG G L+I++EGPSKA+I+F+DRKDGSC V Y VTEPGEY   +KFND HI +SPF++ V+    D   +         +++  G   A   + P    +R +G   +L A IV PS T++   IQ I+   Y++RF P+E+G H I+V  +    HIP SPFR+ +G+  ADP  VHA G+GL     G K  FI+NT N+G G L V+IDGPSKV +   E EEGY+  Y P  PGE+ ITVKY  N HI GSPF  N +G  +  ++    + S + V+TV      GK+    +PT  S A KV   G+G+KKA + + N F++ A+ AGN+IL+VG+ GPK  CEE  VKH G N + + YLV+++G++ L++KWGE++IPGSPF +DV
Sbjct:  439 PNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKV--DGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKK--ESSIVAYGPGLSSG--VIGYPAAFVVET-NGETGALGFTVAGPS----QAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVP----LGEKVVVEQTVDVSKIKVDG---LEPTAPLNSLQQFRIITHGLPKADLA--VTITSPSGNRIKAHIIPTA--EGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVE---GPCEAAINCRDNGDGTCNVAYLPTEAGD-YTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSC-AIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQV-RESVPTFFNVDVGEAGPGRIAVKLTNSEG--IPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDV-----IEKDG--FFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQ-QTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLE-------VQQFPQGNIQA---DAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHV--KFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKYN-NMHIVGSPFKVNATG--DKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2399          
BLAST of Filamin vs. Ensembl Fly
Match: cher (gene:FBgn0014141 transcript:FBtr0337101)

HSP 1 Score: 1284.24 bits (3322), Expect = 0.000e+0
Identity = 803/2275 (35.30%), Postives = 1207/2275 (53.05%), Query Frame = 3
Query:  111 ERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSK-VHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSK--IKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKP-EASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPA-YFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPI-NTANVKCFGEPLTPGSINRVDQPITFTVDASRAG----EAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFC-CQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXX--XXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVE---IENNGNGTQSIYYSPNELSEYLV-DIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQ-NVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG---KVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKD--NENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQI------------------CIGSTSDVPLK---INNLDIST----LTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSD----MRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ-QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQ--QSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            ER+LA+DAQWK IQ+NTFTRW N HLK  ++SIN+L+ D SDG+RL+ LIEVLS+ +    NKR  FR+QKLENV++ L+FL++ EG+K++NIDSSDIVDC+LKLILGL+W LILHYSISMP+W+GED K ++ S  TPKQR+++WI  ++P+  + N T DW  G A+GALVD+CAPGLCPDW  W P DA+ +  EAM  A+ WLNV QLIKPEE+++PNVDE++MMTYLSQ+PN+K+  GAP+  K NPN+VR YGPGIE    + G  A FTV+ FSAG+G++D+ I    G++    +    DK   Y  +Y P  +G++ + V+++ +DIP+SPF V ++  +GD SKVKV GPGI+ NGV +   T+F I  +DAG G    +++ P+  K  +  K+ Q    ++R EY     G+HS+N+F +   I NSPF V V+P S+A+ V  SGRG+Q+ G+RVGD A+F I T+ AG G+  V+++ P    ++V  ++++ N +EC Y P+K G Y + + +    V +SPF++ V P K S I A+GPGL++GV+G  A FV +TNGE G+LGF++ GPS+A+IEC DN DGSA + Y PTA GEYAVHILCD EDIP SP++A I+P   +TD     +K  GPG++K GV +N P  FT+D    K+   P +       G ++PV + +  +   +  Y P +   H V V+    S P SP +V V  P +   V+  G  L    R   A +F++D   AG   L V+I  E   I       D + + + V   P + G  Y  ++ Y G  +P     + ++  +D+SK+ V+ L+ T    S  +F +    +    K  +    T PS  +  + +    +G +  +++P   G Y+L + +   PI   PF ++ + G D +KV  FG GLE G   QP  F ID  GAGQG LG+ +EGP +A INC DN DGTC V Y  T  G Y + I FN+  + GSPF+ P+  P+ N  N +  G  + P  +  ++    F VD S+ G       L     D  GH  P +I   +     I+ I + P E G H IE+ + NI VPG+PF+ N+    +P + K  G G+      LT +   +F ++   AG G + L++  P +  +      +G    C   Y  TD G++ IT+ F D  +   PF V V +  D +K  +     E+  +         ++  EAG G+I+ ++     N E      +PV+   +E+ GN   +++Y P +    L   +KF  V +P   F               E  K K +  + + +T        P EF +      Q ++   +  P G      + + + G+  + + P E G ++ ++     +I+GSP+K  A   G     K+    P +    +G  +   +  ++AG G ++  I   + +EIV  D   ++G  D+ Y    PGDY I +KF   +IP   F    +   ++ S                     +   S++  +      L + T    +TA VR PSGK +  +++   +  + + + PRE G+H + V  +G  + GSPFK  V     G    V  +G GL  G++ E  +FT+ T+ A  GGL++++EGPSKA+I   DN DGT  V Y P+ PG Y +++++ ++H+ GSP+  KITGE   +            +   VGS  E+T+  PG    D    + A++    G  E C +  +  G+  I F P+E+G H V V+    HI  SPF+ TV     G A KV  SG GLK G T   N FS+ TR AG GGLS++IEGPSKAEI   D+ DG+  + Y  TEPG YI ++KF D H+  SPF + V  +  +        +        IG     T   P  T+      L A +  PS   E A IQ +E   YA+ F+PKE G H ++V    +  HIPGSPF+  +G  + +   +V A G GL  G VG+   F V T  +G G L ++++GPSK  +  ++ ++G  +  Y  + PGEY++ +K+  + HI  SPF   +S    D+ ++ V Q  Q N++ D   + MV     +  +  K                                  I  P    ++  ++ +    + + +  +E G H + VK+   +IP SPF + V
Sbjct:   34 ERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGHTPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILP---RTDFHPELVKASGPGLEKNGVTINQPTSFTVD--PSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKG-AYTTTMTYGGQRVPLGEKVV-VEQTVDVSKIKVDGLEPTAPLNSLQQFRIITHGLP---KADLAVTITSPSGNRIKAHIIPTAEG-FLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLPTEAGDYTVNITFNERHITGSPFQ-PLIVPVPNLKNTRVSGIGIQPHGV-IMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKI--VQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKG---LT-NQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGS---CDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLT----NSE-----GIPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPF-------VMTVFPKSEPTKVKVKGVNEKKKTP----ASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQ--TSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSG---YVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKR------------NQISVGSCSEVTM--PGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSF----DLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSV--RYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF-NDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAK----------------------------------IVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKV 2205          

HSP 2 Score: 1202.96 bits (3111), Expect = 0.000e+0
Identity = 740/2020 (36.63%), Postives = 1123/2020 (55.59%), Query Frame = 3
Query:  831 PGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSN--AKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEG-PSEAKIEC----CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY---KSDIKPEASCFTCSGNEIPV-VISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTT---IFQESFIRFVVNAKAIDA---KGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGP-HAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTP-SVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFR------LPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDV--PLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDG---KLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTV------GKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P +P   K+ P     KVR  G G+++  +  G  A+F +    AG G  ++ +    G   +V   ++    N Y+C Y P  +G Y I V +A +++ +SPF+V +       S +   GPG+     ++     F++ T +  TG +   V  PS    +   +       S  V+Y     G ++++I   +  I  SPF   + PR++   +LV  SG G++ NG+ +     F +D   AGN  L+V +     ++  V++        +  Y P+    + +++NY  +    SP ++ V +P   + + AFGP L  GV   AA        E G     ++    E KIE      DN+D + ++   P + G Y   +   G+ +P    +   +   +  DVSKIKV G    +    LNS  +F I  I +   K+D+    +  + SGN I   +I +A  + +   + P   G + + +      +   PF+++    S+ N V+  G GL       PA F IDT  AG G L V +    G         D      +V Y P  +G  Y  +I ++  +I GSPF   I P  ++    V  +      +   +   F+V+   + +    GK +  AIF          +V+   D  +   Y+P++AG + +++ Y+++P+  SPF + V  GCDP++   +G GLE G TNQ N FT++  GAG G L LAIEGPS+AK+ CTDN DG+C V+Y +T PG YDI I+F D  + GSPF++ + + ++ + VK +G  +  G + R   P  F VD   AG   +     +++G   P++    E+    IY + +VP + G     ++K + + VP +PF+  + PKSEP KVKV G          TP S+P +F ID  +AGQ DI +++ NP    +   + +   G +   + P + G +  ++ + D  ++  PF +E    G+A KC + +   +     +++ + ++  EAG+G ++C+I     +  V  ++     IE +G     I Y+ N+  +Y +++KFGG  IPNG F  K ++          IE+  ++    +   ++  NG   + +R      LP+     NV A V  PSG  +  ++ DN +G+V+++Y+PRE G HE+ V  +G  +QGSP+KF  ++   G V AYGPGL+HG TG PA FTI TK A AGGL++A+EGPSKA+I   DN++G+  V Y P  PG+Y + ++F D +I GSP+ A I GE ++R+QI +GS S+V  P  I + D+  L AS++APSG EE C LK+MP  N+GISFTPRE+G H ++V + G HI  SPFK+ V + E+GDA KV+V G GLK G ++  N F+VDTR AG+GGLS+SIEGPSKAEI+C D  DGT  +SY P+EPG Y++N+K+A+ HV GSPF VK+ GE S +  EKI  +++A  IT++GSQC+LT K+PG    D+ A VT+    TE  EI +++DG Y++ F+PKE+G+HTV V++  MHIPGSPFQFTVGP+ D G+H V A G+GL+ G      EF+++TREAG G L+I++EGPSKA+I+F+DRKDGSC V Y VTEPGEY   +KFND HI +SPF++ V+    D   +         +++  G   A   + P    +R +G   +L A IV PS T++   IQ I+   Y++RF P+E+G H I+V  +    HIP SPFR+ +G+  ADP  VHA G+GL     G K  FI+NT N+G G L V+IDGPSKV +   E EEGY+  Y P  PGE+ ITVKY  N HI GSPF  N +G  +  ++    + S + V+TV      GK+    +PT  S A KV   G+G+KKA + + N F++ A+ AGN+IL+VG+ GPK  CEE  VKH G N + + YLV+++G++ L++KWGE++IPGSPF +DV
Sbjct:  469 PNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKV--DGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKK--ESSIVAYGPGLSSG--VIGYPAAFVVET-NGETGALGFTVAGPS----QAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVP----LGEKVVVEQTVDVSKIKVDG---LEPTAPLNSLQQFRI--ITHGLPKADLA--VTITSPSGNRIKAHIIPTA--EGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSNKVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVE---GPCEAAINCRDNGDGTCNVAYLPTEAGD-YTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMSKVGSNIDSGKLSC-AIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQV-RESVPTFFNVDVGEAGPGRIAVKLTNSEG--IPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDV-----IEKDG--FFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQ-QTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLE-------VQQFPQGNIQA---DAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHV--KFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKYN-NMHIVGSPFKVNATG--DKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2429          
BLAST of Filamin vs. Ensembl Zebrafish
Match: flna (filamin A, alpha (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-030131-2145])

HSP 1 Score: 1288.09 bits (3332), Expect = 0.000e+0
Identity = 768/2028 (37.87%), Postives = 1164/2028 (57.40%), Query Frame = 3
Query:  843 ITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKC--TYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGD---PSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKL------LSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK-TSHIAAFGPGLT-TGV-VGKAAIFVTDTNGE-LGSLGFSIEGPSEAK----IECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCV-YQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXX---------XXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNET--TDYTNGM--------YPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGS--VNDSSEIYVHQQSNLKVDTVGKSMVTSMPT----QSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            I S+  P +VR +GPG+ES   + G++A+F V+A     G L  ++   +   I+       D K    C   Y P   G Y + V    +DI  SPF   I    G    P KVK  GPG++ +G+ V     F +  +  G   +   + +   D + ++ ++      +Y   YT  +   H++ +      I  SPF + +    +   V VSG G+   G++  D   F +D   AG G +++ +      + P +++    I   + + F   Y P   G Y + + + +  +  +P +I V P+   S + A GPGL+ +GV + K   F  +T       L     GP++       +  DN DG+ T+ Y P   G   +++   G+ IP SP+   I PS    D+SK+KV G G +   + +    E T+         K  A     S   +P  +    + +   V + P   G ++V ++ D   +P SPF ++   P++P+ VR  G GL  A    P  F +D TNAG   L +EI  + G      + ++ D   + + Y P   G  Y  +IRY   ++P  P  + ++P ++ S  KVF   ++   +F+E+   F V+A+A+   G   +K    +PS  ++ ++++  GDG+Y   Y+PY+ GT+ ++V Y+  P+  SPF + V  GCDP++V V G GL+ G TN+PN FT++  GAG G LGLA+EGPS+AK++CTDN DG+C VEY    PGTY++ + +    + GSPF +P+ D ++   VKC G+ L  G+  R + P  F+VDAS+AG APL+   +  +G   P E+    +     + +++VPT  GP++I + +A+  +P +P+   +LP  +  KV+  G G+  TG  +  S+PV+F ID  +AG+G + + +++PD      +I D   G +   Y P   G++ I + +    +   P+ +  +  GDA+KC +   +  + L            +T+IT++   AG+GK++C +    + GEV       V++  N +GT  I+Y+  +  +Y++ ++FGG  IPN  F+   ++ ++  + + + +  +  +A    +T  TD   GM         P +  +P ++    +   V  PSG      + DN +G+VT++Y P E G+HEM++  DGI I GSP +F+ +    G V AYGPGL HG    PA FT+ TKDAG GGLSLAIEGPSKA+I C DN++G+C V+Y P++PGDY+II+K+ D NIPGSPF++ I G+   R S + +GS +D+PL I  LD+S LTA++  PSG+EE C+LK + N ++GISF P+E+G H +N+ ++G HI  SP  +++ Q+EIGDAS+VRV G+GL    + E   F +DTR+AGYGGLSLSIEGPSK +I   D  DGTC+V+Y P+EPG Y+INIK+A++HV GS F VK+TGE   ++ E I  ++ AA +  VGSQC+L+LK+P    +DM A VT+  G     EI++ ++  Y I+F+P EMG+HTV V+++  H+PGSPFQFTVGP+ +GGAHKV A G GL+      P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGS GV Y V EPG+Y  SIKFND+HI +SPF + V     D   ++VAS+ ++ L     + +PA+F V+        + G + A +  PS   E   +  I++++YA+RFIP+E+G +LI+V  +    HIPGSPF++ +G+  Q  DPGMV A G GL  G  G    FIVNT ++G G L VTIDGPSKV++  QE  EGY+  Y P APG Y I++KYGG YHI GSPF A I+GS  VN  S   +H+ S++ VD V +SM TS        SS A +V   GLG+ K  + Q NTF+VD S+AG ++L VG+ GPK  CEE+ VKH+G   + ++Y ++EKG + L+VKWG+++IPGSP+ + V
Sbjct:  574 IGSEAGPQQVRAWGPGLESG--VVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIEC------DDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLK--IQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPS---LDLSKVKVAGLGSK---MTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGD-GTYTITYVPLYPG-AYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGL--GNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQT---HTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTG--VPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVC-TPDGGEVD------VDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTALEGDSPDQLMQQSQNLQYAYAPNMGQTWATDGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGE--GRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGL----KVNQPASFAVSLNG-----AKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDV--KFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHS---MHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2553          

HSP 2 Score: 1027.7 bits (2656), Expect = 0.000e+0
Identity = 742/2330 (31.85%), Postives = 1114/2330 (47.81%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEW---KPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGP-GIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDV-SKIKVYGPGVQKEGVALNSPNEFTIDC-IEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDN---LDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHID---VSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-----EDGVKEYXXXXXXXXXXXXXXXA-------GEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPA----EFTIVTKDAGAGGLSLAIEG----PSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQIC--------------------IGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGP---------SKAEI--------------ECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI----TGEPSA---KLMEKIICQQEAADI-TQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGH--TSGPNEFSIYTREAGAGGLSIAIEGPSKAE--IDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPS----KVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ K F   N+R  FR  +LENV++ L FL+  E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ E+      ++TPKQR++ WI  ++PE  + N + DW  G A+GALVDSCAPGLCPDW  W   KPVD   + +EAM  A+ WL VPQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YGP GIE    +  + A FTV+  SAG+G + + + D AG   + K+    DK   Y   Y P   G + +TV +A + I +SPF+V +    GD SKV  +GPG+E  G I + +TYF + T  AG GE+  V++ PSG KD +   +  +  +SYR  Y   + G H I I  +  QI  SP+ V V    N  L T  GRG+Q  G+RV + AEF + T+ AG G L V +  P+  EE  K  ++    +   Y PS PG Y + I +    + RSPF++ +        + A+GPGL +GVVGK+A FV +  G ++G+LGFS+EGPS AKIEC D  DGS  + YWPT PGEYAVH+LC  EDI  SP+MA IMP+  K     K+K YGPG+Q  G+++  P EFT+D  +  K+ +K +A      GN + V +   GN  Y C Y P     H V VS    ++P+SPF++ +    +PN V+V G G+       Y P YF++D   AG G++++ I    G + P     D      D+D F V Y P  +G  Y   + +    IP +P  I++ P  D SKV  E     ++ +       F VN K   A GK  + A FT P+    G  V+      N DG+++  Y+P   G   L+VTY   PI  SPF + + P  D SKV V G G +                 GQG +G  + GPS   + C         T  V +     G Y++ + ++   + GSPF +    P + + V+C G  L      +V +P  F VD + AG A L      + G E  + I+   +   G Y IT+VP   G + + I++ +  VP  P   ++ P  E   VKV G GV   G F   +    F +D   +++ G   I+  ++NP        I D G G +  +YTP + G H + VA++ SPV   PF V V +  D  +  +     + G+       T       T           E K+SC                      +N +G+  + Y P E   Y +++ +GG  I    F            + ++  K K Q     N        ++ V+       G   ++  V  P G+ E A V DN + + T+ Y P   G + +NV     +I  SPYK          KV   GPGL+   TG+PA    EFTI  KDAG G L++ I      P KA I  +DN++G+  V+Y P + G Y+I+IK+    IP SP+   I   P   +  C                    IG  + + +         +T +V  P G E    + +  +    I +T  + G + I V   G HI  SPF++   + +  D  ++    + L+   +  M        + G  GL ++   P          K EI              +  DN DGT  V Y P+E G + ++IKY   H+ GSP    +    +G  +A    L+  ++ +     + T+   +  L+L + G   +D+  T              D  DG  ++ ++P   G + ++V++ + +IPGSPF               +   + +++ H       +  +   E     L+  +  PS  E     +  ++G  G+ +   E GE++ +IK N  HI +SP  +M+N+ ++   S   V    L++  T  +PA F ++    T     G L  +I GPS+ +     ++ E     + + P E G ++IN+  +  ++H+PGS F V +  +      +  K        VG +    +         +   +  PS    K ++   EN   Y   ++P+  G + ++VKY G  H+ GSPF                         TVG       P     A KV+  G G+++A       F++   +AG   L + + GP     E++ +        ++Y+VQE G + + +K+ +++IP SPF+V V
Sbjct:   32 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIANLQTDLSDGLRLIALLEVLSQKKMFRKYNQRPTFRQMQLENVSVALEFLD-IENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEESEESKQKTPKQRLLGWIQNKLPELPITNFSRDWQSGKALGALVDSCAPGLCPDWDSWDQTKPVD---NAREAMQQADDWLGVPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPAGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQ--DRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAG-SYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTK---AAGKAKLDAQFTGPN---KGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERA---KVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGD---GTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREAT--TDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCT---------------------DNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFS-------VPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDAS---KAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLN--TTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANI--RDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPY--RIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTALEGDSPD--QLMQQSQNLQYAYAPNMGQTWATDGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCT--------------DNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFM------------SKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTF-EPAEFIID----TRDAGYGGLSLSIEGPSKVD--INTEDQEDGTCKVTYCPTEPGNYIINI--KFADQHVPGSAFTVKVTGEGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNT-YCIRFVPTEMGVHTVSVKYQGQ-HVPGSPFQF-----------------------TVG-------PLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKA--EIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPV 2232          

HSP 3 Score: 263.848 bits (673), Expect = 6.587e-70
Identity = 327/1358 (24.08%), Postives = 552/1358 (40.65%), Query Frame = 3
Query: 2895 PGCDPSKVLVFG-EGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPI-RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCF-----IEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTEN--GEVKSNLSLP----VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAI-VSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG----KVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGLSLAIE------GPSKAEIVCK--DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII-----------GEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDN--LGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAG-YGGLSLSIEGPSKAEIECRDN---YDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITG--EPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTR---EAGAGGLSIAIEGPS--KAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGK-KNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEG---YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATL--NQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P  +P K   +G  G+E  G    +   FT++   AGQG + + +E P+    +AK+   ++ + T +V Y   + G + + + F    ++ SPF++ +     +++ V   G  L P   N  ++   F V  + AG   ++    D  G +  +E  S E+     Y  T+ PT+ G H I I  A   +  +P+  N+     P      G G+ P G  L      +F +    AG GD+++++  P  L  P    D G GV+   Y P+  G + IT+ +    +   PF V++       +       +E GV                     GK +  +V    +  G +  ++  P    +E ++ G+G+  + Y P E  EY V +      I   Q      +    P +    +K K+     ++          P EF +   LG +    I      G      V DN NG+ +  Y PR+   H + V+  G+ I  SP++    N G G    KV   GPG++  +TGL    P  FT+   +AG G +S+ I+      GP++A+I      N+N +  V Y P   G Y+I++ FAD  IP +P    +            G    RS + +   +   +       + L A    P+  +       + N +    + +TP + GN  +NV   G  I  SPF + +  +   D SKV+V G G K  +  +    TV ++ AG  G +   + GPS   + C+        T QV + P + G Y + + Y    + GSPF ++     +PS     K+ C     +  +VG   +  +       +++   + +  GT     I D  DG Y+I ++P   G +T+ +++ +  +P  P +  V P V+    KV   G   K        +F++  R   + G   +   I  PS  + E    D  DG+  V+Y   E G +   + ++   +  SPFR+ V E   D   V   G     +     KP  FTV      T      +     GPS  E      + +     + +IP E G + +NVT     + I GSPF V +     DP  V  +G GL +         F V+   +G  PL V + GP  V   ++  + G   +   Y+P+  G Y I V Y  +  I  SP+   +                              +PT    A KV+C G G+    +  +    F +DA  AG  +L V I  P  + ++ +++      ++++Y+    GR+ +++K+G   IP SP+ +  L
Sbjct:  279 PKLNPKKARAYGPAGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAG-NIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVEC-SVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSLCTAKGRGLQPKG--LRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVV--------------------GKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDI---QLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGK---PAEFTVDAKLGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRM---NIGAGCHPNKVKVSGPGVA--KTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSL--DLSKVKVAGLGSKMTVGKD-QEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPS-----KVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEG-CDPARVRVHGPGL--QSGITNKPNKFTVETRGAGTGGLGLAME----GPS--EAKMSCTDNKDGSCCVEYIPYEPGTYNLNVT--YGGQPITGSPFSVPV-HDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYA-DEEIPQSPYKVKV------------------------------LPTHD--ASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRAL 1548          
BLAST of Filamin vs. Ensembl Zebrafish
Match: CR352234.3 (filamin A, alpha (actin binding protein 280) [Source:NCBI gene;Acc:562529])

HSP 1 Score: 1284.24 bits (3322), Expect = 0.000e+0
Identity = 766/2029 (37.75%), Postives = 1155/2029 (56.92%), Query Frame = 3
Query:  843 ITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKC--TYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGD---PSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKL------LSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK-TSHIAAFGPGLT-TGV-VGKAAIFVTDTNGE-LGSLGFSIEGPSEAK----IECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCV-YQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXX---------XXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNG-----------MYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGS--VNDSSEIYVHQQSNLKVDTVGKSMVTSMPT----QSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            I S+  P +VR +GPG+ES   + G++A+F V+A     G L  ++   +   I+       D K    C   Y P   G Y + V    +DI  SPF   I    G    P KVK  GPG++ +G+ V     F +  +  G   +   + +   D + ++ ++      +Y   YT  +   H++ +      I  SPF + +    +   V VSG G+   G++  D   F +D   AG G +++ +      + P +++    I   + + F   Y P   G Y + + + +  +  +P +I V P+   S + A GPGL+ +GV + K   F  +T       L     GP++       +  DN DG+ T+ Y P   G   +++   G+ IP SP+   I PS    D+SK+KV G G +   + +    E T+         K  A     S   +P  +    + +   V + P   G ++V ++ D   +P SPF ++   P++P+ VR  G GL  A    P  F +D TNAG   L +EI  + G      + ++ D   + + Y P   G  Y  +IRY   ++P  P  + ++P ++ S  KVF   ++   +F+E+   F V+A+A+   G   +K    +PS  ++ ++++  GDG+Y   Y+PY+ GT+ ++V Y+  P+  SPF + V  GCDP++V V G GL+ G TN+PN FT++  GAG G LGLA+EGPS+AK++CTDN DG+C VEY    PGTY++ + +    + GSPF +P+ D ++   VKC G+ L  G+  R + P  F+VDAS+AG APL+   +  +G   P E+    +     + +++VPT  GP++I + +A+  +P +P+   +LP  +  KV+  G G+  TG  +  S+PV+F ID  +AG+G + + +++PD      +I D   G +   Y P   G++ I + +    +   P+ +  +  GDA+KC +   +  + L            +T+IT++   AG+GK++C +    + GEV       V++  N +GT  I+Y+  +  +Y++ ++FGG  IPN  F+      +     +          +   N     TNG           + P +  +P ++    +   V  PSG      + DN +G+VT++Y P E G+HEM++  DGI I GSP +F+ +    G V AYGPGL HG    PA FT+ TKDAG GGLSLAIEGPSKA+I C DN++G+C V+Y P++PGDY+II+K+ D NIPGSPF++ I G+   R S + +GS +D+PL I  LD+S LTA++  PSG+EE C+LK + N ++GISF P+E+G H +N+ ++G HI  SP  +++ Q+EIGDAS+VRV G+GL    + E   F +DTR+AGYGGLSLSIEGPSK +I   D  DGTC+V+Y P+EPG Y+INIK+A++HV GS F VK+TGE   ++ E I  ++ AA +  VGSQC+L+LK+P    +DM A VT+  G     EI++ ++  Y I+F+P EMG+HTV V+++  H+PGSPFQFTVGP+ +GGAHKV A G GL+      P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGS GV Y V EPG+Y  SIKFND+HI +SPF + V     D   ++VAS+ ++ L     + +PA+F V+        + G + A +  PS   E   +  I++++YA+RFIP+E+G +LI+V  +    HIPGSPF++ +G+  Q  DPGMV A G GL  G  G    FIVNT ++G G L VTIDGPSKV++  QE  EGY+  Y P APG Y I++KYGG YHI GSPF A I+GS  VN  S   +H+ S++ VD V +SM TS        SS A +V   GLG+ K  + Q NTF+VD S+AG ++L VG+ GPK  CEE+ VKH+G   + ++Y ++EKG + L+VKWG+++IPGSP+ + V
Sbjct:  573 IGSEAGPQQVRAWGPGLESG--VVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIEC------DDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLK--IQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPS---LDLSKVKVAGLGSK---MTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGD-GTYTITYVPLYPG-AYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGL--GNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQT---HTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTG--VPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVC-TPDGGEVD------VDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFI--------HISFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGE--GRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGL----KVNQPASFAVSLNG-----AKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDV--KFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHS---MHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          

HSP 2 Score: 1030.01 bits (2662), Expect = 0.000e+0
Identity = 746/2325 (32.09%), Postives = 1115/2325 (47.96%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEW---KPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDV-SKIKVYGPGVQKEGVALNSPNEFTIDC-IEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDN---LDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHID---VSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-----EDGVKEYXXXXXXXXXXXXXXXA-------GEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPA----EFTIVTKDAGAGGLSLAIEG----PSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQIC--------------------IGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVV----GQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGY-------------GGLSLSIEGPSK--AEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI----TGEPSA---KLMEKIICQQEAADI-TQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGH--TSGPNEFSIYTREAGAGGLSIAIEGPSKAE--IDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPS----KVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ K F   N+R  FR  +LENV++ L FL+  E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ E+      ++TPKQR++ WI  ++PE  + N + DW  G A+GALVDSCAPGLCPDW  W   KPVD   + +EAM  A+ WL VPQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YGPGIE    +  + A FTV+  SAG+G + + + D AG   + K+    DK   Y   Y P   G + +TV +A + I +SPF+V +    GD SKV  +GPG+E  G I + +TYF + T  AG GE+  V++ PSG KD +   +  +  +SYR  Y   + G H I I  +  QI  SP+ V V    N  L T  GRG+Q  G+RV + AEF + T+ AG G L V +  P+  EE  K  ++    +   Y PS PG Y + I +    + RSPF++ +        + A+GPGL +GVVGK+A FV +  G ++G+LGFS+EGPS AKIEC D  DGS  + YWPT PGEYAVH+LC  EDI  SP+MA IMP+  K     K+K YGPG+Q  G+++  P EFT+D  +  K+ +K +A      GN + V +   GN  Y C Y P     H V VS    ++P+SPF++ +    +PN V+V G G+       Y P YF++D   AG G++++ I    G + P     D      D+D F V Y P  +G  Y   + +    IP +P  I++ P  D SKV  E     ++ +       F VN K   A GK  + A FT P+    G  V+      N DG+++  Y+P   G   L+VTY   PI  SPF + + P  D SKV V G G +                 GQG +G  + GPS   + C         T  V +     G Y++ + ++   + GSPF +    P + + V+C G  L      +V +P  F VD + AG A L      + G E  + I+   +   G Y IT+VP   G + + I++ +  VP  P   ++ P  E   VKV G GV   G F   +    F +D   +++ G   I+  ++NP        I D G G +  +YTP + G H + VA++ SPV   PF V V +  D  +  +     + G+       T       T           E K+SC                      +N +G+  + Y P E   Y +++ +GG  I    F            + ++  K K Q     N        ++ V+       G   ++  V  P G+ E A V DN + + T+ Y P   G + +NV     +I  SPYK          KV   GPGL+   TG+PA    EFTI  KDAG G L++ I      P KA I  +DN++G+  V+Y P + G Y+I+IK+    IP SP+   I   P   +  C                    IG  + + +         +T +V  P G E    + +  +    I +T  + G + I V   G HI  SPF++ V      +     S +   G+ L  G    MN   V    AG              G ++  +  PS   A+ +  DN DGT  V Y P+E G + ++IKY   H+ GSP    +    +G  +A    L+  ++ +     + T+   +  L+L + G   +D+  T              D  DG  ++ ++P   G + ++V++ + +IPGSPF               +   + +++ H       +  +   E     L+  +  PS  E     +  ++G  G+ +   E GE++ +IK N  HI +SP  +M+N+ ++   S   V    L++  T  +PA F ++    T     G L  +I GPS+ +     ++ E     + + P E G ++IN+  +  ++H+PGS F V +  +      +  K        VG +    +         +   +  PS    K ++   EN   Y   ++P+  G + ++VKY G  H+ GSPF                         TVG       P     A KV+  G G+++A       F++   +AG   L + + GP     E++ +        ++Y+VQE G + + +K+ +++IP SPF+V V
Sbjct:   32 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIANLQTDLSDGLRLIALLEVLSQKKMFRKYNQRPTFRQMQLENVSVALEFLD-IENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEESEESKQKTPKQRLLGWIQNKLPELPITNFSRDWQSGKALGALVDSCAPGLCPDWDSWDQTKPVD---NAREAMQQADDWLGVPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQ--DRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAG-SYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTK---AAGKAKLDAQFTGPN---KGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERA---KVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGD---GTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREAT--TDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCT---------------------DNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFS-------VPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDAS---KAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLN--TTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANI--RDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPY--RIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFIHISFISNSGQTLTNGQLG-MNGLDV----AGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCT--------------DNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFM------------SKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTF-EPAEFIID----TRDAGYGGLSLSIEGPSKVD--INTEDQEDGTCKVTYCPTEPGNYIINI--KFADQHVPGSAFTVKVTGEGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNT-YCIRFVPTEMGVHTVSVKYQGQ-HVPGSPFQF-----------------------TVG-------PLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKA--EIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPV 2224          

HSP 3 Score: 318.931 bits (816), Expect = 1.051e-86
Identity = 292/1059 (27.57%), Postives = 472/1059 (44.57%), Query Frame = 3
Query:  741 LIKPEEMIDPNVDEKAMMTYLSQ----------FPNAKVNPGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKV------------KGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMV------------SPRSNAKLVTVSGRGIQSNGIRVGDKAEF-FIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTN--GELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEF-TIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS--NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCD--PSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSIN----RVDQPITFTVDASRAG----------EAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE---PDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAF 3728
            +++P E++D N D+   ++Y+            + + ++ P +P   K+ P    +KVR  GPG+ +  + A    EFT+DA  AG G L + ITD  GK     I +  ++   Y  +Y P   G YTI ++Y   +IP SP+++    T GD SK  V             GP I+     +   T   +  + AG G+++C V +P G +  ++  + +    ++ + YTA + G + I +      I NSPF V V            S  SN+     +G+ +  NG+ V     F  +       G++   +  P        I +         Y P++ G++E+ I YD I +  SP +  V    + H+ A+GPGL  G+V K A+F  +T   GE G L  +IEGPS+A I C DNQDG+ T+ Y P  PG+Y + +  + ++IP SP+M+ I   ++   +S +KV        G A + P +   +D  +        A+  T SG E P ++    N      + P   G H V +  + + +P SP  V + Q    + + VRV G+GL  A  + PA F IDT +AG+G L++ I    G       + D +     V Y P   G  Y  +I++   ++PGS FT+++  E  + +      +         +  ++ K I       + A  T PS     + +    + +Y   + P + G + + V Y+   +  SPF   V P  +    KV   G GLE      P  F+I    AG G L +A+EGPS A+I   D  DG+  V Y    PG Y++ IKFND  +  SPF +P+  P + A        LT  S+     +V+QP +F V  + A              L+ CC          EI   +      Y + F+P E G + I++K     +PG+PF   +    +   P  V   G G+   GG  T   P +F ++ S AG G + +++  P  + +      EG   +   YTP   G + I++ +
Sbjct: 1403 VVEPAEVVD-NGDQTHTVSYVPTREGPYSINVLYADEEI-PQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRD--NQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPT-GDASKCTVTVSIGGHGLGAGVGPTIQ-----IGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVD--VVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFIHISFISNSGQTLTNGQ-LGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGE-GGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKIT-GDDSMRMSHLKV--------GSAADIPLDIGELDLSQLT------ATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIE---GPSKVDINTEDQEDGTCKVTYCPTEPG-NYIINIKFADQHVPGSAFTVKVTGEGRMKESITRKRRAASVANVGSQCDLSLK-IPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARR------LTVASLQESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCV--------TEIDEDK------YAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLE--GG--TTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEG---YKVTYTPMAPGNYLISIKY 2400          

HSP 4 Score: 268.085 bits (684), Expect = 3.016e-71
Identity = 327/1357 (24.10%), Postives = 552/1357 (40.68%), Query Frame = 3
Query: 2895 PGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPI-RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCF-----IEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTEN--GEVKSNLSLP----VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAI-VSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG----KVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGLSLAIE------GPSKAEIVCK--DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII-----------GEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDN--LGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAG-YGGLSLSIEGPSKAEIECRDN---YDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITG--EPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTR---EAGAGGLSIAIEGPS--KAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGK-KNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEG---YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATL--NQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P  +P K   +G G+E  G    +   FT++   AGQG + + +E P+    +AK+   ++ + T +V Y   + G + + + F    ++ SPF++ +     +++ V   G  L P   N  ++   F V  + AG   ++    D  G +  +E  S E+     Y  T+ PT+ G H I I  A   +  +P+  N+     P      G G+ P G  L      +F +    AG GD+++++  P  L  P    D G GV+   Y P+  G + IT+ +    +   PF V++       +       +E GV                     GK +  +V    +  G +  ++  P    +E ++ G+G+  + Y P E  EY V +      I   Q      +    P +    +K K+     ++          P EF +   LG +    I      G      V DN NG+ +  Y PR+   H + V+  G+ I  SP++    N G G    KV   GPG++  +TGL    P  FT+   +AG G +S+ I+      GP++A+I      N+N +  V Y P   G Y+I++ FAD  IP +P    +            G    RS + +   +   +       + L A    P+  +       + N +    + +TP + GN  +NV   G  I  SPF + +  +   D SKV+V G G K  +  +    TV ++ AG  G +   + GPS   + C+        T QV + P + G Y + + Y    + GSPF ++     +PS     K+ C     +  +VG   +  +       +++   + +  GT     I D  DG Y+I ++P   G +T+ +++ +  +P  P +  V P V+    KV   G   K        +F++  R   + G   +   I  PS  + E    D  DG+  V+Y   E G +   + ++   +  SPFR+ V E   D   V   G     +     KP  FTV      T      +     GPS  E      + +     + +IP E G + +NVT     + I GSPF V +     DP  V  +G GL +         F V+   +G  PL V + GP  V   ++  + G   +   Y+P+  G Y I V Y  +  I  SP+   +                              +PT    A KV+C G G+    +  +    F +DA  AG  +L V I  P  + ++ +++      ++++Y+    GR+ +++K+G   IP SP+ +  L
Sbjct:  279 PKLNPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAG-NIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVEC-SVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSLCTAKGRGLQPKG--LRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVV--------------------GKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDI---QLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGK---PAEFTVDAKLGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRM---NIGAGCHPNKVKVSGPGVA--KTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSL--DLSKVKVAGLGSKMTVGKD-QEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPS-----KVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEG-CDPARVRVHGPGL--QSGITNKPNKFTVETRGAGTGGLGLAME----GPS--EAKMSCTDNKDGSCCVEYIPYEPGTYNLNVT--YGGQPITGSPFSVPV-HDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYA-DEEIPQSPYKVKV------------------------------LPTHD--ASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRAL 1547          

HSP 5 Score: 187.963 bits (476), Expect = 8.534e-47
Identity = 197/760 (25.92%), Postives = 319/760 (41.97%), Query Frame = 3
Query:  771 NVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVA---QPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDG-VNIPGSPFTIQIKPEI--------DISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            N D    ++YL   P         N K  PG+P  SK+  +        +    L  G  A+  +D        L  T+T  +G+     ++ +  +      ++ P   G + + ++   + IP SP  V I+++  GD S+V+V G G+ +          FII T DAG G +S  +  PS    K++     +   + +V Y   E G + INI  +   +  S F V V+     K      R   S    VG + +  +         +  ++ SP       +I E   N +   ++P++ G++ + + Y    V  SPF+  V P        + A GPGL     G  A F +       G L  ++EGPS+A+I   D +DGS+ + Y    PG+Y V I  + E IP+SP++  +  ++   D  ++ V    +Q+ G+ +N P  F +     K  I  +A   + SG      ++     KY   + P  +G + + V  +   +P SPFK++V    Q  +P  V   G GL   T  +P  F ++T++AG G LAV I+       P  +  D     + + V Y P   G  Y  SI+Y G  +I GSPF  +I            + S V V+ +    TT  Q +      +A  + AKG G  K      ++F     K+G                  +VK  G+  Y+ SY   + G YIL V + D  I  SP++I V
Sbjct: 1814 NQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDD------SMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKML--RNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAE--FIIDTRDAGYGGLSLSIEGPS----KVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGEGRMKESITRKRRAASVA-NVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPV--ASPSDDARRLTVAS--LQESGLKVNQPASFAVSLNGAKGVI--DAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDG------PSKVKMDCQECPEGYKVTYTPMAPG-NYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          
BLAST of Filamin vs. Ensembl Zebrafish
Match: CR352234.2 (filamin A, alpha (actin binding protein 280) [Source:NCBI gene;Acc:562529])

HSP 1 Score: 1284.24 bits (3322), Expect = 0.000e+0
Identity = 766/2029 (37.75%), Postives = 1155/2029 (56.92%), Query Frame = 3
Query:  843 ITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKC--TYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGD---PSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKL------LSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK-TSHIAAFGPGLT-TGV-VGKAAIFVTDTNGE-LGSLGFSIEGPSEAK----IECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCV-YQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXX---------XXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNG-----------MYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGS--VNDSSEIYVHQQSNLKVDTVGKSMVTSMPT----QSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            I S+  P +VR +GPG+ES   + G++A+F V+A     G L  ++   +   I+       D K    C   Y P   G Y + V    +DI  SPF   I    G    P KVK  GPG++ +G+ V     F +  +  G   +   + +   D + ++ ++      +Y   YT  +   H++ +      I  SPF + +    +   V VSG G+   G++  D   F +D   AG G +++ +      + P +++    I   + + F   Y P   G Y + + + +  +  +P +I V P+   S + A GPGL+ +GV + K   F  +T       L     GP++       +  DN DG+ T+ Y P   G   +++   G+ IP SP+   I PS    D+SK+KV G G +   + +    E T+         K  A     S   +P  +    + +   V + P   G ++V ++ D   +P SPF ++   P++P+ VR  G GL  A    P  F +D TNAG   L +EI  + G      + ++ D   + + Y P   G  Y  +IRY   ++P  P  + ++P ++ S  KVF   ++   +F+E+   F V+A+A+   G   +K    +PS  ++ ++++  GDG+Y   Y+PY+ GT+ ++V Y+  P+  SPF + V  GCDP++V V G GL+ G TN+PN FT++  GAG G LGLA+EGPS+AK++CTDN DG+C VEY    PGTY++ + +    + GSPF +P+ D ++   VKC G+ L  G+  R + P  F+VDAS+AG APL+   +  +G   P E+    +     + +++VPT  GP++I + +A+  +P +P+   +LP  +  KV+  G G+  TG  +  S+PV+F ID  +AG+G + + +++PD      +I D   G +   Y P   G++ I + +    +   P+ +  +  GDA+KC +   +  + L            +T+IT++   AG+GK++C +    + GEV       V++  N +GT  I+Y+  +  +Y++ ++FGG  IPN  F+      +     +          +   N     TNG           + P +  +P ++    +   V  PSG      + DN +G+VT++Y P E G+HEM++  DGI I GSP +F+ +    G V AYGPGL HG    PA FT+ TKDAG GGLSLAIEGPSKA+I C DN++G+C V+Y P++PGDY+II+K+ D NIPGSPF++ I G+   R S + +GS +D+PL I  LD+S LTA++  PSG+EE C+LK + N ++GISF P+E+G H +N+ ++G HI  SP  +++ Q+EIGDAS+VRV G+GL    + E   F +DTR+AGYGGLSLSIEGPSK +I   D  DGTC+V+Y P+EPG Y+INIK+A++HV GS F VK+TGE   ++ E I  ++ AA +  VGSQC+L+LK+P    +DM A VT+  G     EI++ ++  Y I+F+P EMG+HTV V+++  H+PGSPFQFTVGP+ +GGAHKV A G GL+      P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGS GV Y V EPG+Y  SIKFND+HI +SPF + V     D   ++VAS+ ++ L     + +PA+F V+        + G + A +  PS   E   +  I++++YA+RFIP+E+G +LI+V  +    HIPGSPF++ +G+  Q  DPGMV A G GL  G  G    FIVNT ++G G L VTIDGPSKV++  QE  EGY+  Y P APG Y I++KYGG YHI GSPF A I+GS  VN  S   +H+ S++ VD V +SM TS        SS A +V   GLG+ K  + Q NTF+VD S+AG ++L VG+ GPK  CEE+ VKH+G   + ++Y ++EKG + L+VKWG+++IPGSP+ + V
Sbjct:  573 IGSEAGPQQVRAWGPGLESG--VVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIEC------DDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLK--IQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPS---LDLSKVKVAGLGSK---MTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGD-GTYTITYVPLYPG-AYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFSVPVHDTVDPTKVKCQGQGL--GNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQT---HTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLNTTG--VPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVC-TPDGGEVD------VDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFI--------HISFISNSGQTLTNGQLGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGE--GRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARRLTVASLQESGL----KVNQPASFAVSLNG-----AKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDV--KFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKAKITGSRLVNSHS---MHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          

HSP 2 Score: 1030.01 bits (2662), Expect = 0.000e+0
Identity = 746/2325 (32.09%), Postives = 1115/2325 (47.96%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEW---KPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDV-SKIKVYGPGVQKEGVALNSPNEFTIDC-IEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDN---LDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHID---VSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-----EDGVKEYXXXXXXXXXXXXXXXA-------GEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPA----EFTIVTKDAGAGGLSLAIEG----PSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQIC--------------------IGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVV----GQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGY-------------GGLSLSIEGPSK--AEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI----TGEPSA---KLMEKIICQQEAADI-TQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGH--TSGPNEFSIYTREAGAGGLSIAIEGPSKAE--IDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPS----KVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ K F   N+R  FR  +LENV++ L FL+  E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ E+      ++TPKQR++ WI  ++PE  + N + DW  G A+GALVDSCAPGLCPDW  W   KPVD   + +EAM  A+ WL VPQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YGPGIE    +  + A FTV+  SAG+G + + + D AG   + K+    DK   Y   Y P   G + +TV +A + I +SPF+V +    GD SKV  +GPG+E  G I + +TYF + T  AG GE+  V++ PSG KD +   +  +  +SYR  Y   + G H I I  +  QI  SP+ V V    N  L T  GRG+Q  G+RV + AEF + T+ AG G L V +  P+  EE  K  ++    +   Y PS PG Y + I +    + RSPF++ +        + A+GPGL +GVVGK+A FV +  G ++G+LGFS+EGPS AKIEC D  DGS  + YWPT PGEYAVH+LC  EDI  SP+MA IMP+  K     K+K YGPG+Q  G+++  P EFT+D  +  K+ +K +A      GN + V +   GN  Y C Y P     H V VS    ++P+SPF++ +    +PN V+V G G+       Y P YF++D   AG G++++ I    G + P     D      D+D F V Y P  +G  Y   + +    IP +P  I++ P  D SKV  E     ++ +       F VN K   A GK  + A FT P+    G  V+      N DG+++  Y+P   G   L+VTY   PI  SPF + + P  D SKV V G G +                 GQG +G  + GPS   + C         T  V +     G Y++ + ++   + GSPF +    P + + V+C G  L      +V +P  F VD + AG A L      + G E  + I+   +   G Y IT+VP   G + + I++ +  VP  P   ++ P  E   VKV G GV   G F   +    F +D   +++ G   I+  ++NP        I D G G +  +YTP + G H + VA++ SPV   PF V V +  D  +  +     + G+       T       T           E K+SC                      +N +G+  + Y P E   Y +++ +GG  I    F            + ++  K K Q     N        ++ V+       G   ++  V  P G+ E A V DN + + T+ Y P   G + +NV     +I  SPYK          KV   GPGL+   TG+PA    EFTI  KDAG G L++ I      P KA I  +DN++G+  V+Y P + G Y+I+IK+    IP SP+   I   P   +  C                    IG  + + +         +T +V  P G E    + +  +    I +T  + G + I V   G HI  SPF++ V      +     S +   G+ L  G    MN   V    AG              G ++  +  PS   A+ +  DN DGT  V Y P+E G + ++IKY   H+ GSP    +    +G  +A    L+  ++ +     + T+   +  L+L + G   +D+  T              D  DG  ++ ++P   G + ++V++ + +IPGSPF               +   + +++ H       +  +   E     L+  +  PS  E     +  ++G  G+ +   E GE++ +IK N  HI +SP  +M+N+ ++   S   V    L++  T  +PA F ++    T     G L  +I GPS+ +     ++ E     + + P E G ++IN+  +  ++H+PGS F V +  +      +  K        VG +    +         +   +  PS    K ++   EN   Y   ++P+  G + ++VKY G  H+ GSPF                         TVG       P     A KV+  G G+++A       F++   +AG   L + + GP     E++ +        ++Y+VQE G + + +K+ +++IP SPF+V V
Sbjct:   32 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIANLQTDLSDGLRLIALLEVLSQKKMFRKYNQRPTFRQMQLENVSVALEFLD-IENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEESEESKQKTPKQRLLGWIQNKLPELPITNFSRDWQSGKALGALVDSCAPGLCPDWDSWDQTKPVD---NAREAMQQADDWLGVPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECSVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSLCTAKGRGLQPKGLRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQ--DRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAG-SYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTK---AAGKAKLDAQFTGPN---KGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSLDLSKVKVAGLGSKMTVGKDQEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPSKVRCSGPGLERA---KVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGD---GTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREAT--TDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEGCDPARVRVHGPGLQSGITNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCT---------------------DNKDGSCCVEYIPYEPGTYNLNVTYGGQPITGSPFS-------VPVHDTVDPTKVKCQGQGLGNNVRANIPQVFSVDAS---KAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPQSPYKVKVLPTHDASKVRCSGPGLN--TTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANI--RDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPY--RIRALPTGDASKCTVTVSIGGHGLGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFIHISFISNSGQTLTNGQLG-MNGLDV----AGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCT--------------DNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFM------------SKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTF-EPAEFIID----TRDAGYGGLSLSIEGPSKVD--INTEDQEDGTCKVTYCPTEPGNYIINI--KFADQHVPGSAFTVKVTGEGRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNT-YCIRFVPTEMGVHTVSVKYQGQ-HVPGSPFQF-----------------------TVG-------PLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKA--EIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPV 2224          

HSP 3 Score: 318.931 bits (816), Expect = 1.051e-86
Identity = 292/1059 (27.57%), Postives = 472/1059 (44.57%), Query Frame = 3
Query:  741 LIKPEEMIDPNVDEKAMMTYLSQ----------FPNAKVNPGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKV------------KGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMV------------SPRSNAKLVTVSGRGIQSNGIRVGDKAEF-FIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTN--GELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEF-TIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS--NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCD--PSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSIN----RVDQPITFTVDASRAG----------EAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE---PDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAF 3728
            +++P E++D N D+   ++Y+            + + ++ P +P   K+ P    +KVR  GPG+ +  + A    EFT+DA  AG G L + ITD  GK     I +  ++   Y  +Y P   G YTI ++Y   +IP SP+++    T GD SK  V             GP I+     +   T   +  + AG G+++C V +P G +  ++  + +    ++ + YTA + G + I +      I NSPF V V            S  SN+     +G+ +  NG+ V     F  +       G++   +  P        I +         Y P++ G++E+ I YD I +  SP +  V    + H+ A+GPGL  G+V K A+F  +T   GE G L  +IEGPS+A I C DNQDG+ T+ Y P  PG+Y + +  + ++IP SP+M+ I   ++   +S +KV        G A + P +   +D  +        A+  T SG E P ++    N      + P   G H V +  + + +P SP  V + Q    + + VRV G+GL  A  + PA F IDT +AG+G L++ I    G       + D +     V Y P   G  Y  +I++   ++PGS FT+++  E  + +      +         +  ++ K I       + A  T PS     + +    + +Y   + P + G + + V Y+   +  SPF   V P  +    KV   G GLE      P  F+I    AG G L +A+EGPS A+I   D  DG+  V Y    PG Y++ IKFND  +  SPF +P+  P + A        LT  S+     +V+QP +F V  + A              L+ CC          EI   +      Y + F+P E G + I++K     +PG+PF   +    +   P  V   G G+   GG  T   P +F ++ S AG G + +++  P  + +      EG   +   YTP   G + I++ +
Sbjct: 1403 VVEPAEVVD-NGDQTHTVSYVPTREGPYSINVLYADEEI-PQSPYKVKVLPTHDASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRD--NQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPT-GDASKCTVTVSIGGHGLGAGVGPTIQ-----IGEQTVITVDAKAAGKGKVTCTVCTPDGGEVDVD--VVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVTVHTCHAHHLFIHISFISNSGQTLTNGQ-LGMNGLDVAGLRPFDLVIPFTIQKGEITGDVRMPSGKVAKPDITDNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGE-GGLSLAIEGPSKADISCTDNQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKIT-GDDSMRMSHLKV--------GSAADIPLDIGELDLSQLT------ATLTTPSGREEPCLLKMLRNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIE---GPSKVDINTEDQEDGTCKVTYCPTEPG-NYIINIKFADQHVPGSAFTVKVTGEGRMKESITRKRRAASVANVGSQCDLSLK-IPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPVASPSDDARR------LTVASLQESGLKVNQPASFAVSLNGAKGVIDAKVHSPSGALEECCV--------TEIDEDK------YAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLE--GG--TTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEG---YKVTYTPMAPGNYLISIKY 2400          

HSP 4 Score: 268.085 bits (684), Expect = 3.016e-71
Identity = 327/1357 (24.10%), Postives = 552/1357 (40.68%), Query Frame = 3
Query: 2895 PGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPI-RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCF-----IEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTEN--GEVKSNLSLP----VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAI-VSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG----KVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGLSLAIE------GPSKAEIVCK--DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII-----------GEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDN--LGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAG-YGGLSLSIEGPSKAEIECRDN---YDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITG--EPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTR---EAGAGGLSIAIEGPS--KAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGK-KNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEG---YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATL--NQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P  +P K   +G G+E  G    +   FT++   AGQG + + +E P+    +AK+   ++ + T +V Y   + G + + + F    ++ SPF++ +     +++ V   G  L P   N  ++   F V  + AG   ++    D  G +  +E  S E+     Y  T+ PT+ G H I I  A   +  +P+  N+     P      G G+ P G  L      +F +    AG GD+++++  P  L  P    D G GV+   Y P+  G + IT+ +    +   PF V++       +       +E GV                     GK +  +V    +  G +  ++  P    +E ++ G+G+  + Y P E  EY V +      I   Q      +    P +    +K K+     ++          P EF +   LG +    I      G      V DN NG+ +  Y PR+   H + V+  G+ I  SP++    N G G    KV   GPG++  +TGL    P  FT+   +AG G +S+ I+      GP++A+I      N+N +  V Y P   G Y+I++ FAD  IP +P    +            G    RS + +   +   +       + L A    P+  +       + N +    + +TP + GN  +NV   G  I  SPF + +  +   D SKV+V G G K  +  +    TV ++ AG  G +   + GPS   + C+        T QV + P + G Y + + Y    + GSPF ++     +PS     K+ C     +  +VG   +  +       +++   + +  GT     I D  DG Y+I ++P   G +T+ +++ +  +P  P +  V P V+    KV   G   K        +F++  R   + G   +   I  PS  + E    D  DG+  V+Y   E G +   + ++   +  SPFR+ V E   D   V   G     +     KP  FTV      T      +     GPS  E      + +     + +IP E G + +NVT     + I GSPF V +     DP  V  +G GL +         F V+   +G  PL V + GP  V   ++  + G   +   Y+P+  G Y I V Y  +  I  SP+   +                              +PT    A KV+C G G+    +  +    F +DA  AG  +L V I  P  + ++ +++      ++++Y+    GR+ +++K+G   IP SP+ +  L
Sbjct:  279 PKLNPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYVPKVTGQHKVTVLFAGQHISKSPFEVDVGMAQGDSSKVTAQGPGLEPAG-NIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVEC-SVEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVNVGEACNPSLCTAKGRGLQPKG--LRVKETAEFKVYTKGAGTGDLKVTIKGPKGLEEPCKKKDLGDGVYSFDYYPSTPGNYIITITWGGQHIPRSPFEVKIGSEAGPQQVRAWGPGLESGVV--------------------GKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDI---QLSPFMAEIMPAPGKDFYPDKVKAYGPGLQSSGLSVGK---PAEFTVDAKLGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPVKHTVMVSWGGVNIPESPFRM---NIGAGCHPNKVKVSGPGVA--KTGLKAYDPTYFTVDCAEAGQGDISIGIKCAAGVVGPAEADIDFDIIRNDNDTFTVKYTPPGAGSYTIMVLFADQTIPMTPIRIKVDPSHDASKVKAEGPGLSRSGVELNKPTHFTVNTKAAGKAKLDAQFTGPNKGDAVRDFDIIDNHDGTHTVKYTPVQQGNMGLNVTYGGDPIPKSPFAVAIAPSL--DLSKVKVAGLGSKMTVGKD-QEITVKSKGAGGQGKVGAKVTGPSAKSVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGAPIPGSPFPIEAIAPTDPS-----KVRCSGPGLERAKVGEPGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYVPLYPGAYTLTIRYGDQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTDFTVDARALTKTGGNHIKTCINNPSGNRTEALIRDLGDGTYQVEYTPYEEGTHSVEVAYDSSPVPKSPFRVPVTEG-CDPARVRVHGPGL--QSGITNKPNKFTVETRGAGTGGLGLAME----GPS--EAKMSCTDNKDGSCCVEYIPYEPGTYNLNVT--YGGQPITGSPFSVPV-HDTVDPTKVKCQGQGLGNNVRANIPQVFSVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYA-DEEIPQSPYKVKV------------------------------LPTHD--ASKVRCSGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPDGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRAL 1547          

HSP 5 Score: 187.963 bits (476), Expect = 8.534e-47
Identity = 197/760 (25.92%), Postives = 319/760 (41.97%), Query Frame = 3
Query:  771 NVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVA---QPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDG-VNIPGSPFTIQIKPEI--------DISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            N D    ++YL   P         N K  PG+P  SK+  +        +    L  G  A+  +D        L  T+T  +G+     ++ +  +      ++ P   G + + ++   + IP SP  V I+++  GD S+V+V G G+ +          FII T DAG G +S  +  PS    K++     +   + +V Y   E G + INI  +   +  S F V V+     K      R   S    VG + +  +         +  ++ SP       +I E   N +   ++P++ G++ + + Y    V  SPF+  V P        + A GPGL     G  A F +       G L  ++EGPS+A+I   D +DGS+ + Y    PG+Y V I  + E IP+SP++  +  ++   D  ++ V    +Q+ G+ +N P  F +     K  I  +A   + SG      ++     KY   + P  +G + + V  +   +P SPFK++V    Q  +P  V   G GL   T  +P  F ++T++AG G LAV I+       P  +  D     + + V Y P   G  Y  SI+Y G  +I GSPF  +I            + S V V+ +    TT  Q +      +A  + AKG G  K      ++F     K+G                  +VK  G+  Y+ SY   + G YIL V + D  I  SP++I V
Sbjct: 1814 NQDGTCTVSYLPVLPGDYNIIVKYNDKNIPGSPFMSKITGDD------SMRMSHLKVGSAADIPLDIGELDLSQLTATLTTPSGREEPCLLKML--RNGHVGISFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIGDASRVRVTGQGLSEARTFEPAE--FIIDTRDAGYGGLSLSIEGPS----KVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGEGRMKESITRKRRAASVA-NVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDEHIPDSPFVVPV--ASPSDDARRLTVAS--LQESGLKVNQPASFAVSLNGAKGVI--DAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRVGETGQAGDPGMVSAYGAGLEGGTTGSPCEFIVNTSSAGPGALAVTIDG------PSKVKMDCQECPEGYKVTYTPMAPG-NYLISIKYGGPYHIVGSPFKAKITGSRLVNSHSMHETSSVLVDPVTRSMTTSQQAAPGWASSDASRVVAKGLGLNKGFIGQKNTFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDEHIPGSPYHITV 2545          
BLAST of Filamin vs. Ensembl Zebrafish
Match: flnca (filamin C, gamma a (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-070503-1])

HSP 1 Score: 1150.96 bits (2976), Expect = 0.000e+0
Identity = 752/2105 (35.72%), Postives = 1117/2105 (53.06%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSG----DKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIEC---CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQTT-IFQESFIRFVVNAKA-IDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQ--PITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIE-----DGVKEYX----XXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQ-RRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRAT---------VTNLYGTTEVCEIIDLDDGHYSIK-----------------------FIPKE-MGLHTVVVQHRNMHIPGSPFQFTV--GPIVDGGAHKVVASGN---------------------------GLKLGHTSGP-NEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEP------------------------GEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGK---LRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHA--DPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGK---------SMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIV 6761
            P  + + P KV+ +GPG+E   +   ++ +FTVDA  AG+G L I   D  G +ID++I +  D    + C Y P     +TI + + E +IP+SPF+V + +    P KVKV GPG+E+ G+  +  TYF +   +AG G++S  +    G     +  I+  I +    ++ V+YT    G ++I +  +  +I +SPF V V P  +A  V   G GI   G++V     F I T+ AG  K  V   +  K   +VK  EI  N+   +   Y     G   + + +   P+ +SPFKI V P+          GL   V VGK   F+ +T G    G +  SI  PS   I C    D    +  + Y P   G Y V I  DG  +P SP+ +  +MP+    D SK++ YGPG++  G  +  P +F+ID     +          C   E  +     G+     VY P   G++ + +      +P SPFK  V    +   V   G GL  A     A F++D + AG   L +EI  + G      + N+ D   F V Y P   G V+  +I+Y G  +P SP  ++++P +D S  KV+   ++   + +E    F+V+A+A    KG   VK    +PS   + + +   GDG+Y   Y+ ++ G ++++V Y+++ +  SPF + VV GCDP++V  +G GLEGG  N+PN FT++  GAG   LGL IEG S+AK+ C DN DG+C+VEY     G YDI I +    + GSPF++ ++D ++ + VKC G    PG  N+V    P TFTVD S+AG APL+      +G   P+ +K   N   G + + + P + GPH + +K+AN  VP +P+  N  P  +  KV+  G G+  TG  +  S+PV+F ID  +AG+G + + + +P+       I D   G +   Y P   G++ IT+ +    +   P+ V+    GDA+KC +       GV E +     ++ ET+IT++   AG+GK++C +   T NG     + L +++  N +GT  IYY+  E  +Y++ I+FGG  IP   F+                     Q  + R++T        P+   +P ++    +   V  PSG      + DN +G+VT++++P E+G+HEM++  DG  I GSP +F+ +    G V AYGPGL HG    PA FT+VTK+AG GGLSLA+EGPSKAEI CKDN++G+C V+Y P  PGDY+II+KF + +IPGSPF A I G+   RRSQ+ +G+ +DV LKI   D+S LTAS++APSGKEE C+LK++PN ++G+SFTP+EVG H ++V +SG H+  SPFKI+VG +EIG+AS+V+ FG+GL    + E+  F VDTR AGYGGL LSIEGPSK +I C D  DGTC+V+Y P+EPG Y+INIK+A++H+ GSPF VK+TGE   ++ + I  +++AA I  VGS C+L LK+PG     + A           ++ Y  TE  EI     G    +                       F+ ++ +G    + Q     I G   Q T   G + D    ++V SGN                           G     T GP  E   +   AG  GL  A+     AE     R+ G+ G+   V  P                        G+Y  SIKFN++HI +SPF           + VA++ D+A     T  +     VN   +  ++ +G    + A +  PS   E   +  ++ ++ AIRFIP+E+G H I+V  +    HIPGSPF+V +G+  +  DPGMV A G GL  G  G  + F+VNT  +G+G L+VTIDGPSKV++   E +EGY+  Y P APG Y I +KYGG  HI GSPF A + G +  S    +H+ S++ V+TV K         S+ +SMPT  S A KV CHG G+ KA + Q N+F+VD S+AG ++L VG+ GP++ CE+V+VKHMG   + + Y V+EKG + ++VKWG++ IPGSPF V
Sbjct:  667 PAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGD--GTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGC-HPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGN-AVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKV-QGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPA----DPSKVRAYGPGLK--GGIVGQPAKFSIDTKGAGAGGLGLTLEGPC---EAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKD-GTFSVTYTPLFHG-VHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSG----PGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVK---NNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTG--VAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTV--QTPNG-----MELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQ----------------VMATDQPVAPRDDTKPM---FQPLNLVIPFTVQQGELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGE--GRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEGETGIQGMTAQVTSPGGNLADA---EIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAV-AKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPF----------IVPVATLSDDARRLTVTSLQEKDLKVNQEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDV--KFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGYKISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIG-MRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPT--SDASKVVCHGAGLSKAFVGQKNSFSVDCSKAGTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHV 2699          

HSP 2 Score: 1097.03 bits (2836), Expect = 0.000e+0
Identity = 761/2331 (32.65%), Postives = 1152/2331 (49.42%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSK-LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFG--EGLEGGFTNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINC---TDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI------EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTG-LPAEFTIVTKDAGAGGLSLAIEGP--SKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIAN---------IIGEPQRRSQICIGSTSDVPLKINNLDIST--LTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASK----VRVFGEGLKCGIS-----NEMNSFTVDTREAGYGGLSLSIEGPSKAEI--ECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGT-HHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAK-EWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIG-QQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQS------------NLKVDTVGKSMVTSMP-------------TQSSVAQKVQCHGLGIKKATLNQVNT----------FNVDASQAGNDILF----------VGIAG-------PKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ + DLQ D  DG++L++L+EVLS+ K +   + R NFR  KLENV++ L FL+ +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ ED +    K TPKQR++ WI  ++PE  + N   DW DG A+GALVD+CAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE++DP+VDE ++MTYLSQFP AK+ PGAP+  K L P K + YGPGIE +  +  + A FTV+   AG G + + + D  G   + K+    DKK  +  TY P  +G + + V +A +DI +SPF V + K  GDP+KV+ +GPG+E  G +    TYF I T  AG G++S V++ P    + +   +  +    +R  Y     G H+I++  +   I +SPF V +S  SNA     +GRG+Q  G+RV + A+F + T+ AG G+L V +  P   E  VK+ ++    F+C Y P KPG Y + I +   P+ RSPF++ V     T  + A+GPGL TG+VGK+A FV +  G E+G+LGFSIEGPS+AKIEC D  DGS  + YWPT PG+YAVH++CD EDI +SP+MA+I+P+       K+K +GPG++  GV +N   +FT+D  E  K  +K  A      G  I + I+  G+  + CVY P     H + ++    ++PKSPF+V V +  +P+ V+V G G+         P YF++D + AG G++++ I    G + P     D      D+D F V Y P   G  Y   + +    IP SPF +++ P  D  KV  E     +T +  E    F +  K     GK   +  F    +   G+ VK      N D SY+  Y+    G   + VT+   PI  SPF I V P  D  KV V G  E +E G   +   F ++  GA GQG + ++I  PS   I C   +D       V+Y     G Y + I ++   V  SPF +    P + + V+ +G  L  G +    QP  F++D   AG   L          E P E K   ++   G   + ++PTE G + I I +    +PG+PF   + P  +  KV   G G+         S    F +D S AG+ ++ + + +         I +   G F   YTP   G H IT+ +    V   P  V+V    D +   +        GV   +  +       +    G   +  RI+         S  +    I + G+GT  + Y+  E   +L+++ +  V++P   FK           E  +  + ++          +  N  + VE R     GA      ++         L  DN +GS ++ Y P   G +++N+   G  I GSP++    +   + KV   GPGL++  T  +P  FT+    AG   L + + GP  +   +V K+N +G+  V Y P   G +++ +K+A+  +P SP+  N         +           + ++  V   I+  D     LT  +  P GK +   +    +    +S+ P   G + I +   G +I  SP+   V     GDASK    V + G G+   +      +E    TVD + AG G ++ +++ P+  E+  +  +N DGT  + YT  EPG Y+I I++  +H+  SPF V  T +P A             D T+   Q  L L +P T    ++   V    G T    I D  DG  +++F P E GLH + +++   HIPGSP QF V     G    V A G GL  G  + P  F++ T+ AG GGLS+A+EGPSKAEI  +D KDG+C V Y  T PG+Y   +KF++ HI  SPF   +             GD++L + +  +G  A  ++   +T        L A+I  PS  EEP +++ +      + F PKE GEH ++V    + KH+  SPF++++G  +  +   V A G GL+     +   F V+T N+G G L ++I+GPSKV +   + E+G  +  Y P+ PG Y I +K+  + HI GSPFT  ++G       I   +Q+            NLK+      M+++               T++   +  + HG   K+    + +T           +V  S  G D L            GI G       P     +  +   G + + + ++  E G H + VK+  +++PGSPF
Sbjct:   31 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKGVTDLQKDLGDGLKLISLLEVLSQKKMYRKHHVRPNFRQMKLENVSVALEFLD-RERIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDEDDE-EVKKLTPKQRLLGWIQNKVPELPINNFNKDWRDGKALGALVDNCAPGLCPDWQTWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPVKPKQLYPKKAKAYGPGIEPQGNMVLKPAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQ--DAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPG-RYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTK---GAGKAKPEVHF---KTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGKDQE---FIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVG---QPAKFSIDTKGAGAGGLGLTL------EGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVAS----FTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIIN-------PSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFK-------VSVVEGCDPTRVRAYGPGLEGGIVNKPN-CFTVETR-----GAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYN--VQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVA-----------PRDDTKPMFQ-PLNLVIPFTVQQGELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSG---MVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKIT------------GDDSLRRSQLNVGTAADVSLKITETDL----SYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRK--SGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKF-ADKHIPGSPFTVKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEGETGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPF 2278          

HSP 3 Score: 499.204 bits (1284), Expect = 2.559e-142
Identity = 521/1940 (26.86%), Postives = 826/1940 (42.58%), Query Frame = 3
Query: 1161 PSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPR-SNAKLVTVSGRGIQSNGIRVGDKAEFF-IDTQNAGNGKLNVKLLSPEKSEESVKIAEINP--NYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIA-AFGPGLT-TGV-VGKAAIFVTDTNGE-LGSLGFSIEGPS--EAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSG-NEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSN---PNNVRVIGEGLH--SATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPV-YNCSIRYDGVNIPGSPFTIQIKP--EIDISKVFVENLQTTIFQESF-IRFVVNAKAIDAKGKGTVK-AIFTDPSSFKSGS------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQG----NLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFG--EPLTPGSINRVDQPITFTVDASRAG-EAPLKACCKDNQGHEYPLEI---KSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPI-SLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGS------TSDVP----LKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKC-GISNEMN-SFTVDTREAGYGGLSLSI---EG-PSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI--TGEPSAKLMEKIICQQEAADI----TQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQF--TVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQ---LYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKS---QCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P K K  GPGIE  G +V     F + T +AG GE+   V  P G  ++       +   ++ V Y  +  G H + +  +   I  SPF V V+    +   V   G G++  G  V  K  +F I T  AG G ++V ++ P+    +V++   N   N F C Y P   G + + + +   P+  SPFK+N+     ++   A G GL   GV V + A F   T G   G L  S++GP   E  ++ CD  DG     Y P  PG+Y V+I   G+ IP SP+   +   +++    K++ +GPG++   V  ++  +F ++ I  +         F+  G ++  +     G+      Y P   G++ V V CD++ +  SPF   +   +N   P  V+  G GL     T      F++D   AG G L +   D  G ++   +++  D   F   Y P    PV +   I +  VNIP SPF + +      D  KV+   ++ T  + +    F V+       G+G V   I   P             ++K++ D +++  Y+P   G Y + V + D  I +SPF ++V P  D  KV   G G+   G     P  FTI   GAG+     +   A +G +       DN D + TV+Y++   G   I +      +  SPFK+ +   ++   VK  G  E +  G     DQ   F V+   AG +  +        G   P ++   K++E T      + ++P E G + ++I +    VP +PF    L  ++P KV+  G G+   GG +    P +F ID   AG     L L+         +  D G G     Y PT+AG + I + + ++ +   PF   V    DA K        E          T++ + AGE +++  IV         S     V I+NN +GT S+ Y+P     + + IK+GG  +P      K     +     +     + +    R  TT +      V+ R    + G  +V+  +  PSG    A + D  +G+  + Y   E G+H + V  D + +  SP+K    E     +V AYGPGL  G    P  FT+ T+ AG  GL L IEG S+A+++CKDN++GSC V Y P   GDY I I +    IPGSPF   +          C G       T+ VP    +  +   ++ L   +  P G  E  ++K   +    +++TP + G H ++V  +   +  SP+K+    +   DASKVR  G GL   G++  +   FT+D R+AG G L++ I   EG P KA I   DN DGT  VSY P   G Y I IKY  +++  SP+ V+   TG+ S  L+   I     A+      Q+  +  +T+         +  TV    G     ++ +  DG + I +   E G + + ++    HIP SPFQ   T  P+      K +     L +  T    E S   R          +     A     D KDG+  V++  TE G +   IK++ +HI  SP +  V+      ++    G        T+ KPA+FTV     T     G L   + GPS+ E     ++ +     + ++P   G++  N+  +  N HIPGSPF   I     D  +  ++ +      VG      +    +    L  +I  PS  +   L  +         + P   GE++++V+  G  H+  SPF                            K MV   P++   A +V+  G G+ +A   +V  F VD   AG   L + I GP      C++V           + Y   E G + + +K+ +K+IPGSPF V V
Sbjct:  282 PKKAKAYGPGIEPQGNMVLKPAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEG-NVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEV---SKEAGTQKVRAWGPGLKTGMVGKSA--DFVVEAIGTEVG----TLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGD-GTFVCVYVPTK--PVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSE---AGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDND-TFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGK----DQ--EFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATC-----VKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLK--GGIV--GQPAKFSIDTKGAGA--GGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVS-------DSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPK-GVLREVTTHFI-----VDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSH--DASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASI--HDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVAESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVAPRDDTKPMFQPLNLVIPFTVQQGELSGEVR----------MPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPG----LCHGTVNKPASFTV----VTKNAGQGGLSLAVEGPSKAE--ISCKDNKDGTCTVSYLPTTPGDY--NIIVKFDNSHIPGSPFTAKI---TGDDSLRRSQLN------VGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGK-HVNNSPF----------------------------KIMVG--PSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVE-----DGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKV 2103          

HSP 4 Score: 302.753 bits (774), Expect = 1.003e-81
Identity = 330/1167 (28.28%), Postives = 514/1167 (44.04%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKS-EPDKVKVIGEGVAPTGGF-LTPSVPVQFHIDVSEAGQGDI--QXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQ-VGDANKCFIED-GVK-EYXXXXXXXXXXXXXXXAGEGKISCRIV-PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-----PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKE------ESCILKKMPNDNLGISF----TPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIE------GPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELT------LKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPS----KAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQM--DFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIK-KATLNQVNT-FNVDA-----SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            L PGAP    + PK   P K K  G G+ P G   L P+V   F ++  EAG G++   +               ++ K  F   Y P   G+H + V F    +   PF+V V + +GD NK      G++ E  + +  T   I T  AG G +S  IV P  +N  V+      V +EN G+      Y P     + + + F G  IP+  FK    + +N           + +    + E  D+T              G   ++  V  P G+     V D  +G     Y P + G + +N+T  G  I  SP++   ++ AG  KV A+GPGL  G  G  A+F +       G L  +IEGPS+A+I C D  +GSCDV Y+P  PGDY++ +   D +I  SPF+A+I+       P++      G      + +N     T+ A      G +      E C++     D    +F     P +   H I +     +I  SPF+++VG+    D  KV+V+G G+ K G+ +NE   FTVD  EAG G +S+ I+      GP++A+I+     N + T  V YTP  PG Y I + +A++ +  SPF VK+  +PS    +    + E   I + G Q E+        K  G    ++           +  EIID  D  Y++K+     G   +VV H    IP SPF+ TV P +D G  KV      +++G      EF + T+ AG  G ++++I  PS      +++ +  K+ +C VKY   E G Y   I ++ + +  SPF +   E  M  D   V + G     K   +G+PA F+++    T     G L  T+ GP   E     Q+      ++ ++P E+G++ IN+       HIPGSPF+ V+ +   D G V A G GL     G+   F V+   +G   L + I  D  ++ ++  Q N++G +   Y P   G + IT+KYGG   +  SP                +H +    VDT G                ++ +G G++ K  L +V T F VDA     ++ GN +  + I  P     +  +   G   + + Y   E G H + V + E  +P SPF V V+
Sbjct:  269 LKPGAP----VKPKQLYPKKAKAYGPGIEPQGNMVLKPAV---FTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVE------VILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEASNANACRATGRGLQPKGVRVK-EVADFT--------VFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPG-LEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPD--KVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKV--DPSHDAGK---VRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGKD---QEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATC-VKYIPPEEGHYKVDITYDGNPVPESPFSV---EGLMPADPSKVRAYGPG--LKGGIVGQPAKFSID----TKGAGAGGLGLTLEGPC--EAKIECQDNGDGTCSVVYLPTEAGDYNINIL--YGEAHIPGSPFKAVV-KPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQ-QVPKSP----------------IHVKVEPSVDTSG----------------IKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVK-IRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVV 1353          
BLAST of Filamin vs. Ensembl Zebrafish
Match: flnca (filamin C, gamma a (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-070503-1])

HSP 1 Score: 1150.19 bits (2974), Expect = 0.000e+0
Identity = 751/2104 (35.69%), Postives = 1116/2104 (53.04%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSG----DKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIEC---CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQTT-IFQESFIRFVVNAKA-IDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQ--PITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIE-----DGVKEYX---XXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQ-RRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRAT---------VTNLYGTTEVCEIIDLDDGHYSIK-----------------------FIPKE-MGLHTVVVQHRNMHIPGSPFQFTV--GPIVDGGAHKVVASGN---------------------------GLKLGHTSGP-NEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEP------------------------GEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGK---LRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHA--DPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGK---------SMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIV 6761
            P  + + P KV+ +GPG+E   +   ++ +FTVDA  AG+G L I   D  G +ID++I +  D    + C Y P     +TI + + E +IP+SPF+V + +    P KVKV GPG+E+ G+  +  TYF +   +AG G++S  +    G     +  I+  I +    ++ V+YT    G ++I +  +  +I +SPF V V P  +A  V   G GI   G++V     F I T+ AG  K  V   +  K   +VK  EI  N+   +   Y     G   + + +   P+ +SPFKI V P+          GL   V VGK   F+ +T G    G +  SI  PS   I C    D    +  + Y P   G Y V I  DG  +P SP+ +  +MP+    D SK++ YGPG++  G  +  P +F+ID     +          C   E  +     G+     VY P   G++ + +      +P SPFK  V    +   V   G GL  A     A F++D + AG   L +EI  + G      + N+ D   F V Y P   G V+  +I+Y G  +P SP  ++++P +D S  KV+   ++   + +E    F+V+A+A    KG   VK    +PS   + + +   GDG+Y   Y+ ++ G ++++V Y+++ +  SPF + VV GCDP++V  +G GLEGG  N+PN FT++  GAG   LGL IEG S+AK+ C DN DG+C+VEY     G YDI I +    + GSPF++ ++D ++ + VKC G    PG  N+V    P TFTVD S+AG APL+      +G   P+ +K   N   G + + + P + GPH + +K+AN  VP +P+  N  P  +  KV+  G G+  TG  +  S+PV+F ID  +AG+G + + + +P+       I D   G +   Y P   G++ IT+ +    +   P+ V+    GDA+KC +       GV+       ++ ET+IT++   AG+GK++C +   T NG     + L +++  N +GT  IYY+  E  +Y++ I+FGG  IP   F+                     Q  + R++T        P+   +P ++    +   V  PSG      + DN +G+VT++++P E+G+HEM++  DG  I GSP +F+ +    G V AYGPGL HG    PA FT+VTK+AG GGLSLA+EGPSKAEI CKDN++G+C V+Y P  PGDY+II+KF + +IPGSPF A I G+   RRSQ+ +G+ +DV LKI   D+S LTAS++APSGKEE C+LK++PN ++G+SFTP+EVG H ++V +SG H+  SPFKI+VG +EIG+AS+V+ FG+GL    + E+  F VDTR AGYGGL LSIEGPSK +I C D  DGTC+V+Y P+EPG Y+INIK+A++H+ GSPF VK+TGE   ++ + I  +++AA I  VGS C+L LK+PG     + A           ++ Y  TE  EI     G    +                       F+ ++ +G    + Q     I G   Q T   G + D    ++V SGN                           G     T GP  E   +   AG  GL  A+     AE     R+ G+ G+   V  P                        G+Y  SIKFN++HI +SPF           + VA++ D+A     T  +     VN   +  ++ +G    + A +  PS   E   +  ++ ++ AIRFIP+E+G H I+V  +    HIPGSPF+V +G+  +  DPGMV A G GL  G  G  + F+VNT  +G+G L+VTIDGPSKV++   E +EGY+  Y P APG Y I +KYGG  HI GSPF A + G +  S    +H+ S++ V+TV K         S+ +SMPT  S A KV CHG G+ KA + Q N+F+VD S+AG ++L VG+ GP++ CE+V+VKHMG   + + Y V+EKG + ++VKWG++ IPGSPF V
Sbjct:  685 PAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGD--GTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGC-HPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGN-AVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKV-QGLNEKVEVGKDQEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPA----DPSKVRAYGPGLK--GGIVGQPAKFSIDTKGAGAGGLGLTLEGPC---EAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKD-GTFSVTYTPLFHG-VHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSG----PGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVK---NNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTG--VAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGPNIQMSEETVITVDAKAAGKGKVTCTV--QTPNG-----MELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQ----------------VMATDQPVAPRDDTKPM---FQPLNLVIPFTVQQGELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKITGDDSLRRSQLNVGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKVTGE--GRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEGETGIQGMTAQVTSPGGNLADA---EIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPFQFTVGPLGEGGFHKVRAGGTGLERAV-AKVPAEFSIWTREAGAGGLSIAVEGPSKAEINFEDRKDGSCGVSYVVQEPGDYEVSIKFNNEHIPDSPF----------IVPVATLSDDARRLTVTSLQEKDLKVNQEASFAVQRNGARGVIDAKVHAPSGVVEECYVTELDSDKNAIRFIPRENGVHSIDV--KFNGSHIPGSPFKVRVGEAESVGDPGMVSAFGPGLEGGRTGVPSEFVVNTCKAGSGALSVTIDGPSKVKMDCNECQEGYKISYTPMAPGNYLICIKYGGPQHIVGSPFKAKVIG-MRLSGGHSLHETSSVIVETVTKSSKMAGAYSSLTSSMPT--SDASKVVCHGAGLSKAFVGQKNSFSVDCSKAGTNMLMVGVHGPRTPCEDVTVKHMGNKLYNVTYTVKEKGNYVVIVKWGDETIPGSPFHV 2716          

HSP 2 Score: 1087.02 bits (2810), Expect = 0.000e+0
Identity = 763/2348 (32.50%), Postives = 1156/2348 (49.23%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSK-LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVS---------PR---------SNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFG--EGLEGGFTNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINC---TDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI------EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTG-LPAEFTIVTKDAGAGGLSLAIEGP--SKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIAN---------IIGEPQRRSQICIGSTSDVPLKINNLDIST--LTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASK----VRVFGEGLKCGISN----EMNSFTVDTREAGYGGLSLSIEGPSKAEI--ECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGT-HHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAK-EWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIG-QQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQS------------NLKVDTVGKSMVTSMP-------------TQSSVAQKVQCHGLGIKKATLNQVNT----------FNVDASQAGNDILF----------VGIAG-------PKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ + DLQ D  DG++L++L+EVLS+ K +   + R NFR  KLENV++ L FL+ +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ ED +    K TPKQR++ WI  ++PE  + N   DW DG A+GALVD+CAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE++DP+VDE ++MTYLSQFP AK+ PGAP+  K L P K + YGPGIE +  +  + A FTV+   AG G + + + D  G   + K+    DKK  +  TY P  +G + + V +A +DI +SPF V + K  GDP+KV+ +GPG+E  G +    TYF I T  AG G++S V++ P    + +   +  +    +R  Y     G H+I++  +   I +SPF V +S         P+         SNA     +GRG+Q  G+RV + A+F + T+ AG G+L V +  P   E  VK+ ++    F+C Y P KPG Y + I +   P+ RSPF++ V     T  + A+GPGL TG+VGK+A FV +  G E+G+LGFSIEGPS+AKIEC D  DGS  + YWPT PG+YAVH++CD EDI +SP+MA+I+P+       K+K +GPG++  GV +N   +FT+D  E  K  +K  A      G  I + I+  G+  + CVY P     H + ++    ++PKSPF+V V +  +P+ V+V G G+         P YF++D + AG G++++ I    G + P     D      D+D F V Y P   G  Y   + +    IP SPF +++ P  D  KV  E     +T +  E    F +  K     GK   +  F    +   G+ VK      N D SY+  Y+    G   + VT+   PI  SPF I V P  D  KV V G  E +E G   +   F ++  GA GQG + ++I  PS   I C   +D       V+Y     G Y + I ++   V  SPF +    P + + V+ +G  L  G +    QP  F++D   AG   L          E P E K   ++   G   + ++PTE G + I I +    +PG+PF   + P  +  KV   G G+         S    F +D S AG+ ++ + + +         I +   G F   YTP   G H IT+ +    V   P  V+V    D +   +        GV   +  +       +    G   +  RI+         S  +    I + G+GT  + Y+  E   +L+++ +  V++P   FK           E  +  + ++          +  N  + VE R     GA      ++         L  DN +GS ++ Y P   G +++N+   G  I GSP++    +   + KV   GPGL++  T  +P  FT+    AG   L + + GP  +   +V K+N +G+  V Y P   G +++ +K+A+  +P SP+  N         +           + ++  V   I+  D     LT  +  P GK +   +    +    +S+ P   G + I +   G +I  SP+   V     GDASK    V + G G++    N    E    TVD + AG G ++ +++ P+  E+  +  +N DGT  + YT  EPG Y+I I++  +H+  SPF V  T +P A             D T+   Q  L L +P T    ++   V    G T    I D  DG  +++F P E GLH + +++   HIPGSP QF V  + + G   V A G GL  G  + P  F++ T+ AG GGLS+A+EGPSKAEI  +D KDG+C V Y  T PG+Y   +KF++ HI  SPF   +             GD++L + +  +G  A  ++   +T        L A+I  PS  EEP +++ +      + F PKE GEH ++V    + KH+  SPF++++G  +  +   V A G GL+     +   F V+T N+G G L ++I+GPSKV +   + E+G  +  Y P+ PG Y I +K+  + HI GSPFT  ++G       I   +Q+            NLK+      M+++               T++   +  + HG   K+    + +T           +V  S  G D L            GI G       P     +  +   G + + + ++  E G H + VK+  +++PGSPF
Sbjct:   31 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKGVTDLQKDLGDGLKLISLLEVLSQKKMYRKHHVRPNFRQMKLENVSVALEFLD-RERIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDEDDE-EVKKLTPKQRLLGWIQNKVPELPINNFNKDWRDGKALGALVDNCAPGLCPDWQTWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPVKPKQLYPKKAKAYGPGIEPQGNMVLKPAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEAHLKPPGAPKQIPPQKKKASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQ--DAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPG-RYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTK---GAGKAKPEVHF---KTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGKDQE---FIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATCVKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLKGGIVG---QPAKFSIDTKGAGAGGLGLTL------EGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVAS----FTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVKIRIIN-------PSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFK-------VSVVEGCDPTRVRAYGPGLEGGIVNKPN-CFTVETR-----GAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSHDASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASIHDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYN--VQAFPTGDASKCLLTVSIGGHGVESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVA-----------PRDDTKPMFQ-PLNLVIPFTVQQGELSGEVRMPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVD-VTNSGM--VTAYGPGLCHGTVNKPASFTVVTKNAGQGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTTPGDYNIIVKFDNSHIPGSPFTAKIT------------GDDSLRRSQLNVGTAADVSLKITETDL----SYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRK--SGKHVNNSPFKIMVGPSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVEDGTCKVTYCPTEPGNYIINIKF-ADKHIPGSPFTVKVTGEGRMKQSITRKRQAASIASVGSTCDLNLKIPGNWFQMLSAQERLTRTFTRSSHTYTRTERTEISKTHGGETKREVHVEESTQVGGGGGDPFRDVFESFLGRDRLGSFGTIRQEGETGIQGMTAQVTSPGGNLADAEIVDSGNSTYRVRFVPTEMGSHTVNVKYRGEHVPGSPF 2295          

HSP 3 Score: 492.271 bits (1266), Expect = 4.044e-140
Identity = 521/1957 (26.62%), Postives = 828/1957 (42.31%), Query Frame = 3
Query: 1161 PSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPR-SNAKLVTVSGRGIQSNGIRVGDKAEFF-IDTQNAGNGKLNVKLLSPEKSEESVKIAEINP--NYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-------------LPTKTSHIA------AFGPGLT-TGV-VGKAAIFVTDTNGE-LGSLGFSIEGPS--EAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSG-NEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSN---PNNVRVIGEGLH--SATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPV-YNCSIRYDGVNIPGSPFTIQIKP--EIDISKVFVENLQTTIFQESF-IRFVVNAKAIDAKGKGTVK-AIFTDPSSFKSGS------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQG----NLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFG--EPLTPGSINRVDQPITFTVDASRAG-EAPLKACCKDNQGHEYPLEI---KSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPI-SLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGS------TSDVP----LKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKC-GISNEMN-SFTVDTREAGYGGLSLSI---EG-PSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI--TGEPSAKLMEKIICQQEAADI---TQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQF--TVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQ---LYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKS---QCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P K K  GPGIE  G +V     F + T +AG GE+   V  P G  ++       +   ++ V Y  +  G H + +  +   I  SPF V V+    +   V   G G++  G  V  K  +F I T  AG G ++V ++ P+    +V++   N   N F C Y P   G + + + +   P+  SPFK+N+             +P +    +      A G GL   GV V + A F   T G   G L  S++GP   E  ++ CD  DG     Y P  PG+Y V+I   G+ IP SP+   +   +++    K++ +GPG++   V  ++  +F ++ I  +         F+  G ++  +     G+      Y P   G++ V V CD++ +  SPF   +   +N   P  V+  G GL     T      F++D   AG G L +   D  G ++   +++  D   F   Y P  + PV +   I +  VNIP SPF + +      D  KV+   ++ T  + +    F V+       G+G V   I   P             ++K++ D +++  Y+P   G Y + V + D  I +SPF ++V P  D  KV   G G+   G     P  FTI   GAG+     +   A +G +       DN D + TV+Y++   G   I +      +  SPFK+ +   ++   VK  G  E +  G     DQ   F V+   AG +  +        G   P ++   K++E T      + ++P E G + ++I +    VP +PF    L  ++P KV+  G G+   GG +    P +F ID   AG     L L+         +  D G G     Y PT+AG + I + + ++ +   PF   V    DA K        E          T++ + AGE +++  IV         S     V I+NN +GT S+ Y+P     + + IK+GG  +P      K     +     +     + +    R  TT +      V+ R    + G  +V+  +  PSG    A + D  +G+  + Y   E G+H + V  D + +  SP+K    E     +V AYGPGL  G    P  FT+ T+ AG  GL L IEG S+A+++CKDN++GSC V Y P   GDY I I +    IPGSPF   +          C G       T+ VP    +  +   ++ L   +  P G  E  ++K   +    +++TP + G H ++V  +   +  SP+K+    +   DASKVR  G GL   G++  +   FT+D R+AG G L++ I   EG P KA I   DN DGT  VSY P   G Y I IKY  +++  SP+ V+   TG+ S  L+   I       +    Q+  +  +T+         +  TV    G     ++ +  DG + I +   E G + + ++    HIP SPFQ   T  P+      K +     L +  T    E S   R          +     A     D KDG+  V++  TE G +   IK++ +HI  SP +  V+      ++    G        T+ KPA+FTV     T     G L   + GPS+ E     ++ +     + ++P   G++  N+  +  N HIPGSPF   I     D  +  ++ +      VG      +    +    L  +I  PS  +   L  +         + P   GE++++V+  G  H+  SPF                            K MV   P++   A +V+  G G+ +A   +V  F VD   AG   L + I GP      C++V           + Y   E G + + +K+ +K+IPGSPF V V
Sbjct:  282 PKKAKAYGPGIEPQGNMVLKPAVFTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEG-NVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVEVILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEAHLKPPGAPKQIPPQKKKASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEV---SKEAGTQKVRAWGPGLKTGMVGKSA--DFVVEAIGTEVG----TLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPGLEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGD-GTFVCVYVP--TKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDC---SEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDND-TFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKVDPSHDAGKVRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGK----DQ--EFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATC-----VKYIPPEEGHYKVDITYDGNPVPESPFSVEGLMPADPSKVRAYGPGLK--GGIV--GQPAKFSIDTKGAGA--GGLGLTLEGPCEAKIECQDNGDGTCSVVYLPTEAGDYNINILYGEAHIPGSPFKAVVKPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVS-------DSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQQVPKSPIHVKVEPSVDTSGIKVYGPGVEPK-GVLREVTTHFI-----VDARAHAKTKGGNHVKIRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVVEGCDPTRVRAYGPGLEGGIVNKPNCFTVETRGAGTAGLGLTIEGASEAKMLCKDNKDGSCSVEYMPFTAGDYDINIAYGGQPIPGSPFRVQVKDVVDVSKVKCSGPGLANKVTAHVPQTFTVDCSKAGVAPLEVQLYGPKGTLEPVVVKNNRDGTHTVNYTPAQEGPHTVSVKYANQEVPSSPYKVNSAPSH--DASKVRASGPGLDTTGVAASLPVEFTIDARDAGKGLLTVQILDPEGKPKKASI--HDNRDGTYTVSYVPDMTGRYTITIKYGGDNIPYSPYNVQAFPTGDASKCLLTVSIGGHGVESLGPNIQMSEETVITVDAKAAGKGKVTCTVQTPNGMELDMDVTENPDGTFDIYYTAPEPGKYVITIRFGGQHIPKSPFQVMATDQPVAPRDDTKPMFQPLNLVIPFTVQQGELSGEVR----------MPSGKTARPFIRDNKDGTVTVQFQPTEKGLHEMDIKYDGNHIPGSPLQFYVDVTNSGMVTAYGPG----LCHGTVNKPASFTV----VTKNAGQGGLSLAVEGPSKAE--ISCKDNKDGTCTVSYLPTTPGDY--NIIVKFDNSHIPGSPFTAKI---TGDDSLRRSQLN------VGTAADVSLKITETDLSYLTASIKAPSGKEEPCLLKRLPNRHIGLSFTPKEVGEHEVSVRKSGK-HVNNSPF----------------------------KIMVG--PSEIGEASRVKAFGKGLVEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDINCDDVE-----DGTCKVTYCPTEPGNYIINIKFADKHIPGSPFTVKV 2120          

HSP 4 Score: 306.605 bits (784), Expect = 5.954e-83
Identity = 336/1176 (28.57%), Postives = 520/1176 (44.22%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKS-EPDKVKVIGEGVAPTGGF-LTPSVPVQFHIDVSEAGQGDI--QXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQ-VGDANKCFIED-GVK-EYXXXXXXXXXXXXXXXAGEGKISCRIV-PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLP-------ISLGAQNVEAIVST--PSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-----PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKE------ESCILKKMPNDNLGISF----TPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIE------GPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELT------LKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPS----KAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQM--DFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIK-KATLNQVNT-FNVDA-----SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            L PGAP    + PK   P K K  G G+ P G   L P+V   F ++  EAG G++   +               ++ K  F   Y P   G+H + V F    +   PF+V V + +GD NK      G++ E  + +  T   I T  AG G +S  IV P  +N  V+      V +EN G+      Y P     + + + F G  IP+  FK    + +  P    +    + + AS  N       G+ P   R+         + GA   E  VS   P G+     V D  +G     Y P + G + +N+T  G  I  SP++   ++ AG  KV A+GPGL  G  G  A+F +       G L  +IEGPS+A+I C D  +GSCDV Y+P  PGDY++ +   D +I  SPF+A+I+       P++      G      + +N     T+ A      G +      E C++     D    +F     P +   H I +     +I  SPF+++VG+    D  KV+V+G G+ K G+ +NE   FTVD  EAG G +S+ I+      GP++A+I+     N + T  V YTP  PG Y I + +A++ +  SPF VK+  +PS    +    + E   I + G Q E+        K  G    ++           +  EIID  D  Y++K+     G   +VV H    IP SPF+ TV P +D G  KV      +++G      EF + T+ AG  G ++++I  PS      +++ +  K+ +C VKY   E G Y   I ++ + +  SPF +   E  M  D   V + G     K   +G+PA F+++    T     G L  T+ GP   E     Q+      ++ ++P E+G++ IN+       HIPGSPF+ V+ +   D G V A G GL     G+   F V+   +G   L + I  D  ++ ++  Q N++G +   Y P   G + IT+KYGG   +  SP                +H +    VDT G                ++ +G G++ K  L +V T F VDA     ++ GN +  + I  P     +  +   G   + + Y   E G H + V + E  +P SPF V V+
Sbjct:  269 LKPGAP----VKPKQLYPKKAKAYGPGIEPQGNMVLKPAV---FTVETLEAGLGEVIVYVEDPEGHTEEAKVVANNDKKRTFSVTYVPKVEGRHKVKVLFAGQDIDKSPFMVNVAKALGDPNKVQARGPGLEPEGNVAHKPTYFDIYTAGAGAGDVSVVIVDPQNKNNTVE------VILENKGDNIFRCTYKPVLEGPHTIHVTFAGQPIPSSPFKVNISEAHLKPPGAPKQIPPQKKKASNANACRATGRGLQPKGVRVKEVADFTVFTKGAGTGELKVSVKGPGGVEVPVKVCDVGDGVFKCDYCPVKPGKYTVNITWGGQPIPRSPFEVEVSKEAGTQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKAFGPG-LEPTGVTVNKSTQFTVDAREAGKGGLKIYAQDAEGCVIDIQITDKGDGTFVCVYVPTKPVKHTIIITWGEVNIPKSPFRVLVGEGCHPD--KVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVVFADQEIPSSPFKVKV--DPSHDAGK---VRAEGPGINKTGVQVEIPTHFTIFTKGAGKAKPEVHFKTAAKGNAVKDFEIIDNHDYSYTVKYTALHQGEMAIVVTHGGDPIPKSPFKITVAPSLDLGKVKVQGLNEKVEVGKD---QEFIVNTKGAGGQGKVNVSITSPSGRPIPCKLESDKTKEATC-VKYIPPEEGHYKVDITYDGNPVPESPFSV---EGLMPADPSKVRAYGPG--LKGGIVGQPAKFSID----TKGAGAGGLGLTLEGPC--EAKIECQDNGDGTCSVVYLPTEAGDYNINIL--YGEAHIPGSPFKAVV-KPALDAGKVTASGPGLERAKAGEVASFTVDCSRAGEAELTIEIVSDSGAQAEVCIQNNKDGTFSVTYTPLFHGVHTITIKYGGQ-QVPKSP----------------IHVKVEPSVDTSG----------------IKVYGPGVEPKGVLREVTTHFIVDARAHAKTKGGNHVK-IRIINPSGANTDAYITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFKVSVV 1371          
BLAST of Filamin vs. Ensembl Xenopus
Match: coq2 (coenzyme Q2 4-hydroxybenzoate polyprenyltransferase [Source:Xenbase;Acc:XB-GENE-967037])

HSP 1 Score: 1370.53 bits (3546), Expect = 0.000e+0
Identity = 810/2014 (40.22%), Postives = 1165/2014 (57.85%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSG----DKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQDGSA---TICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXX---------XXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH--ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVT------SMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P ++K  P KV+ YG G+E    I    AEFT+DA +AG   L I   D  G  ID+KI++  D  N Y C Y P     +TI + +   +IP SP++V++ + S  P+KVKV GPG+E+ G+  +  TYF +   +AG G++S  +    G     +  I+  I +    ++ V+YT    G ++I +  +  +I  SPF V V P  +A  V   G G+   G+ VG    F + T+ AG  KL+V+     K E +V+  EI  N+   +   Y   + G   + + Y   P+ +SPF +NV P    S +     GL   V VGK   F  DT+G    G +   I  PS   I C      ++   T+ Y P   G Y V I  DG  +P SP+ +  +MP     D SK++ YGPG++  G  +  P  F ID     +          C   E  +     G+      Y P   G + + +      +P SPFK  +    +P+ V   G GL        A F++D + AG   L +EI  + G+     + N++D   + + Y P   G  Y  +I+Y G  +P  P  + ++P +D S  KVF   ++   + +E    F V+A+++   G   V      PS   + S +  NGDG+Y   Y+ Y+ G ++++V Y+D+P+  SPF + V  GCDPS+V  +G GLEGG  N+ N FT++  GAG G LGLAIEGPS+AK++C DN DG+C+VEY    PG YD+ I F    + GSPF++P+++ ++ + VKC G  L  GS  R   P TFTVD S+AG APL+   +   G   P++I+   +   G + + + P   GP+ + +++A+  VP +PF   +LP  +  KV+  G G+   G  +  S+PV+F ID  +AG+G + + + +P+      +I   G G +   Y P  AG++ IT+ +    +   PF +  +  GDA+KC +   +  + L            ET+IT++   AG+GK++C++              L V++  N +GT  IYY+  E  +Y++ I+FGG  IPN  F         +   +       ++      E  D    + P    +P ++    +   V  PSG      + DN +G+VT+++ P E+G+HEM++  DG  I GSP +F+ +      V+AYGPGLSHG    PA FTIVTKDAG GGLSLA+EGPSKAEI CKDN++G+C V+Y P  PGDY+II++F D +IPGSPF + I G+   R SQ+ +G+++DV LKI   D+S LTAS+RAPSG EE C+LK++PN ++GISFTP+EVG H ++V ++G H+  SPFKI+VG +EIGDASKV+V G+GL  G++ E+  F VDTR AGYGGL LSIEGPSK +I C D  DGTC+VSY P+EPGTY+INIK+A +HV GSPF VK+TGE   ++ E I  +++A  I  +GS C+L LK+P     +M A VT+  G T   EIID +D  YS++F+P+EMG HTV V++R  H+PGSPFQFTVGP+ +GGAHKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGSCGV Y V E G+Y  SIKFND+HI +SPF + V  +  D   ++V S+ +  +     + +PA+F V   Q    R  G + A +  PS   E   +  ++ ++Y+IRFIP+E+G H I+V  +   +HIPGSPF++ +G+Q    DPG+V A G GL  G  G+ + FIV+TLN+G G L+VTIDGPSKV+L  Q++ EGY+  Y P APG Y I++KYGG  HI GSPF A ++G V  S    +H+ S + V+TV KS  +      + P  SS A KV   G G+ KA + Q NTF VD S+AG ++L VG+ GPK+ CEEV VKHMG   + + Y V++KG + L+VKWG++N+PGSPF V V
Sbjct:  641 PASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIKDNGD--NTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGS-HPNKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGE-AVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKV--QGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPP----DSSKVRAYGPGLK--GGFVGKPAPFAIDTKGAGTGGLGLTVEGPC---EAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSD-GTYSITYIPACPG-AYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGL--GSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGD---GTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAG--IPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKV-------STPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKIFLSFHPIQATEEPVVPVENLDTM--LRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGE--GRMKESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVASRSDDARRLTVTSLQETGI----IVNQPASFAV---QLNGAR--GVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDV--KFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEGYKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARVTG-VRLSGGHSLHETSTVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKGDYILIVKWGDQNVPGSPFQVAV 2607          

HSP 2 Score: 1119.38 bits (2894), Expect = 0.000e+0
Identity = 762/2285 (33.35%), Postives = 1141/2285 (49.93%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSK-LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEK-SEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDC-IEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSM----VKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGF-TNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINC---TDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDAN--KCF---IEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSK-AEIV-CKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVP------LKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASK----VRVFGEGLKCGIS-----NEMNSFTVDTREAGYGGLSLSIEGPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKI----ICQQEAADITQVGSQCE-LTLKVPGT-HHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNAL-AKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIG-QQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I DLQ D SDG++L+ L+EVLS+ K +   + R NFR  KLENV++ L FL+ +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+WE ED +    KQTPKQR++ WI  ++P+  + N   DW DG A+GALVD+CAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+ SK L+P K   YGPGIE    +  + A FTV+  +AG G + + + D  G   + K+    DK   Y  +Y P   G + +TV +A ++I +SPF V +    GD +KV  +GPG+E  G + +  TYF I T  AG+G++  +++ P   +D +   +  +    YR  Y     G H + I  + +QI   P+ V +S   N      +GRG+Q  G+RV + A+F + T+ A    L   L    K +EE VKI +     +EC Y P  PG Y + I +    + RSPF++ V P      + A+GPGL TG+VGK+A FV +  G E+G+LGFSIEGPS+AKIEC D  DGS  + YWPT PGEYAVH++CD EDI +SP++A+I+P++ K    K+K YG G++  G  +  P EFTID      +++K  A      G+ I + I   G+  Y CVY P     H + ++    ++P SP++V V + S+PN V+V G G+         P YF++D + AG G++++ I    G + P     D      D+D F V Y P  +G  Y   + +    IP SPF +++ P  D SKV  E     +T +       F V       KG G  K       S K  ++    +  N D SY+  Y+    GT  + VTY   PI  SPFN+ V P  D SKV V  +GL       +   F+ID  GA GQG + + I  PS   I C   T       TV+Y     G Y + I ++   V GSPF +    P +++ V+ +G  L  G + +   P  F +D   AG   L          E P E K   ++   G   ++++PTE G ++I I  A   +PG+PF  +I P  +P KV   G G+     G   T      F +D S+AG  ++ + + +         I +   G +   Y P   G + IT+ +    V   P  V V    D +  K F   +E       +    T+   + T+ G   ++ RI  L  +G V  +      + +NG+GT  + Y+  E   +L+++ +  V +P   F+    +  +               +  R        G+     R  +         +     G  E+ +   DN +GS ++ Y P   G +++N+T  G  I GSP++    E     KV   GPGL  G R  +P  FT+    AG   L + ++GPS  AE V  +DN +G+  V Y P   G Y++ +++AD  +P SPF   ++           G   +T+ +P        I+  D     LT  +  P GK +   ++   +    +S+ P   G + I +   G  I  SPF+I       GDASK    V + G GL   +       E    TVD + AG G ++  +  P  AE++    +N DGT  + YT  EPG Y+I I++  EH+  SPF V ++ +   K+          ++    +  + +      L +P T    ++   V    G T    I D  DG  ++KF P E GLH + +++   HIPGSP QF V  I    +  V A G GL  G  + P  F+I T++AG GGLS+A+EGPSKAEI  +D KDG+C V Y  T PG+Y   ++F+D HI  SPF   +             GD+++   +  +G     ++   ++        L A+I  PS  EEP +++ +      I F PKE GEH+++V      KH+  SPF++++G  +  D   V   G GL+ G   +   FIV+T N+G G L ++I+GPSKV +  ++ E+G  +  Y P+ PG Y I +K+    H+ GSPF   ++G            +  +K                S+ ++ Q   +    A++      N+   +AG   +   +  P  Q  +  +     N + + ++ QE G H + VK+  +++PGSPF
Sbjct:    4 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCMNKRIGDLQKDLSDGLKLIGLLEVLSQKKMYRKYHSRPNFRQMKLENVSVALEFLD-REHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDEE-DAKKQTPKQRLLGWIQNKIPQLPITNFHRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRSKQLHPKKANAYGPGIEPHGNMVLKPAYFTVETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNINKSPFNVNVAMALGDANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEACNPNACRATGRGLQPKGVRVKEVADFKVFTKGAEVENLKSLLKGQVKGTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQ--DAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSHPNKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGK-YTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVY-----TKGAGKAKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKV--QGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGK---PAPFAIDTKGAGTGGLGLTV------EGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVAT------FTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRI--LGPSGAVTESF-----LSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDP--------------SRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRI--HAVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKIFLSFHPIQATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAI---NSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKIT------------GDDSMRTSQLNVGTSTDVSLKITESDL----SLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKK--NGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYCPTEPGTYIINIKF-AEKHVPGSPFMVKVTG------------EGRMK---------------ESITRRRQAPSI----ASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPF 2185          

HSP 3 Score: 367.081 bits (941), Expect = 3.186e-101
Identity = 410/1566 (26.18%), Postives = 673/1566 (42.98%), Query Frame = 3
Query: 2283 PKSPFKVKVAQPSNPNNVRVIGEGL--HSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPF-TLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEI-DISKVF-----VENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGS--MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGP---SDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDA----------SRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE---PDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GV-KEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEV-KSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL----VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGA-GGLSLAIEGPSKAEIVCKDNENGSCD---VTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQIC---------IGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSI--EGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAK------LMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDG-GAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSD----GKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKK--NHFIVNTLNSGTGPLNVTI---DGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGI---KKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P +P + K   P   N     G G+  H      PAYF+++T NAG G + V + D  G+      + N+  +  + V Y P  +G ++  ++ + G NI  SPF + +   + D +KV      +E +     + ++   +  A A    G G V  I  DP + +     +++  GD  Y C+Y P   G + + +T+    I   P+ + +   C+P+     G GL+  G    +   F +   GA   NL   ++G    ++  +   D  DG    +Y   +PG Y + I +    +  SPF++ +   +    V+ +G  L  G + +      F V+A          S  G +  K  C D++G               G  D+ + PTE G +A+ +   +  +  +PF+ +ILP S    P+KVK  G+G+ PTG  +    P +F ID   AG  ++++   + +   +   I D G   + C Y PT   KH I + +    + N P+ V V +    NK  +   GV K  +  N  T  T++ +EAG+G +S  I      G V  +   +  +I  N N T ++ Y+P    +Y + + F    IP   F+ K    ++         K +++         +      P  F +  + GA   +  V     I+  A+    + DN++ S T++Y   ++G   ++VT  G  I  SP+    A    L KV   G   +    G   EF+I T  AG  G + + I  PS+  I CK     + D   V Y P   G Y + I +  H +PGSPF    +  P                +G  +   +         L  +V  P   +  C  +   + +  +S+ P E G + IN+  + +HI GSPFK  +    + D SKV   G GL+ G + E+ +FTVD  +AG   L++ I  +  SKAE+  ++N DGT  ++Y P+ PG Y I IKY    V    F V++  EP+            +  +    ++T   +    +L   G  H   R  +    G      + D  DG Y +++   E G+H + V + ++ +P SPF+    P+ +G    +V A G GL+ G  +  N F++ TR AG GGL +AIEGPS+A++  +D KDGSC V+Y    PG+Y  +I F    I  SPFR+ V E          + D +  K    G  +    + PQT T+         L   + GPS   EP  I++     + + + P   G + ++V     ++ +P SPF++ +   H D   V A G GL +  +       F ++  ++G G L V I   +G  K        +  Y   Y+P   G Y IT+KYGG+  I  SPF               +H            ++ T   ++  V   +  HGLG        + +     VDA  AG   +   ++ P     +V V       F I Y   E G++ + +++G ++IP SPF V V
Sbjct:  244 PGAPLRSKQLHPKKAN---AYGPGIEPHGNMVLKPAYFTVETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAG-LHKVTVLFAGQNINKSPFNVNVAMALGDANKVTARGPGLEPVGNVANKPTYFD-IYTAGA----GSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEACNPNACRATGRGLQPKGVRVKEVADFKVFTKGAEVENLKSLLKGQVKGTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMVGKSAD---FVVEAIGTEVGTLGFSIEGPSQAKIEC-DDKGD--------------GSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIV--EHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSHPNKVKVYGPGVEKTGLKANEPTYFTVDCSEAGQGDVSIGI--KCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDAS-------KVRAEGPGLNRTGVEVGK---PTHFTV-YTKGAGKAKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKVQGLN-NKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIEC--QDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADI--RPVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVP--KFPVRVNVEPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTR--ILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRV---PVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKE----------IVDPSKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSV--RYADQEVPRSPFKIKVLPTH-DASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGD-EIPYSPFR--------------IH------------AVPTGDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVV 1715          

HSP 4 Score: 328.176 bits (840), Expect = 2.489e-89
Identity = 290/995 (29.15%), Postives = 450/995 (45.23%), Query Frame = 3
Query:  831 PGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSK----VKVKGPGIEQ---NGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSN--------GIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIF--VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKP-EASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKV--AQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCD--PSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRA-GEAPLKACCKDNQGHE-YPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEP-DKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAF 3728
            P +P   K+ P    +KVR  GPG+ +  + A    EFT+DA  AG G L + I D  GK     I    D    Y  +Y P   G YTIT++Y   +IP SPF++    T GD SK    V + G G+       + +   T   +  + AG G+++C V +P G +  ++  + +    ++ + YTA E G + I I      I NSPF V+VS +   K+  +S   IQ+          +    +    +       G++  ++  P        I +         + P + G++E+ I YD   +  SP +  V    + H++A+GPGL+ G+V K A F  VT   GE G L  ++EGPS+A+I C DN+DG+ T+ Y PTAPG+Y + +  D + IP SP+ + I   ++    S++ V        G + +   + T      +SD+    AS    SGNE P ++    N+     + P   G H V V  + + V  SPFK+ V  ++  + + V+V G+GL     +  A F +DT NAG+G L + I    G         D +     V Y P   G  Y  +I++   ++PGSPF +++  E  + +      Q            +N K  +A G   + A  T PS   + + +    D +YS  + P + G + + V Y    +  SPF   V P  +    KV   G GLE G    P  F+I    AG G L +A+EGPS A+I   D  DG+C V Y     G Y++ IKFND  +  SPF +P+    + A           G I  V+QP +F V  + A G    K         E Y  E+ S +      Y I F+P E G H+I++K     +PG+PF   +  +S+  D   V   G+   GG      P +F +    AG G + +++  P  + L      EG   +   YTP   G + I++ +
Sbjct: 1506 PRSPFKIKVLPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGD--GTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPT-GDASKCLVTVSIGGHGLGTCLGPSIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVD--VVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKIF-LSFHPIQATEEPVVPVENLDTMLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGE-GGLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKIT-GDDSMRTSQLNV--------GTSTDVSLKIT------ESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIE---GPSKVDINCEDMEDGTCKVSYCPTEPG-TYIINIKFAEKHVPGSPFMVKVTGEGRMKESITRRRQAPSIASIGSTCDLNLKIPEA-GAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVASRSDDARRLTVTSLQETGII--VNQPASFAVQLNGARGVIDAKVHTPSGMVEECYVSEVDSDK------YSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVT--GRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEG---YKVSYTPMAPGNYLISIKY 2460          

HSP 5 Score: 323.168 bits (827), Expect = 8.425e-88
Identity = 351/1353 (25.94%), Postives = 564/1353 (41.69%), Query Frame = 3
Query: 2907 PSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTAN-VKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXE-GKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEV-----IQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPL--TENGEVKSNLSLP----VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGM--------YPVEFRLPI-SLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGLSLAIE------GPSKAEI---VCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII-----------GEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLG--ISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAG-YGGLSLSIEGPSKAEIECRDNYDGTCQ---VSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEV-CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAI--EGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVT-DEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQV-NTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P K   +G G+E  G    +P +FT++   AG G + + +E P     +AK+   ++ + T +V Y   + G + + + F   ++N SPF + +   +  AN V   G  L P   N  ++P  F +  + AG   +     D Q H+  +E+   E+    IY  T+ P   GPH + I  A   +P  P++ NI     P+  +  G G+ P G  +       F +    A   +++  L            I + G GV+ C Y P   GK+ +T+ +    +   PF V+V     +Q   A    +E G+                     GK +  +V    TE G +  ++  P    +E ++ G+G+  + Y P E  EY V +      I +  F                     +    F  +   Y  G+        +P EF +   + G   ++       G      + DN + +    Y P +   H + +T  G+ I  SPY+    E +   KV  YGPG+   +TGL    P  FT+   +AG G +S+ I+      GP++A+I   + K N+N +  V Y P   G Y+I++ FAD  IP SPF   +            G    R+ + +G  +   +       + L          E     + + N +    + +T  + G   ++V   G  I  SPF + V      D SKV+V G   K  +  +   F++DT  AG  G + + I  PS+  I C+     T     V Y P E G Y ++I Y    V GSPF+V+    P +    K+           VG      +    T  +        + G  E   E  D  DG  S+ ++P E G +++ +     HIPGSPF+  + P+ D    KV ASG GL+ G       F++   +AG   L+I I  +  SKAE+  ++  DG+  + Y    PG Y  +IK+    +   P R+ V E  +D   V   G     +         FTV+  ++ T      +   I+GPS     + + +     Y +++   E G HLI V  D++    +P SPFRV +  +  DP  V A G GL  G + K N F V T  +GTG L + I+GPS+ ++  ++N++G   + YIP  PG+Y + + +GG   I GSPF   +   V+ S                                KV+C G G+       V  TF VD S+AG   L V + GP    E V ++  G     +NY     G + + V++ ++ +P SPF + VL
Sbjct:  255 PKKANAYGPGIEPHGNMVLKPAYFTVETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNINKSPFNVNVAMALGDANKVTARGPGLEPVG-NVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEV-ILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEACNPNACRATGRGLQPKGVRVKEVA--DFKVFTKGAEVENLKSLLKGQVKGTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMV--------------------GKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHI---------------LPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSVGEGSHPNKVKVYGPGVE--KTGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIK-NDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPL--DLSKVKVQGLNNKVDVGKD-QEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDS---SKVRAYGPGLKGGFVGKPAPFAID---TKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFD--PSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNV-EPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDA-RSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVP---VPKSPFRVPV-TEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGR-PIPGSPFRVPVKEIVDPS--------------------------------KVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVL 1515          

HSP 6 Score: 199.904 bits (507), Expect = 2.317e-50
Identity = 209/809 (25.83%), Postives = 349/809 (43.14%), Query Frame = 3
Query:  624 VDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKV---AQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDG-VNIPGSPFTIQI--------KPEIDISKVFVENLQTTI-----FQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            V +  PGL       KP    I TK+A +     L V    K E     N D    ++Y+   P         + K  PG+P TSK+  +        + +  L  G + + ++    +    L  +I   +G      ++ +P++      ++TP   G + ++V+   K +  SPFK+ +  +  GD SKVKV G G+ + GV    +  FI+ T +AG G +   +  PS  K  IN +  ++   + +V Y   E G + INI  +   +  SPF V V+     K  +++ R    +   +G   +  +    AG  ++  ++ SP       +I +   N +   ++P + G + + + Y    V  SPF+  V P        + A GPGL  GV G  A F +       G L  ++EGPS+A+I   D +DGS  + Y     G+Y V I  + E IP+SP++  +  ++   D  ++ V    +Q+ G+ +N P  F +     +  I  +A   T SG      +S   + KY   + P  +G H + V  + + +P SPFK++V   +Q  +P  V   G GL       P+ F + T NAG G+L+V I+          L      + + V Y P   G  Y  SI+Y G  +I GSPF  ++            + S V VE +  +      +  +  +F  +A  + ++G G  KA     ++F     K+G+                  VK  G+  Y+ +Y+  D G YIL V + D  +  SPF + V
Sbjct: 1827 VSAYGPGLSHGMVN-KPATFTIVTKDAGEGGLS-LAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDD------SMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRH--IGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLE-GVTFEVAE-FIVDTRNAGYGGLGLSIEGPS--KVDINCEDMEDG--TCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGEGRMKE-SITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPV--ASRSDDARRLTVTS--LQETGIIVNQPASFAVQLNGARGVI--DAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDVKFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGP----SKVKLDCQDSPEGYKVSYTPMAPG-NYLISIKYGGPQHIVGSPFKARVTGVRLSGGHSLHETSTVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKGDYILIVKWGDQNVPGSPFQVAV 2607          
BLAST of Filamin vs. Ensembl Xenopus
Match: FLNB (filamin B [Source:NCBI gene;Acc:100485165])

HSP 1 Score: 1341.25 bits (3470), Expect = 0.000e+0
Identity = 769/2006 (38.33%), Postives = 1137/2006 (56.68%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQ---DGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGS-------VNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P +  ++P+KV+ YGPG+E    I    AEF VD   AG+  L I   D  G  +D+  +E PD    Y C+YTP     +T+ V +    +P SPF+V I + S  P  VKV GPG+E+ G+  +  T+F +   +AG G++S    C     S +++ I+  I   +  ++ V+Y     G ++I +  +  +I  SPF + V P  +A  V   G G+  +G+  G  + F + T+ AG   ++V    P   + +VK  EI  NY       Y P + G  ++ +NY   P+ +SPF + V  P   + I   G  L + V VGK   F+ D NG    G L   I  PS   + C       +  +T+ Y P   G Y V +  DG  +P SPY   ++ +    D SK+K YGPG+  EG  +  P EFTID     +          C   E  +  S  G+      Y P T G + V +  +   +P SPF+  V  P +P+ V   G GL            +D + AG GNLAVE   + G+     + ++ D   + V Y P  +G +Y  +++Y G  +P  P  +++ P +D SK+ V      +  +F+E+   F V+AK++   G   VK   T+PS   +  +++ NGDG+Y   Y+P++ G + + VTY+D P+ NSPF + V  GC P +V   G GL    TN+PN F++   GAG G LG+ +EGPS++K++C DN DG+C+VEY+  + G YD+ I ++   + GSPF++P++D ++ + VK  G  L  G+  R   P  FTVD S+AG APL       +G   P+++    +   G + +++ PT  GP+ + +++A+  +P +PF   +LP  +  KV   G G+   G  ++ S+PV F +D   AG G + + +++ +       I D   G +   Y P   G++ + V +    +   P+ +  + +GDA+KC +   G++  +    E    ++ T AG+GK++C I  L  +G     L    ++  N +GT  IYY+  +   Y++ ++FGG  IPN  F                   T      FR           P +  +P ++    +   V  PSG    A + DN +G+V+IRY P E G+HE+ + C+G  I  SP +FF      G V+AYGPGL +G    PA FTI+T+DAG GGL LAIEGPSKAEI C DN++G+C VTY P +PGDY+I++K+ D +I GSPFIA I  + +RRSQ+ +GST+D  L I   D+S L+AS++APSG++E C+LK++PN+++GISF PREVG H +++ ++G HI  SP  I+V Q+EIGDASKV+ FG GL  G + EM+ F VDTREAGYGGLSL++EGPSK +I+  D  DGTCQVSY P+EPG Y+++IK+A+EHV GSPF  K+ GE   ++ E I  +++A  +  VG  CEL LK+P    +++ A V +  G  +  EI+DL      ++F+P+E G+HTV V++R  H+PGSPFQFTVGP+ +GGA KV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGS GV Y V EPG+Y   IKFND+HI  SPF           + + +  D+A     T  + +   VN P +  IR   + GK+ A +  PS   E   +  +E ++YA+RF+P+E+G H+I+V  +    H+PGSPF+V +G+  Q  DPG+V A GDGL +G  GK++ FI+NT  +G G L+VTI+GPSKV +  +E  EGY  +Y P APG Y I VKYGG  HI GSPF A ++G         +++S I V   +    +T      +++P  +S A KV   G G+ KA L Q +TF VD S+AG++IL VG+ GP   CEEVS+KH+G   + ++Y V+E+G + L+VKWGE++IPGSPF + V
Sbjct:  639 PASGDIDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAGKAALKIYSQDVEGNPVDIMTKEKPD--GTYACSYTPAKPIKHTVAVTWGGVSVPNSPFRVNIGQGS-HPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVISDEEEDIDFDIIPNANDTFTVKYMPPAAGRYTIKVLFAGEEIPESPFRIKVDPSHDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAGKAPVDVSFTGPAPGD-AVKDFEIIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRING--LESRVEVGKDQQFIVDPNGAGGQGKLEVKISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVDVSYDGNPVPGSPY---VVEATLPPDPSKVKAYGPGL--EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPC---EAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQANVEMPFDPSKVIATGPGLEHGKVGEAGLIHVDCSQAGPGNLAVEAVSDSGSKAEVNVQDNKD-GTYTVTYVPLFAG-MYTLALKYGGEQVPKFPARVKVDPAVDTSKIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSPFKVGVTEGCYPDRVKAQGAGLTEALTNKPNLFSVITRGAGIGGLGITVEGPSESKMSCKDNKDGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVKDVVDPSKVKISGPGL--GTAVRAKIPQQFTVDTSKAGIAPLAVQVTGPRGTVEPVDLVDNGD---GTHTVSYTPTLEGPYTVAVQYADEEIPRSPFKVKVLPTYDASKVTASGPGLCAQG--ISASLPVNFAVDAKNAGLGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAVKYGGDDIPYSPYRIRAMSIGDASKCTVAGPGIQAAVKTGEEVGFVVDATTAGKGKVTCSI--LGPDG-----LENEADVIENVDGTYDIYYTTAKTGPYVIHVRFGGADIPNSPF-------------------TVMGAPCFR-----------PFDLVIPFAIRTGEITGDVHMPSGKTAPADIVDNKDGTVSIRYVPTETGLHELAIKCNGAHIPESPLQFFVNYPNTGSVSAYGPGLIYGVANKPATFTIITEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPFIAKITDDSRRRSQVKLGSTADFLLDITETDLSLLSASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGRHIPNSPISIMVYQSEIGDASKVKAFGPGLIEGRTYEMSDFIVDTREAGYGGLSLAVEGPSKVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKFADEHVPGSPFTAKVMGE--GRVKESITRRRKAPSVASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTSCVRFVPQETGIHTVSVKYRGEHVPGSPFQFTVGPLGEGGAEKVKAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSSGVSYVVQEPGDYDVIIKFNDEHIPQSPF----------LVPIVATSDDARRLTVTSLQESGLKVNQPASFAIRLNGARGKIDAKVHSPSGAVEECFVTELEPDKYAVRFMPRENGIHMIDV--KFNGSHVPGSPFKVRVGEAGQEGDPGLVTAYGDGLETGTTGKQSEFIINTSKAGPGALSVTIEGPSKVTMECKECPEGYRVLYTPMAPGIYMIGVKYGGPNHIVGSPFKAKVTGQRLVGIGGTSETSSIIVQSVTRASTETT----YSALPRFASDATKVTSKGAGLSKAFLGQKSTFTVDCSKAGSNILLVGVHGPTLPCEEVSIKHLGNKHYTVHYHVKERGDYMLVVKWGEEHIPGSPFHITV 2566          

HSP 2 Score: 1115.14 bits (2883), Expect = 0.000e+0
Identity = 757/2277 (33.25%), Postives = 1150/2277 (50.51%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTD-----HDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFG--EGLEGGFTNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINC-TDNLDGT--CTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV----APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGP--SKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQ--------ICI-GSTSDVPLKI----NNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAK-EWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ + +   ++R  F   +LENV++ L FLE +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+WE E  +     QTPKQR++ WI  ++P+  + N + +W DG A+GALVDSCAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE+IDPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YG G+E    +  ++A FTV+  SAG G + + I D  G   + K+    DK   +   Y P   G + +TV +A + I +SPF+V ++K  GD SKV  KGPG+E  G I +  TYF I T  AG G+I   V+ P G  + +   +  +    YR  Y   + G H++ I         SP+ V +    N      +GRG+Q  G+R+ + A+F +DT+ AG+G L+V +  P+  +E +K +E         Y P  PG Y + I +    + +SPF++ V L      + A+GPGL +G+ GKAA FV ++ G E+GSLGF+IEGPS+AKIEC D  DGS  + YWP  PGEYA+HI+CD EDI NSPYMA I P++   D  K+K YGPG++K G  +++P EF +D  +  K+ +K  +      GN + ++     +  Y C Y P     H V V+    SVP SPF+V + Q S+P+ V+V G G+         P +F++D T AG G+++V I  +   I       D D     +D F V Y P  +G  Y   + + G  IP SPF I++ P  D SKV  E     ++ +       F V  K     GK  V   FT P+    G  VK      N D S++  Y+P   G   + V Y   PI  SPF + V    D +K+ + G    +E G   Q   F +D +GA GQG L + I  PS   + C  + + G    TV+Y     G Y++ + ++   V GSP+ +    P + + VK +G  L  G + +   P  FT+D   AG   L          E P E K    +   G   ++++PT  G + + I      +PG+PF  N+    +P KV   G G+        G +        H+D S+AG G++ +   +        ++ D   G +   Y P  AG + + + +    V   P  V+V    D +K  +   G++E  +    T          +  +  + +  T    VK+ ++ P        + +NG+GT  + Y+P E   + + + +    +PN  FK           E    ++ K+Q A      T+  N ++ V     I+ GA  +  +  T  G  ES +   DN +GS ++ Y P   G +++N+T DG  I GSP++   ++     KV   GPGL    R  +P +FT+ T  AG   L++ + GP  +   +   DN +G+  V+Y P + G Y++ +++AD  IP SPF   ++  P   +         +C  G ++ +P+       N  +  L+  +    GK +   ++   +    +S+ P   G + + V   G  I  SP++I      IGDASK  V G G++  + + E   F VD   AG G ++ SI GP   E E    +N DGT  + YT ++ G Y+I++++    +  SPF V   G P  +  + +I                  ++       ++   V    G T   +I+D  DG  SI+++P E GLH + ++    HIP SP QF V     G    V A G GL  G  + P  F+I T +AG GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +K+ND HI  SPF             +A + D++  + +  +G  A F ++  +T        L A+I  PS  +EP +++ +  N   I FIP+E GEHL+++      +HIP SP  +++ Q    D   V A G GL+ G   + + FIV+T  +G G L++ ++GPSKV + +++ E+G  +  Y P+ PG Y +++K+  + H+ GSPFTA +                      +G+  V    T+   A  V         A++  +   N+   +   + L   +  P  + +E  +  +G+N   + ++ QE G H + VK+  +++PGSPF
Sbjct:    4 TEKDLAQDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFSQMQLENVSVALEFLE-RENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPVWEDEGDE-ETKNQTPKQRLLGWIQNKIPQLPITNFSQNWQDGKALGALVDSCAPGLCPDWESWDPKKPVENAREAMQQADDWLGVPQVIAPEEIIDPNVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGLGVEPTGNMVKRSAPFTVETISAGTGEVLVYIEDPEGNREEAKVTGNNDKNKTFSVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKAQGDASKVTAKGPGLEPIGNIANKPTYFDIYTAGAGVGDIGIEVIDPQGRNNTVELALEDKGNCVYRCTYKPIKAGPHNVAINFGGEATPKSPYLVSIGEACNPNACRANGRGLQPKGVRIRETADFRVDTKAAGSGDLHVSVKGPKGLDEVLKQSESLDGLHLFEYYPLTPGKYVVAITWGGHHIPKSPFEVQVALEAGPQKVRAWGPGLYSGMAGKAADFVVESVGSEVGSLGFAIEGPSQAKIECEDQGDGSCDVRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGDIDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAGKAALKIYSQ--DVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAVTWGGVSVPNSPFRVNIGQGSHPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVISDEEEDIDFDIIPNANDTFTVKYMPPAAG-RYTIKVLFAGEEIPESPFRIKVDPSHDASKVRAEGPGLSKSGVENGKPSHFTVYTK---GAGKAPVDVSFTGPA---PGDAVKDFEIIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRINGLESRVEVGKDQQ---FIVDPNGAGGQGKLEVKISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVDVSYDGNPVPGSPYVVEATLPPDPSKVKAYGPGLEGGLVGK---PAEFTIDTKGAGTGGLGLTV------EGPCEAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQANVEMPFDPSKVIATGPGLEHGKVGEAGLI--------HVDCSQAGPGNLAVEAVSDSGSKAEVNVQDNKDGTYTVTYVPLFAGMYTLALKYGGEQVPKFPARVKVDPAVDTSKIKVFGPGIEEKGVFREATT---------DFTVDAKSLTKTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSPFK-------VGVTEGCYPDRVKAQGAGLTEALTNKPN-LFSV-----ITRGA-GIGGLGITVEGPSESKMSCKDNKDGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVKDVVDPSKVKISGPGLGTAVRAKIPQQFTVDTSKAGIAPLAVQVTGPRGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAVQYADEEIPRSPFKVKVL--PTYDASKVTASGPGLCAQGISASLPVNFAVDAKNAGLGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAVKYGGDDIPYSPYRIRA--MSIGDASKCTVAGPGIQAAVKTGEEVGFVVDATTAGKGKVTCSILGPDGLENEADVIENVDGTYDIYYTTAKTGPYVIHVRFGGADIPNSPFTV--MGAPCFRPFDLVI---------------PFAIRT-----GEITGDVHMPSGKTAPADIVDNKDGTVSIRYVPTETGLHELAIKCNGAHIPESPLQFFVNYPNTG---SVSAYGPGLIYGVANKPATFTIITEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPF-------------IAKITDDSRRRSQVKLGSTADFLLDITETDL----SLLSASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK--NGRHIPNSPISIMVYQSEIGDASKVKAFGPGLIEGRTYEMSDFIVDTREAGYGGLSLAVEGPSKVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKF-ADEHVPGSPFTAKV----------------------MGEGRVKESITRRRKAPSV---------ASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTSCVRFVPQETGIHTVSVKYRGEHVPGSPF 2146          

HSP 3 Score: 265.774 bits (678), Expect = 2.751e-70
Identity = 325/1266 (25.67%), Postives = 524/1266 (41.39%), Query Frame = 3
Query: 3165 PIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNI-LPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKG--VFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKC------FIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIV-PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQ--NVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAG----LGKVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGL---SLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI-IGEPQRRSQICIGSTSDVPLKINNL-------------DIST-LTASVRAPSGKEESCILKKMPN--DNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGISNEMNS-FTVDTREAGYGGLSLSIEGPSKAE----IECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAV-----------KITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKK--NHFIVNT---LNSGTGPLNVTIDGPS--KVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P++  +N    + +G  + P + N V +   FTV+   AG   +    +D +G+    ++ +  N     + + +VP   G H + +  A   +  +PF  N+   + +  KV   G G+ P G     + P  F I  + AG GDI + + +P       ++  E KG  V+ C Y P  AG H + + F        P++V + +  + N C          GV+    +       ++T  AG G +   +  P   +  +K + SL        +G     Y P    +Y+V I +GG  IP   F+ +        +         S  A    +  D+      VE     S+G++  ++   +  PS  +      D  +GS  +RY P+E G + +++ CD   IQ SPY    + A       KV AYGPGL   +TG     PAEF +   DAG   L   S  +EG +  +I+ K+  +G+   +Y P  P  +++ + +   ++P SPF  NI  G      ++         LK N               D+S  +    R  S +EE      +PN  D   + + P   G + I V  +G  I  SPF+I V  +   DASKVR  G GL K G+ N   S FTV T+ AG   + +S  GP+  +     E  DNYD +  V YTP + G   + + Y  + +  SPF V           +I G  S   + K   QQ   D    G Q +L +K+       +   V  + G    C          ++K+IPKE GL+ V V +    +PGSP+   V   +     KV A G GL+ G    P EF+I T+ AG GGL + +EGP +A+I+  D  DG+C V Y  T PGEY  +I F + HI  SPF+  V   +M F     +      +   +G+     V+  Q       G L    V  S ++    +Q+ +   Y + ++P  +G + + +  +   + +P  P RV +     D   +   G G+    V ++    F V+      +G   +   I  PS        ++N +G  ++ Y P   G + I V Y  +  +  SPF   +                                T+     +V+  G G+ +A  N+ N F+V    AG   L + + GP     ++S K        + Y     G + + + +  ++IPGSPF V V
Sbjct:  247 PLKPKLNPKKARAYGLGVEP-TGNMVKRSAPFTVETISAGTGEVLVYIEDPEGNREEAKV-TGNNDKNKTFSVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKAQGDASKVTAKGPGLEPIGNIA--NKPTYFDIYTAGAGVGDIGIEVIDPQGRNNTVELALEDKGNCVYRCTYKPIKAGPHNVAINFGGEATPKSPYLVSIGEACNPNACRANGRGLQPKGVR----IRETADFRVDTKAAGSGDLHVSVKGPKGLDEVLKQSESL--------DGLHLFEYYPLTPGKYVVAITWGGHHIPKSPFEVQVALEAGPQKVRAWGPGLYSGMA---GKAADFV-----VE-----SVGSEVGSLGFAIEGPS--QAKIECEDQGDGSCDVRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGDIDPDKVKAYGPGLE--KTGCIVSTPAEFAVDPTDAGKAALKIYSQDVEG-NPVDIMTKEKPDGTYACSYTPAKPIKHTVAVTWGGVSVPNSPFRVNIGQGSHPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVISDEEEDIDFDIIPNANDTFTVKYMPPAAGRYTIKVLFAGEEIPESPFRIKVDPSH--DASKVRAEGPGLSKSGVENGKPSHFTVYTKGAGKAPVDVSFTGPAPGDAVKDFEIIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRINGLESRVEVGK--DQQFIVDPNGAGGQGKLEVKISSPSRKSVPCLVEPVPGNE--CS---------TVKYIPKEEGLYNVDVSYDGNPVPGSPY--VVEATLPPDPSKVKAYGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQANV---EMPFDPSKVIATGPGLEHGKVGEAGLIHVDCSQA----GPGNLAVEAVSDSGSKAEVNVQDNKDGTYTVTYVPLFAGMYTLAL--KYGGEQVPKFPARVKV-DPAVDTSKIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYD-DEPVPNSPFKVGV--------------------------------TEGCYPDRVKAQGAGLTEALTNKPNLFSVITRGAGIGGLGITVEGPSES--KMSCKDNKDGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPV 1416          

HSP 4 Score: 203.371 bits (516), Expect = 2.551e-51
Identity = 198/762 (25.98%), Postives = 330/762 (43.31%), Query Frame = 3
Query:  771 NVDEKAMMTYLSQFPN-----AKVN----PGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTY----FIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVA---QPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVN-IPGSPFTIQIKPE--------IDISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            N D    +TYL   P       K N     G+P  +K+  +  R          +  G TA+F +D        L  +I   +G+     ++ +P+  N    ++ P   G + ++++   + IP SP  + + ++  GD SKVK  GPG+      +   TY    FI+ T +AG G +S  V  PS    K++ +       + +V Y   E GV+ ++I  +   +  SPF   V      K  +++ R    +   VG   E  +        +L  +++SP   ++  +I ++  N     ++P + G++ + + Y    V  SPF+  V P        + A GPGL  G  G  A F +       G L  ++EGPS+A+I   D +DGS+ + Y    PG+Y V I  + E IP SP++  I+ +++  D  ++ V    +Q+ G+ +N P  F I     +  I  +A   + SG      ++     KY   + P  +G H + V  +   VP SPFKV+V    Q  +P  V   G+GL + T    + F I+T+ AG G L+V I          T+      + + V Y P   G +Y   ++Y G N I GSPF  ++  +         + S + V+++    T     +  RF  +A  + +KG G  KA     S+F     K+GS                  +K  G+  Y+  Y   + G Y+L V + +  I  SPF+I V
Sbjct: 1836 NKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPFIAKITDDSRR-------RSQVKLGSTADFLLDITETDLSLLSASIKAPSGRDEPCLLKRLPN--NHIGISFIPREVGEHLVSIKKNGRHIPNSPISIMVYQSEIGDASKVKAFGPGL------IEGRTYEMSDFIVDTREAGYGGLSLAVEGPS----KVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKFADEHVPGSPFTAKVMGEGRVKE-SITRRRKAPSVASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTSCVRFVPQETGIHTVSVKYRGEHVPGSPFQFTVGPLGEGGAEKVKAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSSGVSYVVQEPGDYDVIIKFNDEHIPQSPFLVPIVATSD--DARRLTVTS--LQESGLKVNQPASFAIRLNGARGKI--DAKVHSPSGAVEECFVTELEPDKYAVRFMPRENGIHMIDVKFNGSHVPGSPFKVRVGEAGQEGDPGLVTAYGDGLETGTTGKQSEFIINTSKAGPGALSVTIEGP----SKVTMECKECPEGYRVLYTPMAPG-IYMIGVKYGGPNHIVGSPFKAKVTGQRLVGIGGTSETSSIIVQSVTRASTETTYSALPRFASDATKVTSKGAGLSKAFLGQKSTFTVDCSKAGSNILLVGVHGPTLPCEEVSIKHLGNKHYTVHYHVKERGDYMLVVKWGEEHIPGSPFHITV 2566          

HSP 5 Score: 191.815 bits (486), Expect = 6.981e-48
Identity = 200/781 (25.61%), Postives = 325/781 (41.61%), Query Frame = 3
Query: 4644 PGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTAS-------VRAPSGKEESCIL--KKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLK--CGISNEMNSFTVDTREAGYGGLSLSIEGP----SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGE---PSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVN--EKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEK--NQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGL-MSGF-VGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI----------YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATL-----NQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL*NMSTTVPFVLN-ITFQFCDTSMQIVRNNSFLL 6866
            PG+P    +  +  R   + +  T ++  +     + T++A        +  P G  E   +      N    + + P+  G H + V  +G HI  SPF++ V + + GDASKV   G GL+    I+N+   F + T  AG G + + +  P    +  E+   D  +   + +Y P + G + + I +  E    SP+ V I GE   P+A        Q +   I +     +  +        D+  +V    G  EV +  +  DG +  ++ P   G + V +     HIP SPF+  V   ++ G  KV A G GL  G      +F + +  +  G L  AIEGPS+A+I+ ED+ DGSC V+Y+  EPGEY   I  +D+ I NSP+  ++      +D   V + G         +  PA F V+          GK    I        P  I   EK    YA  + P +  +H + VT       +P SPFRV IGQ  + P +V   G G+  +G    +  HF V+   +G G ++V I   ++V +  +E +  ++ I          Y+P A G Y I V + G   I  SPF                     +KVD             S  A KV+  G G+ K+ +     +    +   A +A  D+ F G A P    ++  +         + Y   ++G+  + V +G   IP SPF V V        P  LN I     ++ +++ ++  F++
Sbjct:  244 PGAPLKPKLNPKKARAYGLGVEPTGNMVKRSAPFTVETISAGTGEVLVYIEDPEGNREEAKVTGNNDKNKTFSVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKAQ-GDASKVTAKGPGLEPIGNIANKPTYFDIYTAGAGVGDIGIEVIDPQGRNNTVELALEDKGNCVYRCTYKPIKAGPHNVAINFGGEATPKSPYLVSI-GEACNPNACRANGRGLQPKGVRIRET---ADFRVDTKAAGSGDLHVSVKGPKGLDEVLKQSESLDGLHLFEYYPLTPGKYVVAITWGGHHIPKSPFEVQVA--LEAGPQKVRAWGPGLYSGMAGKAADFVVESVGSEVGSLGFAIEGPSQAKIECEDQGDGSCDVRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGDIDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDA------GKAALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAVT--WGGVSVPNSPFRVNIGQG-SHPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSVGIKCDARV-ISDEEEDIDFDIIPNANDTFTVKYMPPAAGRYTIKVLFAGE-EIPESPF--------------------RIKVD------------PSHDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAGKAPVDVSFTGPA-PGDAVKDFEIIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGV------AAPLDLNKIRINGLESRVEVGKDQQFIV 967          
BLAST of Filamin vs. Ensembl Xenopus
Match: FLNB (filamin B [Source:NCBI gene;Acc:100485165])

HSP 1 Score: 1340.87 bits (3469), Expect = 0.000e+0
Identity = 768/2011 (38.19%), Postives = 1142/2011 (56.79%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQ---DGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIE-----DGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGM--YPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGS-------VNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P +  ++P+KV+ YGPG+E    I    AEF VD   AG+  L I   D  G  +D+  +E PD    Y C+YTP     +T+ V +    +P SPF+V I + S  P  VKV GPG+E+ G+  +  T+F +   +AG G++S    C     S +++ I+  I   +  ++ V+Y     G ++I +  +  +I  SPF + V P  +A  V   G G+  +G+  G  + F + T+ AG   ++V    P   + +VK  EI  NY       Y P + G  ++ +NY   P+ +SPF + V  P   + I   G  L    VGK   F+ D NG    G L   I  PS   + C       +  +T+ Y P   G Y V +  DG  +P SPY   ++ +    D SK+K YGPG+  EG  +  P EFTID     +          C   E  +  S  G+      Y P T G + V +  +   +P SPF+  V  P +P+ V   G GL            +D + AG GNLAVE   + G+     + ++ D   + V Y P  +G +Y  +++Y G  +P  P  +++ P +D SK+ V      +  +F+E+   F V+AK++   G   VK   T+PS   +  +++ NGDG+Y   Y+P++ G + + VTY+D P+ NSPF + V  GC P +V   G GL    TN+PN F++   GAG G LG+ +EGPS++K++C DN DG+C+VEY+  + G YD+ I ++   + GSPF++P++D ++ + VK  G  L  G+  R   P  FTVD S+AG APL       +G   P+++    +   G + +++ PT  GP+ + +++A+  +P +PF   +LP  +  KV   G G+   G  ++ S+PV F +D   AG G + + +++ +       I D   G +   Y P   G++ + V +    +   P+ +  + +GDA+KC +       G++  +    E    ++ T AG+GK++C I  L  +G     L    ++  N +GT  IYY+  +   Y++ ++FGG  IPN  F                +  +++ +A   +      NG+   P +  +P ++    +   V  PSG    A + DN +G+V+IRY P E G+HE+ + C+G  I  SP +FF      G V+AYGPGL +G    PA FTI+T+DAG GGL LAIEGPSKAEI C DN++G+C VTY P +PGDY+I++K+ D +I GSPFIA I  + +RRSQ+ +GST+D  L I   D+S L+AS++APSG++E C+LK++PN+++GISF PREVG H +++ ++G HI  SP  I+V Q+EIGDASKV+ FG GL  G + EM+ F VDTREAGYGGLSL++EGPSK +I+  D  DGTCQVSY P+EPG Y+++IK+A+EHV GSPF  K+ GE   ++ E I  +++A  +  VG  CEL LK+P    +++ A V +  G  +  EI+DL      ++F+P+E G+HTV V++R  H+PGSPFQFTVGP+ +GGA KV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGS GV Y V EPG+Y   IKFND+HI  SPF           + + +  D+A     T  + +   VN P +  IR   + GK+ A +  PS   E   +  +E ++YA+RF+P+E+G H+I+V  +    H+PGSPF+V +G+  Q  DPG+V A GDGL +G  GK++ FI+NT  +G G L+VTI+GPSKV +  +E  EGY  +Y P APG Y I VKYGG  HI GSPF A ++G         +++S I V   +    +T      +++P  +S A KV   G G+ KA L Q +TF VD S+AG++IL VG+ GP   CEEVS+KH+G   + ++Y V+E+G + L+VKWGE++IPGSPF + V
Sbjct:  645 PASGDIDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAGKAALKIYSQDVEGNPVDIMTKEKPD--GTYACSYTPAKPIKHTVAVTWGGVSVPNSPFRVNIGQGS-HPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVISDEEEDIDFDIIPNANDTFTVKYMPPAAGRYTIKVLFAGEEIPESPFRIKVDPSHDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAGKAPVDVSFTGPAPGD-AVKDFEIIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRING--LERVEVGKDQQFIVDPNGAGGQGKLEVKISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVDVSYDGNPVPGSPY---VVEATLPPDPSKVKAYGPGL--EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPC---EAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQANVEMPFDPSKVIATGPGLEHGKVGEAGLIHVDCSQAGPGNLAVEAVSDSGSKAEVNVQDNKD-GTYTVTYVPLFAG-MYTLALKYGGEQVPKFPARVKVDPAVDTSKIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSPFKVGVTEGCYPDRVKAQGAGLTEALTNKPNLFSVITRGAGIGGLGITVEGPSESKMSCKDNKDGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVKDVVDPSKVKISGPGL--GTAVRAKIPQQFTVDTSKAGIAPLAVQVTGPRGTVEPVDLVDNGD---GTHTVSYTPTLEGPYTVAVQYADEEIPRSPFKVKVLPTYDASKVTASGPGLCAQG--ISASLPVNFAVDAKNAGLGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAVKYGGDDIPYSPYRIRAMSIGDASKCTVTVQYGGPGIQAAVKTGEEVGFVVDATTAGKGKVTCSI--LGPDG-----LENEADVIENVDGTYDIYYTTAKTGPYVIHVRFGGADIPNSPF---------------TVMVSETDYAQVGS-----MNGLSFRPFDLVIPFAIRTGEITGDVHMPSGKTAPADIVDNKDGTVSIRYVPTETGLHELAIKCNGAHIPESPLQFFVNYPNTGSVSAYGPGLIYGVANKPATFTIITEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPFIAKITDDSRRRSQVKLGSTADFLLDITETDLSLLSASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGRHIPNSPISIMVYQSEIGDASKVKAFGPGLIEGRTYEMSDFIVDTREAGYGGLSLAVEGPSKVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKFADEHVPGSPFTAKVMGE--GRVKESITRRRKAPSVASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTSCVRFVPQETGIHTVSVKYRGEHVPGSPFQFTVGPLGEGGAEKVKAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSSGVSYVVQEPGDYDVIIKFNDEHIPQSPF----------LVPIVATSDDARRLTVTSLQESGLKVNQPASFAIRLNGARGKIDAKVHSPSGAVEECFVTELEPDKYAVRFMPRENGIHMIDV--KFNGSHVPGSPFKVRVGEAGQEGDPGLVTAYGDGLETGTTGKQSEFIINTSKAGPGALSVTIEGPSKVTMECKECPEGYRVLYTPMAPGIYMIGVKYGGPNHIVGSPFKAKVTGQRLVGIGGTSETSSIIVQSVTRASTETT----YSALPRFASDATKVTSKGAGLSKAFLGQKSTFTVDCSKAGSNILLVGVHGPTLPCEEVSIKHLGNKHYTVHYHVKERGDYMLVVKWGEEHIPGSPFHITV 2587          

HSP 2 Score: 1113.21 bits (2878), Expect = 0.000e+0
Identity = 762/2286 (33.33%), Postives = 1156/2286 (50.57%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTD-----HDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFG-EGLEGGFTNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINC-TDNLDGT--CTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV----APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGP--SKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQ--------ICI-GSTSDVPLKI----NNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASK----VRVFGEGLKCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLK-----VP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAK-EWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ + +   ++R  F   +LENV++ L FLE +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+WE E  +     QTPKQR++ WI  ++P+  + N + +W DG A+GALVDSCAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE+IDPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YG G+E    +  ++A FTV+  SAG G + + I D  G   + K+    DK   +   Y P   G + +TV +A + I +SPF+V ++K  GD SKV  KGPG+E  G I +  TYF I T  AG G+I   V+ P G  + +   +  +    YR  Y   + G H++ I         SP+ V +    N      +GRG+Q  G+R+ + A+F +DT+ AG+G L+V +  P+  +E +K +E         Y P  PG Y + I +    + +SPF++ V L      + A+GPGL +G+ GKAA FV ++ G E+GSLGF+IEGPS+AKIEC D  DGS  + YWP  PGEYA+HI+CD EDI NSPYMA I P++   D  K+K YGPG++K G  +++P EF +D  +  K+ +K  +      GN + ++     +  Y C Y P     H V V+    SVP SPF+V + Q S+P+ V+V G G+         P +F++D T AG G+++V I  +   I       D D     +D F V Y P  +G  Y   + + G  IP SPF I++ P  D SKV  E     ++ +       F V  K     GK  V   FT P+    G  VK      N D S++  Y+P   G   + V Y   PI  SPF + V    D +K+ + G E +E G   Q   F +D +GA GQG L + I  PS   + C  + + G    TV+Y     G Y++ + ++   V GSP+ +    P + + VK +G  L  G + +   P  FT+D   AG   L          E P E K    +   G   ++++PT  G + + I      +PG+PF  N+    +P KV   G G+        G +        H+D S+AG G++ +   +        ++ D   G +   Y P  AG + + + +    V   P  V+V    D +K  +   G++E  +    T          +  +  + +  T    VK+ ++ P        + +NG+GT  + Y+P E   + + + +    +PN  FK           E    ++ K+Q A      T+  N ++ V     I+ GA  +  +  T  G  ES +   DN +GS ++ Y P   G +++N+T DG  I GSP++   ++     KV   GPGL    R  +P +FT+ T  AG   L++ + GP  +   +   DN +G+  V+Y P + G Y++ +++AD  IP SPF   ++  P   +         +C  G ++ +P+       N  +  L+  +    GK +   ++   +    +S+ P   G + + V   G  I  SP++I      IGDASK    V+  G G++  + + E   F VD   AG G ++ SI GP   E E    +N DGT  + YT ++ G Y+I++++    +  SPF V ++                  D  QVGS   L+ +     +P      ++   V    G T   +I+D  DG  SI+++P E GLH + ++    HIP SP QF V     G    V A G GL  G  + P  F+I T +AG GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +K+ND HI  SPF             +A + D++  + +  +G  A F ++  +T        L A+I  PS  +EP +++ +  N   I FIP+E GEHL+++      +HIP SP  +++ Q    D   V A G GL+ G   + + FIV+T  +G G L++ ++GPSKV + +++ E+G  +  Y P+ PG Y +++K+  + H+ GSPFTA +                      +G+  V    T+   A  V         A++  +   N+   +   + L   +  P  + +E  +  +G+N   + ++ QE G H + VK+  +++PGSPF
Sbjct:   12 TEKDLAQDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFSQMQLENVSVALEFLE-RENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPVWEDEGDE-ETKNQTPKQRLLGWIQNKIPQLPITNFSQNWQDGKALGALVDSCAPGLCPDWESWDPKKPVENAREAMQQADDWLGVPQVIAPEEIIDPNVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGLGVEPTGNMVKRSAPFTVETISAGTGEVLVYIEDPEGNREEAKVTGNNDKNKTFSVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKAQGDASKVTAKGPGLEPIGNIANKPTYFDIYT--AGIGDIGIEVIDPQGRNNTVELALEDKGNCVYRCTYKPIKAGPHNVAINFGGEATPKSPYLVSIGEACNPNACRANGRGLQPKGVRIRETADFRVDTKAAGSGDLHVSVKGPKGLDEVLKQSESLDGLHLFEYYPLTPGKYVVAITWGGHHIPKSPFEVQVALEAGPQKVRAWGPGLYSGMAGKAADFVVESVGSEVGSLGFAIEGPSQAKIECEDQGDGSCDVRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGDIDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAGKAALKIYSQ--DVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAVTWGGVSVPNSPFRVNIGQGSHPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVISDEEEDIDFDIIPNANDTFTVKYMPPAAG-RYTIKVLFAGEEIPESPFRIKVDPSHDASKVRAEGPGLSKSGVENGKPSHFTVYTK---GAGKAPVDVSFTGPA---PGDAVKDFEIIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRINGLERVEVGKDQQ---FIVDPNGAGGQGKLEVKISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVDVSYDGNPVPGSPYVVEATLPPDPSKVKAYGPGLEGGLVGK---PAEFTIDTKGAGTGGLGLTV------EGPCEAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQANVEMPFDPSKVIATGPGLEHGKVGEAGLI--------HVDCSQAGPGNLAVEAVSDSGSKAEVNVQDNKDGTYTVTYVPLFAGMYTLALKYGGEQVPKFPARVKVDPAVDTSKIKVFGPGIEEKGVFREATT---------DFTVDAKSLTKTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSPFK-------VGVTEGCYPDRVKAQGAGLTEALTNKPN-LFSV-----ITRGA-GIGGLGITVEGPSESKMSCKDNKDGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVKDVVDPSKVKISGPGLGTAVRAKIPQQFTVDTSKAGIAPLAVQVTGPRGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAVQYADEEIPRSPFKVKVL--PTYDASKVTASGPGLCAQGISASLPVNFAVDAKNAGLGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAVKYGGDDIPYSPYRIRA--MSIGDASKCTVTVQYGGPGIQAAVKTGEEVGFVVDATTAGKGKVTCSILGPDGLENEADVIENVDGTYDIYYTTAKTGPYVIHVRFGGADIPNSPFTVMVS----------------ETDYAQVGSMNGLSFRPFDLVIPFAIRTGEITGDVHMPSGKTAPADIVDNKDGTVSIRYVPTETGLHELAIKCNGAHIPESPLQFFVNYPNTG---SVSAYGPGLIYGVANKPATFTIITEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPF-------------IAKITDDSRRRSQVKLGSTADFLLDITETDL----SLLSASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK--NGRHIPNSPISIMVYQSEIGDASKVKAFGPGLIEGRTYEMSDFIVDTREAGYGGLSLAVEGPSKVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKF-ADEHVPGSPFTAKV----------------------MGEGRVKESITRRRKAPSV---------ASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTSCVRFVPQETGIHTVSVKYRGEHVPGSPF 2167          
BLAST of Filamin vs. Ensembl Xenopus
Match: coq2 (coenzyme Q2 4-hydroxybenzoate polyprenyltransferase [Source:Xenbase;Acc:XB-GENE-967037])

HSP 1 Score: 1338.94 bits (3464), Expect = 0.000e+0
Identity = 802/2005 (40.00%), Postives = 1147/2005 (57.21%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCV--VLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQDGSA---TICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI--EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH--ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVT------SMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P ++K  P KV+ YG G+E    I    AEFT+DA +AG   L I   D  G  ID+KI++  D  N Y C Y P     +TI + +   +IP SP++V+                     G+  S+  +F     D   G I C   V+ P+  +  I+  I +    ++ V+YT    G ++I +  +  +I  SPF V V P  +A  V   G G+   G+ VG    F + T+ AG  KL+V+     K E +V+  EI  N+   +   Y   + G   + + Y   P+ +SPF +NV P    S +     GL   V VGK   F  DT+G    G +   I  PS   I C      ++   T+ Y P   G Y V I  DG  +P SP+ +  +MP     D SK++ YGPG++  G  +  P  F ID     +          C   E  +     G+      Y P   G + + +      +P SPFK  +    +P+ V   G GL        A F++D + AG   L +EI  + G+     + N++D   + + Y P   G  Y  +I+Y G  +P  P  + ++P +D S  KVF   ++   + +E    F V+A+++   G   V      PS   + S +  NGDG+Y   Y+ Y+ G ++++V Y+D+P+  SPF + V  GCDPS+V  +G GLEGG  N+ N FT++  GAG G LGLAIEGPS+AK++C DN DG+C+VEY    PG YD+ I F    + GSPF++P+++ ++ + VKC G  L  GS  R   P TFTVD S+AG APL+   +   G   P++I+   +   G + + + P   GP+ + +++A+  VP +PF   +LP  +  KV+  G G+   G  +  S+PV+F ID  +AG+G + + + +P+      +I   G G +   Y P  AG++ IT+ +    +   PF +  +  GDA+KC +  E  + E      ET+IT++   AG+GK++C++              L V++  N +GT  IYY+  E  +Y++ I+FGG  IPN  F         +         T+       N  T     + P    +P ++    +   V  PSG      + DN +G+VT+++ P E+G+HEM++  DG  I GSP +F+ +      V+AYGPGLSHG    PA FTIVTKDAG GGLSLA+EGPSKAEI CKDN++G+C V+Y P  PGDY+II++F D +IPGSPF + I G+   R SQ+ +G+++DV LKI   D+S LTAS+RAPSG EE C+LK++PN ++GISFTP+EVG H ++V ++G H+  SPFKI+VG +EIGDASKV+V G+GL  G++ E+  F VDTR AGYGGL LSIEGPSK +I C D  DGTC+VSY P+EPGTY+INIK+A +HV GSPF VK+TGE   ++ E I  +++A  I  +GS C+L LK+P     +M A VT+  G T   EIID +D  YS++F+P+EMG HTV V++R  H+PGSPFQFTVGP+ +GGAHKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGSCGV Y V E G+Y  SIKFND+HI +SPF + V  +  D   ++V S+ +  +     + +PA+F V   Q    R  G + A +  PS   E   +  ++ ++Y+IRFIP+E+G H I+V  +   +HIPGSPF++ +G+Q    DPG+V A G GL  G  G+ + FIV+TLN+G G L+VTIDGPSKV+L  Q++ EGY+  Y P APG Y I++KYGG  HI GSPF A ++G V  S    +H+ S + V+TV KS  +      + P  SS A KV   G G+ KA + Q NTF VD S+AG ++L VG+ GPK+ CEEV VKHMG   + + Y V++KG + L+VKWG++N+PGSPF V V
Sbjct:  641 PASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIKDNGD--NTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSYSLI-----------------GLCFSSPLFF----RDVSIG-IKCAPGVVGPA--EADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGE-AVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKV--QGLNNKVDVGKDQEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPP----DSSKVRAYGPGLK--GGFVGKPAPFAIDTKGAGTGGLGLTVEGPC---EAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSD-GTYSITYIPACPG-AYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFRVPVKEIVDPSKVKCSGPGL--GSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGD---GTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAG--IPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAVPTGDASKCLVTGEPAIGE------ETVITVDAKAAGKGKVTCKV-------STPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKSASKAPAATEEPVVPVENLDT----MLRPFNLVIPFTVQKGEITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKITGDDSMRTSQLNVGTSTDVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTFEVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVSYCPTEPGTYIINIKFAEKHVPGSPFMVKVTGE--GRMKESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPVASRSDDARRLTVTSLQETGI----IVNQPASFAV---QLNGAR--GVIDAKVHTPSGMVEECYVSEVDSDKYSIRFIPRENGVHSIDV--KFNGRHIPGSPFKIRVGEQSQAGDPGLVTAYGLGLEGGVTGRPSEFIVSTLNAGAGSLSVTIDGPSKVKLDCQDSPEGYKVSYTPMAPGNYLISIKYGGPQHIVGSPFKARVTG-VRLSGGHSLHETSTVLVETVTKSSASVGGYAMTAPKFSSDASKVVSRGPGLSKAFVGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRLYNVTYTVKDKGDYILIVKWGDQNVPGSPFQVAV 2567          

HSP 2 Score: 1011.52 bits (2614), Expect = 0.000e+0
Identity = 756/2373 (31.86%), Postives = 1125/2373 (47.41%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSK-LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEK-SEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQP----SNPNNVRVIGEGLHSATRYT-PAYFSID----------------TTNAGHGNLAVEINDEIGNILPFTLSNDTDHDI----------------------------------FDVHYQPNTSGPV-----------YNCSIRYDGVN--------------IPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGS-YSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHID---VSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCF-----IEDGVKEYXXXXXXXXXXXXXXXA-------GEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHG--RTGLPAEFTIVTKDAGAGGLSLAI---EG-PSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQIC-------IGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEI-GDASKVRVFGEGLKCGIS---------NEMNSFTVDTREAGYGGLSLSIEGPS--KAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKL------MEKIICQQEA--ADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAE--IDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQ---------------ENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I DLQ D SDG++L+ L+EVLS+ K +   + R NFR  KLENV++ L FL+ +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+WE ED +    KQTPKQR++ WI  ++P+  + N   DW DG A+GALVD+CAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+ SK L+P K   YGPGIE    +  + A FTV+  +AG G + + + D  G   + K+    DK   Y  +Y P   G + +TV +A ++I +SPF V +    GD +KV  +GPG+E  G + +  TYF I T  AG+G++  +++ P   +D +   +  +    YR  Y     G H + I  + +QI   P+ V +S   N      +GRG+Q  G+RV + A+F + T+ A    L   L    K +EE VKI +     +EC Y P  PG Y + I +    + RSPF++ V P      + A+GPGL TG+VGK+A FV +  G E+G+LGFSIEGPS+AKIEC D  DGS  + YWPT PGEYAVH++CD EDI +SP++A+I+P++ K    K+K YG G++  G  +  P EFTID      +++K  A      G+ I + I   G+  Y CVY P     H + ++    ++P SP++V  +      S+P   R +  G+  A     PA   ID                   AG   + V   D+     PF +  D  HD                                    DV +  +  G             Y+ +++Y  V               IP SPF + + P +D+SKV V+ L   +       F ++     A G+G V    T PS       V++      ++  Y P + G Y +D++Y+  P+  SPF++E V   D SKV  +G GL+GGF  +P  F ID  GAG G LGL +EGP +AKI C DN DG+C+V Y  T PG Y I I F +  + GSPFK  IR   + + V   G  L  G    V    TFTVD S+AG+A L      + G +  + I   +N   G Y IT++P   G + I IK+    VP  P   N+ P  +   VKV G GV P G  +   V  +F +D   +++ G   +   +  P   +    + D G G +  QYT  + G H I V ++D PV   PF V V +  D ++       +E G+       T       T           E K+SC+                     +N +G+ S+ Y P    +Y V+I FGG  IP   F+          +E+++  K K       +    +    + V+       G   +E +V  PSG+ E   + DN +G+ T+ Y P   G + ++V     ++  SP+K          KV A GPGL+       LP EFTI  +DAG G L++ I   EG P KA I  + N +G+  V+Y P + G Y+I IK+    IP SPF  + +  P   +  C       IG  + + +         +T  V  P G E    + +  +    I +T  E G + I +   G HI  SPF +VV + E+   ASK     E     +          N +  FTV   E     ++  +  PS   A     DN DGT  V + P E G + ++IKY   H+ GSP    +    S  +      +   +  + A    +T+   +  L+L V G   +++             C+  D  DG  ++ ++P   G + ++V+  + HIPGSPF   +      G   +  S   L +G ++   + S+   E+    L+ +I  PS  E     +   +   G+ +   E GE++ S+K N  H+ NSPF+IMV   ++   S   V    L +  T  + A F V+    T     G L  +I GPS+ +     +++E     + + P E G ++IN+  +   KH+PGSPF            MV   G+G M   + ++           T  LN+ I      ++ +Q                 +  Y   ++P   G + ++VKY G  H+ GSPF                         TVG       P     A KV+  G G+++        F++   +AG   L + + GP     E++ +        ++Y+VQE G + + +K+ +++IP SPF+V V
Sbjct:    4 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCMNKRIGDLQKDLSDGLKLIGLLEVLSQKKMYRKYHSRPNFRQMKLENVSVALEFLD-REHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDEE-DAKKQTPKQRLLGWIQNKIPQLPITNFHRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRSKQLHPKKANAYGPGIEPHGNMVLKPAYFTVETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNINKSPFNVNVAMALGDANKVTARGPGLEPVGNVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEVILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEACNPNACRATGRGLQPKGVRVKEVADFKVFTKGAEVENLKSLLKGQVKGTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHILPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQ--DAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYRVSYSLIGLCFSSPLFFRDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPLDLSKVKVQGLNNKVDVGKDQEFSIDTSG--AGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDSSKVRAYGPGLKGGFVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFDPSKVTASGPGLEKGKAGEV---ATFTVDCSKAGDAELTIEILSDSGSKAEVLI---QNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNVEPAVDTSGVKVFGPGVEPRG--VLREVTTEFTVDARSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVPVPKSPFRVPVTEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCK---------------------DNKDGSCSVEYIPFTPGDYDVNITFGGRPIPGSPFR-------VPVKEIVDPSKVKCSGPGLGSGVRAHVPQTFTVDCS---KAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVLPTHDASKVRASGPGLNTAGIPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANI--RGNGDGTYTVSYVPDMAGRYTITIKYGGDEIPYSPFRIHAV--PTGDASKCLVTGEPAIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENQDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVSKQEVMKSASKAPAATEEPVVPVENLDTMLRPFNLVIPFTVQKGE-----ITGEVRMPSGKTARPNITDNKDGTVTVKFAPVEKGLHEMDIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEI------------TCK--DNKDGTCTVSYMPTAPGDYNIIVRFDDKHIPGSPFTSKI-----TGDDSMRTS--QLNVGTST---DVSLKITESDLSLLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGPSEIGDASKVKVSGKGLLEGVTF-EVAEFIVD----TRNAGYGGLGLSIEGPSKVD--INCEDMEDGTCKVSYCPTEPGTYIINI--KFAEKHVPGSPF------------MVKVTGEGRMKESITRRRQAPSIASIGSTCDLNLKIPEAGAQEMTAQVTSPSGQTADAEIIDGEDNTYSVRFVPQEMGAHTVSVKYRGQ-HVPGSPFQF-----------------------TVG-------PMGEGGAHKVRAGGPGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKA--EITFEDRKDGSCGVSYIVQEAGDYEVSIKFNDEHIPDSPFVVPV 2244          

HSP 3 Score: 298.901 bits (764), Expect = 2.195e-80
Identity = 338/1343 (25.17%), Postives = 549/1343 (40.88%), Query Frame = 3
Query: 2907 PSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTAN-VKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXE-GKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEV-----IQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPL--TENGEVKSNLSLP----VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGM--------YPVEFRLPI-SLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAG-GLSLAIEGPSKAEI---VCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII-----------GEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLG--ISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAG-YGGLSLSIEGPSKAEIECRDNYDGTCQ---VSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEV-CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAI--EGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVT-DEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQV-NTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P K   +G G+E  G    +P +FT++   AG G + + +E P     +AK+   ++ + T +V Y   + G + + + F   ++N SPF + +   +  AN V   G  L P   N  ++P  F +  + AG   +     D Q H+  +E+   E+    IY  T+ P   GPH + I  A   +P  P++ NI     P+  +  G G+ P G  +       F +    A   +++  L            I + G GV+ C Y P   GK+ +T+ +    +   PF V+V     +Q   A    +E G+                     GK +  +V    TE G +  ++  P    +E ++ G+G+  + Y P E  EY V +      I +  F                     +    F  +   Y  G+        +P EF +   + G   ++       G      + DN + +    Y P +   H + +T  G+ I  SPY+                 +S+   GL     +  +D   G   +  + GP++A+I   + K N+N +  V Y P   G Y+I++ FAD  IP SPF   +            G    R+ + +G  +   +       + L          E     + + N +    + +T  + G   ++V   G  I  SPF + V      D SKV+V G   K  +  +   F++DT  AG  G + + I  PS+  I C+     T     V Y P E G Y ++I Y    V GSPF+V+    P +    K+           VG      +    T  +        + G  E   E  D  DG  S+ ++P E G +++ +     HIPGSPF+  + P+ D    KV ASG GL+ G       F++   +AG   L+I I  +  SKAE+  ++  DG+  + Y    PG Y  +IK+    +   P R+ V E  +D   V   G     +         FTV+  ++ T      +   I+GPS     + + +     Y +++   E G HLI V  D++    +P SPFRV +  +  DP  V A G GL  G + K N F V T  +GTG L + I+GPS+ ++  ++N++G   + YIP  PG+Y + + +GG   I GSPF   +   V+ S                                KV+C G G+       V  TF VD S+AG   L V + GP    E V ++  G     +NY     G + + V++ ++ +P SPF + VL
Sbjct:  255 PKKANAYGPGIEPHGNMVLKPAYFTVETINAGLGEVLVFVEDPEGHTEEAKVIPNNDKNRTYSVSYVPKVAGLHKVTVLFAGQNINKSPFNVNVAMALGDANKVTARGPGLEPVG-NVANKPTYFDIYTAGAGSGDVGVIIVDPQNHQDTVEV-ILEDKGDNIYRCTYRPNMEGPHKVFITFAGSQIPKCPYVVNISEACNPNACRATGRGLQPKGVRVKEVA--DFKVFTKGAEVENLKSLLKGQVKGTEEPVKIRDAGDGVYECDYYPVLPGKYTVTITWGGYAIPRSPFEVQVSPEVGLQKVRAWGPGLETGMV--------------------GKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIKDSPFIAHI---------------LPASNKGFPEKVKAYGQGLEPTGCIVEHPAEFTIDARAAGTAELKIYAQDAEGSPIDIKIKDNGDNTYVCVYVPTKPIKHTIIITWGGVNIPNSPYR-----------------VSYSLIGLCFSSPLFFRDVSIGIKCAPGVVGPAEADIDFDIIK-NDNDTFTVKYTPPGAGKYTIMVLFADQEIPTSPFRVKVDPSHDASKVRAEGPGLNRTGVEVGKPTHFTVYTKGAGKAKLDVQFAGSIKGEAVQDFEIIDNHDYSYTVKYTAVQQGTLTVSVTYGGDPIPKSPFNVNVAPPL--DLSKVKVQGLNNKVDVGKD-QEFSIDTSGAGGQGKVDVKITSPSRRPIPCKVETGVTSDIHTVKYMPPEEGPYKVDISYDGHPVPGSPFSVEAVMPPDS---SKVRAYGPGLKGGFVGKPAPFAID---TKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYSINILFAESHIPGSPFKADIRPVFD--PSKVTASGPGLEKGKAGEVATFTVDCSKAGDAELTIEILSDSGSKAEVLIQNNSDGTYSITYIPACPGAYTITIKYGGHAVPKFPVRVNV-EPAVDTSGVKVFGPGVEPRGVLREVTTEFTVDA-RSLTKTGGSHVTTRILGPSGAVTESFLSDNGDGTYHVQYTAYEDGVHLIEVLYDDVP---VPKSPFRVPV-TEGCDPSRVRAYGPGLEGGLLNKSNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGR-PIPGSPFRVPVKEIVDPS--------------------------------KVKCSGPGLGSGVRAHVPQTFTVDCSKAGLAPLEVLVQGPSGLAEPVDIRDNGDGTHTVNYTPATDGPYTVSVRYADQEVPRSPFKIKVL 1490          
BLAST of Filamin vs. Ensembl Xenopus
Match: FLNB (filamin B [Source:NCBI gene;Acc:100485165])

HSP 1 Score: 1335.47 bits (3455), Expect = 0.000e+0
Identity = 777/2040 (38.09%), Postives = 1145/2040 (56.13%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQ---DGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACC------KDNQGHEYPLEIKS--------RENTMPGI-------------YDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYT-----NGM--YPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGS-------VNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P +  ++P+KV+ YGPG+E    I    AEF VD   AG+  L I   D  G  +D+  +E PD    Y C+YTP     +T+ V +    +P SPF+V I + S  P  VKV GPG+E+ G+  +  T+F +   +AG G++S    C     S +++ I+  I   +  ++ V+Y     G ++I +  +  +I  SPF + V P  +A  V   G G+  +G+  G  + F + T+ AG   ++V    P   + +VK  EI  NY       Y P + G  ++ +NY   P+ +SPF + V  P   + I   G  L + V VGK   F+ D NG    G L   I  PS   + C       +  +T+ Y P   G Y V +  DG  +P SPY   ++ +    D SK+K YGPG+  EG  +  P EFTID     +          C   E  +  S  G+      Y P T G + V +  +   +P SPF+  V  P +P+ V   G GL            +D + AG GNLAVE   + G+     + ++ D   + V Y P  +G +Y  +++Y G  +P  P  +++ P +D SK+ V      +  +F+E+   F V+AK++   G   VK   T+PS   +  +++ NGDG+Y   Y+P++ G + + VTY+D P+ NSPF + V  GC P +V   G GL    TN+PN F++   GAG G LG+ +EGPS++K++C DN DG+C+VEY+  + G YD+ I ++   + GSPF++P++D ++ + VK  G  L  G+  R   P  FTVD S+AG APL           D      PL+  S        R    PG              + +++ PT  GP+ + +++A+  +P +PF   +LP  +  KV   G G+   G  ++ S+PV F +D   AG G + + +++ +       I D   G +   Y P   G++ + V +    +   P+ +  + +GDA+KC +   G++  +    E    ++ T AG+GK++C I  L  +G     L    ++  N +GT  IYY+  +   Y++ ++FGG  IPN  F     D   +  +   +      +    +ET DY      NG+   P +  +P ++    +   V  PSG    A + DN +G+V+IRY P E G+HE+ + C+G  I  SP +FF      G V+AYGPGL +G    PA FTI+T+DAG GGL LAIEGPSKAEI C DN++G+C VTY P +PGDY+I++K+ D +I GSPFIA I  + +RRSQ+ +GST+D  L I   D+S L+AS++APSG++E C+LK++PN+++GISF PREVG H +++ ++G HI  SP  I+V Q+EIGDASKV+ FG GL  G + EM+ F VDTREAGYGGLSL++EGPSK +I+  D  DGTCQVSY P+EPG Y+++IK+A+EHV GSPF  K+ GE   ++ E I  +++A  +  VG  CEL LK+P    +++ A V +  G  +  EI+DL      ++F+P+E G+HTV V++R  H+PGSPFQFTVGP+ +GGA KV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGS GV Y V EPG+Y   IKFND+HI  SPF           + + +  D+A     T  + +   VN P +  IR   + GK+ A +  PS   E   +  +E   YA+RF+P+E+G H+I+V  +    H+PGSPF+V +G+  Q  DPG+V A GDGL +G  GK++ FI+NT  +G G L+VTI+GPSKV +  +E  EGY  +Y P APG Y I VKYGG  HI GSPF A ++G         +++S I V   +    +T      +++P  +S A KV   G G+ KA L Q +TF VD S+AG++IL VG+ GP   CEEVS+KH+G   + ++Y V+E+G + L+VKWGE++IPGSPF + V
Sbjct:  639 PASGDIDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAGKAALKIYSQDVEGNPVDIMTKEKPD--GTYACSYTPAKPIKHTVAVTWGGVSVPNSPFRVNIGQGS-HPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVISDEEEDIDFDIIPNANDTFTVKYMPPAAGRYTIKVLFAGEEIPESPFRIKVDPSHDASKVRAEGPGLSKSGVENGKPSHFTVYTKGAGKAPVDVSFTGPAPGD-AVKDFEIIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRING--LESRVEVGKDQQFIVDPNGAGGQGKLEVKISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVDVSYDGNPVPGSPY---VVEATLPPDPSKVKAYGPGL--EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPC---EAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQANVEMPFDPSKVIATGPGLEHGKVGEAGLIHVDCSQAGPGNLAVEAVSDSGSKAEVNVQDNKD-GTYTVTYVPLFAG-MYTLALKYGGEQVPKFPARVKVDPAVDTSKIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSPFKVGVTEGCYPDRVKAQGAGLTEALTNKPNLFSVITRGAGIGGLGITVEGPSESKMSCKDNKDGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVKDVVDPSKVKISGPGL--GTAVRAKIPQQFTVDTSKAGIAPLAVQVTGPRAEADLLTRRNPLQALSDFFKGEFKRNANEPGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAVQYADEEIPRSPFKVKVLPTYDASKVTASGPGLCAQG--ISASLPVNFAVDAKNAGLGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAVKYGGDDIPYSPYRIRAMSIGDASKCTVAGPGIQAAVKTGEEVGFVVDATTAGKGKVTCSI--LGPDG-----LENEADVIENVDGTYDIYYTTAKTGPYVIHVRFGGADIPNSPFTVMATDEVPVQVQQQSLSACPPGYQPLVSET-DYAQVGSMNGLSFRPFDLVIPFAIRTGEITGDVHMPSGKTAPADIVDNKDGTVSIRYVPTETGLHELAIKCNGAHIPESPLQFFVNYPNTGSVSAYGPGLIYGVANKPATFTIITEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPFIAKITDDSRRRSQVKLGSTADFLLDITETDLSLLSASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGRHIPNSPISIMVYQSEIGDASKVKAFGPGLIEGRTYEMSDFIVDTREAGYGGLSLAVEGPSKVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKFADEHVPGSPFTAKVMGE--GRVKESITRRRKAPSVASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTSCVRFVPQETGIHTVSVKYRGEHVPGSPFQFTVGPLGEGGAEKVKAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSSGVSYVVQEPGDYDVIIKFNDEHIPQSPF----------LVPIVATSDDARRLTVTSLQESGLKVNQPASFAIRLNGARGKIDAKVHSPSGAVEECFVTELEPGNYAVRFMPRENGIHMIDV--KFNGSHVPGSPFKVRVGEAGQEGDPGLVTAYGDGLETGTTGKQSEFIINTSKAGPGALSVTIEGPSKVTMECKECPEGYRVLYTPMAPGIYMIGVKYGGPNHIVGSPFKAKVTGQRLVGIGGTSETSSIIVQSVTRASTETT----YSALPRFASDATKVTSKGAGLSKAFLGQKSTFTVDCSKAGSNILLVGVHGPTLPCEEVSIKHLGNKHYTVHYHVKERGDYMLVVKWGEEHIPGSPFHITV 2632          

HSP 2 Score: 1117.84 bits (2890), Expect = 0.000e+0
Identity = 764/2321 (32.92%), Postives = 1164/2321 (50.15%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTD-----HDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFG--EGLEGGFTNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINC-TDNLDGT--CTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV----APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGP-SKAEIVCK-------------------------------DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQ--------ICI-GSTSDVPLKI----NNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQ--------QEAADITQVGSQCELTLK-----VP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAK-EWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ + +   ++R  F   +LENV++ L FLE +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+WE E  +     QTPKQR++ WI  ++P+  + N + +W DG A+GALVDSCAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE+IDPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YG G+E    +  ++A FTV+  SAG G + + I D  G   + K+    DK   +   Y P   G + +TV +A + I +SPF+V ++K  GD SKV  KGPG+E  G I +  TYF I T  AG G+I   V+ P G  + +   +  +    YR  Y   + G H++ I         SP+ V +    N      +GRG+Q  G+R+ + A+F +DT+ AG+G L+V +  P+  +E +K +E         Y P  PG Y + I +    + +SPF++ V L      + A+GPGL +G+ GKAA FV ++ G E+GSLGF+IEGPS+AKIEC D  DGS  + YWP  PGEYA+HI+CD EDI NSPYMA I P++   D  K+K YGPG++K G  +++P EF +D  +  K+ +K  +      GN + ++     +  Y C Y P     H V V+    SVP SPF+V + Q S+P+ V+V G G+         P +F++D T AG G+++V I  +   I       D D     +D F V Y P  +G  Y   + + G  IP SPF I++ P  D SKV  E     ++ +       F V  K     GK  V   FT P+    G  VK      N D S++  Y+P   G   + V Y   PI  SPF + V    D +K+ + G    +E G   Q   F +D +GA GQG L + I  PS   + C  + + G    TV+Y     G Y++ + ++   V GSP+ +    P + + VK +G  L  G + +   P  FT+D   AG   L          E P E K    +   G   ++++PT  G + + I      +PG+PF  N+    +P KV   G G+        G +        H+D S+AG G++ +   +        ++ D   G +   Y P  AG + + + +    V   P  V+V    D +K  +   G++E  +    T          +  +  + +  T    VK+ ++ P        + +NG+GT  + Y+P E   + + + +    +PN  FK           E    ++ K+Q A      T+  N ++ V     I+ GA  +  +  T  G  ES +   DN +GS ++ Y P   G +++N+T DG  I GSP++   ++     KV   GPGL    R  +P +FT+ T  AG   L++ + GP ++A+++ +                               DN +G+  V+Y P + G Y++ +++AD  IP SPF   ++  P   +         +C  G ++ +P+       N  +  L+  +    GK +   ++   +    +S+ P   G + + V   G  I  SP++I      IGDASK  V G G++  + + E   F VD   AG G ++ SI GP   E E    +N DGT  + YT ++ G Y+I++++    +  SPF V  T E   ++ ++ +              D  QVGS   L+ +     +P      ++   V    G T   +I+D  DG  SI+++P E GLH + ++    HIP SP QF V     G    V A G GL  G  + P  F+I T +AG GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +K+ND HI  SPF             +A + D++  + +  +G  A F ++  +T        L A+I  PS  +EP +++ +  N   I FIP+E GEHL+++      +HIP SP  +++ Q    D   V A G GL+ G   + + FIV+T  +G G L++ ++GPSKV + +++ E+G  +  Y P+ PG Y +++K+  + H+ GSPFTA +                      +G+  V    T+   A  V         A++  +   N+   +   + L   +  P  + +E  +  +G+N   + ++ QE G H + VK+  +++PGSPF
Sbjct:    4 TEKDLAQDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFSQMQLENVSVALEFLE-RENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPVWEDEGDE-ETKNQTPKQRLLGWIQNKIPQLPITNFSQNWQDGKALGALVDSCAPGLCPDWESWDPKKPVENAREAMQQADDWLGVPQVIAPEEIIDPNVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGLGVEPTGNMVKRSAPFTVETISAGTGEVLVYIEDPEGNREEAKVTGNNDKNKTFSVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKAQGDASKVTAKGPGLEPIGNIANKPTYFDIYTAGAGVGDIGIEVIDPQGRNNTVELALEDKGNCVYRCTYKPIKAGPHNVAINFGGEATPKSPYLVSIGEACNPNACRANGRGLQPKGVRIRETADFRVDTKAAGSGDLHVSVKGPKGLDEVLKQSESLDGLHLFEYYPLTPGKYVVAITWGGHHIPKSPFEVQVALEAGPQKVRAWGPGLYSGMAGKAADFVVESVGSEVGSLGFAIEGPSQAKIECEDQGDGSCDVRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGDIDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAGKAALKIYSQ--DVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAVTWGGVSVPNSPFRVNIGQGSHPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVISDEEEDIDFDIIPNANDTFTVKYMPPAAG-RYTIKVLFAGEEIPESPFRIKVDPSHDASKVRAEGPGLSKSGVENGKPSHFTVYTK---GAGKAPVDVSFTGPA---PGDAVKDFEIIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRINGLESRVEVGKDQQ---FIVDPNGAGGQGKLEVKISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVDVSYDGNPVPGSPYVVEATLPPDPSKVKAYGPGLEGGLVGK---PAEFTIDTKGAGTGGLGLTV------EGPCEAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEETHIPGSPFQANVEMPFDPSKVIATGPGLEHGKVGEAGLI--------HVDCSQAGPGNLAVEAVSDSGSKAEVNVQDNKDGTYTVTYVPLFAGMYTLALKYGGEQVPKFPARVKVDPAVDTSKIKVFGPGIEEKGVFREATT---------DFTVDAKSLTKTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSPFK-------VGVTEGCYPDRVKAQGAGLTEALTNKPN-LFSV-----ITRGA-GIGGLGITVEGPSESKMSCKDNKDGSCSVEYTPYVTGDYDVNITYDGEHIPGSPFRVPVKDVVDPSKVKISGPGLGTAVRAKIPQQFTVDTSKAGIAPLAVQVTGPRAEADLLTRRNPLQALSDFFKGEFKRNANEPGTVEPVDLVDNGDGTHTVSYTPTLEGPYTVAVQYADEEIPRSPFKVKVL--PTYDASKVTASGPGLCAQGISASLPVNFAVDAKNAGLGPLSVQITDQEGKPKKAQIQDNNDGTYSVSYIPDRTGRYHVAVKYGGDDIPYSPYRIRA--MSIGDASKCTVAGPGIQAAVKTGEEVGFVVDATTAGKGKVTCSILGPDGLENEADVIENVDGTYDIYYTTAKTGPYVIHVRFGGADIPNSPFTVMATDEVPVQVQQQSLSACPPGYQPLVSETDYAQVGSMNGLSFRPFDLVIPFAIRTGEITGDVHMPSGKTAPADIVDNKDGTVSIRYVPTETGLHELAIKCNGAHIPESPLQFFVNYPNTG---SVSAYGPGLIYGVANKPATFTIITEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYNILVKYNDTHIAGSPF-------------IAKITDDSRRRSQVKLGSTADFLLDITETDL----SLLSASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK--NGRHIPNSPISIMVYQSEIGDASKVKAFGPGLIEGRTYEMSDFIVDTREAGYGGLSLAVEGPSKVDIQTEDLEDGTCQVSYCPTEPGVYIVSIKF-ADEHVPGSPFTAKV----------------------MGEGRVKESITRRRKAPSV---------ASVGGLCELNLKIPEIDRNELTAEVVSPSGRKQEAEIVDLGQNTSCVRFVPQETGIHTVSVKYRGEHVPGSPF 2212          

HSP 3 Score: 271.552 bits (693), Expect = 4.582e-72
Identity = 304/1157 (26.27%), Postives = 483/1157 (41.75%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDI--QXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPI-SLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI--------------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKA--------EIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVG------SQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIY--TREAGAGGLSIAIEGPSKAEID--FEDRKDGSCG-VKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGI-KKATLNQVNT-FNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G GV PTG  +  S P  F ++   AG G++   +     +         ++    F  +Y P   G H +TV F    +   PF V V +  GDA+K   +    E I          +   AG G     I  +   G    N ++ + +E+ GN      Y P +   + V I FGG + P   +     +  N           + +    R ET D         FR+   + G+ ++   V  P G+ E     ++ +G     Y P   G + + +T  G  I  SP++   A  AG  KV A+GPGL  G  G  A+F + +  +  G L  AIEGPS+A+I C+D  +GSCDV Y+P  PG+Y+I I   D +I  SP++A I               G    ++   + + ++  +   +   + L    +   G     + K+ P+     S+TP +   H + V   G  +  SPF++ +GQ        V+VFG G+ K G+ +NE   FTVD  EAG G +S+ I+  ++         + +   N + T  V Y P   G Y I + +A E +  SPF +K+  +PS    +    + E   +++ G      S   +  K  G    D+  T        +  EIID  D  +++++ P + G   V V +    IP SPF   V   +D    ++    NGL+     G ++  I       G G L + I  PS+  +    E      C  VKY   E G Y   + ++ + +  SP+ +       D   V + G     +   +GKPA FT++    T     G L  T+ GP   E      +      ++ ++P   GE+ +N+  E T  HIPGSPF+  + +   DP  V A G GL  G VG+     V+   +G G L V    D  SK ++  Q+N++G Y   Y+P   G Y + +KYGG   +   P    +  +V+ S                                K++  G GI +K    +  T F VDA   ++ G + +   I  P     +  ++  G   + + Y   EKG H + V + ++ +P SPF V V
Sbjct:  242 LKPGAP----LKPKLNPKKARAYGLGVEPTGNMVKRSAP--FTVETISAGTGEVLVYIEDPEGNREEAKVTGNNDKNKTFSVEYVPKVTGMHKVTVLFAGQHIAKSPFEVNVEKAQGDASKVTAKGPGLEPIGNIANKPTYFDIYTAGAGVGDIGIEVIDPQGR---NNTVELALEDKGNCVYRCTYKPIKAGPHNVAINFGGEATPKSPYLVSIGEACNPNACRANGRGLQPKGVRIR-ETAD---------FRVDTKAAGSGDLHVSVKGPKGLDEVLKQSESLDGLHLFEYYPLTPGKYVVAITWGGHHIPKSPFEVQVALEAGPQKVRAWGPGLYSGMAGKAADFVVESVGSEVGSLGFAIEGPSQAKIECEDQGDGSCDVRYWPKEPGEYAIHIMCDDEDIQNSPYMALIQPASGDIDPDKVKAYGPGLEKTGCIVSTPAEFAVDPTDAGKAALKIYSQDVEGNPVDIMTKEKPDGTYACSYTPAKPIKHTVAVTWGGVSVPNSPFRVNIGQGS--HPHLVKVFGPGVEKTGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVISDEEEDIDFDIIPNANDTFTVKYMPPAAGRYTIKVLFAGEEIPESPFRIKV--DPSHDASK---VRAEGPGLSKSGVENGKPSHFTVYTKGAGKAPVDVSFTGPAPGDAVKDFEIIDNYDYSHTVRYTPVQQGKMKVAVNYGGDPIPKSPFTVGVAAPLDLNKIRI----NGLESRVEVGKDQQFIVDPNGAGGQGKLEVKISSPSRKSVPCLVEPVPGNECSTVKYIPKEEGLYNVDVSYDGNPVPGSPYVVEATLPP-DPSKVKAYGPG--LEGGLVGKPAEFTID----TKGAGTGGLGLTVEGP--CEAKIECSDNGDGTCSVSYLPTTPGEYFVNILFEET--HIPGSPFQANV-EMPFDPSKVIATGPGLEHGKVGEAGLIHVDCSQAGPGNLAVEAVSDSGSKAEVNVQDNKDGTYTVTYVPLFAGMYTLALKYGGE-QVPKFPARVKVDPAVDTS--------------------------------KIKVFGPGIEEKGVFREATTDFTVDAKSLTKTGGNHVKTKITNPSGASTDYLLRDNGDGTYYVEYTPFEKGAHAIKVTYDDEPVPNSPFKVGV 1323          
BLAST of Filamin vs. Ensembl Mouse
Match: Flnb (filamin, beta [Source:MGI Symbol;Acc:MGI:2446089])

HSP 1 Score: 1317.75 bits (3409), Expect = 0.000e+0
Identity = 776/2015 (38.51%), Postives = 1148/2015 (56.97%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQDGS---ATICYWPTAPGEYAVHILCDGEDIPNSPYM--ANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQ-TTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG-EVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNE-----TTDYTN-GMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANIS-------GSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P T   NP+ V+ YGPG+E         AEF VD   AG   L I   D  G+ ID++++   D    Y C+YTP     +TI V +   +IP SP++V I + S  P KVKV GPG+E++G+  +  T+F +   +AG G++S    C     S D++ ++  I   +  ++ V+Y     G ++I +  +S +I  SPF V V P  +A  V   G G+   G+  G    F + T+ AG   LNV+  SP   E +VK  +I  NY       Y P++ G  ++ + Y   P+ +SPF + V  P   S I   G  L   V VGK   F  DTNG    G L  +I  PS   + C          +T  + P   G +AV +  DG  +P SPY   A++ P     D +K+K +GPG+  EG  +  P EFTID     +          C   E  +  S  G+      Y P   G + V +  +   +P SPFK  +  P +P+ V   G GL       P    +D + AG G L +E   + G     ++ N+ D   + V Y P T+G +Y  +++Y G  +P  P  ++++P ID S  K F   ++   +F+E+   F V+++ +   G   +KA  T+PS   +   VK N DG+Y   Y+P++ G ++++VTY+D+PI NSPF + V  GC PS+V   G GL+  FTN+ N FT+   GAG G LG+ +EGPS++KINC DN DG+C+ EY    PG YD+ I +  V + GSPF++P +D ++ + VK  G  L+  S  R   P +FTVD+S+AG APL+      +G   P+ +    +   G + +T+ P++ GP+ + +K+A+  +P +PF   +LP  +  KV   G G++  G  +  S+PV+F ID  +AG+G + + +++ +       + D   G +   Y P   G++ I V +    +   P+ +   Q GDA+KC     G+   +    E    ++   AG+GK++C I  LT +G E ++++     IEN  +GT  I+Y+  +   Y++ ++FGGV IPN  F     D      E   +      F  +  E      +D    G  P +  +P ++    +   V  PSG + +  + DN +G+VT+RY P E G+HEM++   G  I  SP +F+      G V+AYGPGL +G     A FTIVT+DAG GGL LAIEGPSKAEI C DN++G+C VTY P +PGDYSI++K+ D +IPGSPF A I  + +R SQ+ +GS +D  L I+  D+STLTAS++APSG++E C+LK++PN+++GISF PREVG H +++ ++G H+  SP  I+V Q+EIGDA + +V+G+GL  G + EM+ F VDTR+AGYGG+SL++EGPSK +I+  D  DGTC+VSY P+ PG Y+++ K+A+EHV GSPF VKI+GE   ++ E I     A  +  VGS C+L LK+P  + SDM A VT+  G     EI+ +    + ++F+P+EMG+HTV V++R  H+ GSPFQFTVGP+ +GGAHKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI F+D K+GSCGV Y   EPG Y  SIKFND+HI +SP+           + V +  D+A        + +   VN P +  IR   + GK+ A +  PS   E   +  +E ++YA+RFIP E+G H I+V  +    H+ GSPF+V +G+  Q  +P +V A G GL +G  G ++ F +NT  +G G L+VTI+GPSKV++  QE  EGY+ +Y P APG Y I VKYGG  HI+ SPF A ++       GS N++S I V   +    +T      +++P  SS A KV   G G+ KA + Q ++F VD S+AG+++L +G+ GP + CEEVS+KH+G+ Q+ + Y+V+E+G + L VKWGE++IPGSPF V V
Sbjct:  638 PATGDYNPDLVQAYGPGLEKSGCTINNPAEFIVDPKDAGSAPLKILAQDGEGQPIDIQMKSRMD--GTYACSYTPLKAIKHTIAVVWGGVNIPHSPYRVNIGQGS-HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPLPGE-AVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKING--LENRVEVGKDQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTYDGHPVPGSPYTVEASLPP-----DPTKVKAHGPGL--EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPC---EAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKD-GTYAVTYVPLTAG-MYTLTMKYGGELVPHFPAWVKVEPAIDTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVHAQGPGLKEAFTNKSNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLS--SCVRACIPQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGD---GTHTVTYTPSQEGPYIVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSAYG--VPASLPVEFAIDARDAGEGLLAVQITDQEGKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLATGPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVI--LTPDGTEAEADV-----IENE-DGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAMEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYRGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDNRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGE--GRVRESITRTSRAPAVATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPY----------LVPVIAPSDDARCLTVLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDV--KFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLETGTTGIQSEFFINTTQAGPGTLSVTIEGPSKVKMDCQEIPEGYKVMYTPMAPGNYLIGVKYGGPNHISRSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETC----YSAIPKSSSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2601          

HSP 2 Score: 1097.8 bits (2838), Expect = 0.000e+0
Identity = 760/2290 (33.19%), Postives = 1129/2290 (49.30%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHA-NKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSD-IKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTD----------HDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGF-TNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIP---GTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG--EVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII---------GEPQRRSQICIGSTSDVPLKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGI-SNEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKII----------CQQEA----ADITQVGSQCELTLKVP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ +  H  ++R  FR  KLENV++ L FL+  E +KL++IDS  IVD  LKLILGLVW LILHYSISMP+WE E       KQTPKQR++ WI  ++P   + N   +W DG A+GALVDSCAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE+I P+VDE ++MTYLSQFP AK+ PGAP+  KLNP K R YG GIE    +  Q A+FTVD  SAG+G++ + + D  G   + ++    DK   Y   Y P   G + + V +A + I +SPF+V +DK  GD SKV  KGPG+E  G I +  TYF I T  AG G+I   V  P G K+ +   +       YR  Y   + G H + +  +   I  SPFGV +    N      SGRG+Q  G+R+ + A+F +DT+ AG+G+L V +  P+  EE VK        +   Y PS PG Y + + +    + +SPF++ V P      + A+GPGL  G+VG++A FV ++ G E+G+LGF+IEGPS+AKIE  D  DGS  + YWP  PGEYAVHI+CD EDI +SPYMA I P+    +   ++ YGPG++K G  +N+P EF +D  +  S  +K  A      G  I + + S  +  Y C Y PL    H + V     ++P SP++V + Q S+P  V+V G G+  +      P +F++D T AG G+++V I  +        LS+D +          +D F V Y P   G  Y   + +    IP SPF +++ P  D SKV  E     +  +       F V+ K     GK  +   F+ P     G  VK      N D S++  Y+P   G   + VTY   PI  SPF + V    D SK+ +   GLE      +   F ID +GA GQG L + I  PS   + C            +  IP   G + + + ++   V GSP+ +    P +   VK  G  L  G + +   P  FT+D   AG   L          E P E K    +   G   ++++PT+ G + + I    + +PG+PF  +I    +P KV   G G+   G    P +     +D SEAG G + L   +         I +   G +   Y P  AG + +T+ +    V + P  V+V    D +      G+K +        +    T   +  +  R  PLT+ G   +K+ ++ P        +++N +GT  + Y+P E   ++V++ +  V IPN  FK    +         +    K  F +  N  T  T G            G   +   V  PS   ES +   DN +GS +  Y P   G +++N+T  G+ I GSP++  +++     KV   GPGLS   R  +P  FT+ +  AG   L + + GP      +   DN +G+  VTY P   G Y + +K+AD  IP SPF   ++               S   + ++  V   I+  D     L   +    GK +   +    +    +++ P + G + I V   G +I  SP++I   Q   GDASK    G G+   + + E   F VD + AG G ++  I  P  ++AE +  +N DGT  + YT ++PGTY+I +++    +  SPF V  T      + E  +            +EA    +D+  +G +    L +P      ++  TV    G     EI+D  DG  ++++ P E+GLH + +++R  HIP SP QF V     G    V A G GL  G  +    F+I T +AG GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +K+ND HI  SPF   + +            DN    +  +G  A F ++  +T        L A+I  PS  +EP +++ +  N   I FIP+E GEHL+++       H+  SP  +++ Q    D       G GL  G   + + FIV+T ++G G +++ ++GPSKV + +++ E+G  +  Y P+ PG Y ++ K+  + H+ GSPFT  IS                      G+  V    T++S A  V         AT+  +   N+   +  +  +   +  P     E  +  MG+N   + ++ QE G H + VK+  +++ GSPF
Sbjct:    4 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMHHKYHQRPTFRQMKLENVSVALEFLDH-ESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDD-DAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAKGPGLETTGNIANKPTYFDIYTAGAGVGDIGIEVEDPQG-KNSVELLVEDRGNQVYRCVYKPVQPGPHVVKVSFAGDAIPKSPFGVQIGEACNPNACRASGRGLQPKGVRIRETADFKVDTKAAGSGELGVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGCTINNPAEFIVDPKDAGSAPLKILAQ--DGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDA-----RVLSDDEEDVDFDIIHNANDTFTVKYVPPAPG-RYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVHTK---GAGKAPLNVQFSSP---LPGEAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKI--NGLENRVEVGKDQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTYDGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGK---PAEFTIDTKGAGTGGLGLTV------EGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLE-HGKVGEPGI---LCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPAWVKVEPAIDTS------GIKAFGPGIEGKDVFREATT--DFTVDSR--PLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVHAQGPGLKEAFTNKSNVFTVVTRGA-----------GIGGLGITVEGPS---ESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLSSCVRACIPQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYIVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQT--GDASKCLATGPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAMEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFK-PFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYRGSHIPESPLQFYVNYPNSG---SVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITD------------DNRRCSQVKLGSAADFLLDISETDL----STLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK--NGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKF-ADEHVPGSPFTVKIS----------------------GEGRVRESITRTSRAPAV---------ATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPF 2181          

HSP 3 Score: 280.026 bits (715), Expect = 9.392e-75
Identity = 304/1153 (26.37%), Postives = 487/1153 (42.24%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEG--KGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI--------------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKA--------EIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQ----CELTLKVPGTHHSDMRATVTNLYGTTEV--CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEID--FEDRKDGSCGVKYFV-TEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +    P +F +D   AGQGD+ + + +P+       +  +      +  +Y P   G H + V F    +   PF V V +  GDA+K   +    E            +   AG G     I    E+ + K+++ L VE  + GN      Y P +   ++V + F G +IP   F  +  +  N           + +    R ET D+      V+ +   + G+  +   V  P G+ E        +G  +  Y P   G + + VT  G  I  SP++      AG+ KV A+GPGL  G  G  A+F + +  +  G L  AIEGPS+A+I   D  +GSCDV Y+P  PG+Y++ I   D +I  SP++A I               G    +S   I + ++  +   +   + L    +   G+     +K   +     S+TP +   H I V   G +I  SP+++ +GQ       KV+VFG G+ + G+ +NE   FTVD  EAG G +S+ I+  ++         + +   N + T  V Y P  PG Y I + +A++ +  SPF VK+  +PS    +    + E   +++ G +       T+   G   + +    ++      V   +IID  D  +++K+ P + G   V+V +    IP SPF   V   +D    K+    N +++G      EF+I T  AG  G L + I  PS+  +           C    F+  E G +   + ++   +  SP+ +  +    D   V + G     +   +GKPA FT++    T     G L  T+ GP   E      +      ++ ++P + GE+ +N+  E    HIPGSPF+  I +   DP  V A G GL  G VG+     V+   +G G L +    D  +K ++  Q N++G Y   Y+P   G Y +T+KYGG                     E+  H  + +KV+          P   +   K    G+  K         F VD+   +Q G D +   I  P     E  VK      + + Y   EKG H + V + +  IP SPF V V
Sbjct:  242 LKPGAP----LKPKLNPKKARAYGRGIEPTGNMV--KQPAKFTVDTISAGQGDVMVFVEDPEGNKEEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAKGPGLETTGNIANKPTYFDIYTAGAGVGDIGI--EVEDPQGKNSVELLVE--DRGNQVYRCVYKPVQPGPHVVKVSFAGDAIPKSPFGVQIGEACNPNACRASGRGLQPKGVRIR-ETADFK-----VDTK---AAGSGELGVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGCTINNPAEFIVDPKDAGSAPLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAVVWGGVNIPHSPYRVNIGQGS--HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASQEIPASPFRVKV--DPSHDASK---VKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPLPGEAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGKD---QEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTYDGHPVPGSPYTVEASLPP-DPTKVKAHGPGL--EGGLVGKPAEFTID----TKGAGTGGLGLTVEGP--CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFE--EVHIPGSPFKADI-EMPFDPSKVVASGPGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGG---------------------ELVPHFPAWVKVE----------PAIDTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKVAV 1322          

HSP 4 Score: 182.57 bits (462), Expect = 3.331e-45
Identity = 193/762 (25.33%), Postives = 319/762 (41.86%), Query Frame = 3
Query:  771 NVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAK-LVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIM-PSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDGVN-IPGSPFTIQIKPEI--------DISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            N D    +TYL   P         N K  PG+P T+K+  +  R          +  G  A+F +D        L  +I   +G+     ++ +P+  N    ++ P   G + ++++     +  SP  + + ++  GD  + KV G G+ +      +   FI+ T DAG G IS  V  PS    K++ +       + +V Y     GV+ ++   +   +  SPF V +S     +  +T + R        VG   +  +      +  ++  + SP       +I  +  N     ++P + G++ + + Y    VT SPF+  V P        + A GPGL  G  G  A F +       G L  ++EGPS+A+I   D+++GS  + Y    PG Y V I  + E IP+SPY+  ++ PS++   ++ + +     Q+ G+ +N P  F I     K  I  +A   + SG      +S     KY   + P  +G H + V  +   V  SPFKV+V +P    NP  V   G GL + T    + F I+TT AG G L+V I        P  +  D     + + V Y P   G  Y   ++Y G N I  SPF  ++  +         + S + VE++    T     +  +   +A  + +KG G  KA     SSF     K+GS                  +K  G   Y+ +Y   + G Y+L V + +  I  SPF++ V
Sbjct: 1871 NKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDNRRC-------SQVKLGSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPN--NHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSD--FIVDTRDAGYGGISLAVEGPS----KVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVRESITRTSRAPAV--ATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPVIAPSDDARCLTVLSL-----QESGLKVNQPASFAIRLNGAKGKI--DAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLETGTTGIQSEFFINTTQAGPGTLSVTIEG------PSKVKMDCQEIPEGYKVMYTPMAPG-NYLIGVKYGGPNHISRSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKSSSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2601          
BLAST of Filamin vs. Ensembl Mouse
Match: Flna (filamin, alpha [Source:MGI Symbol;Acc:MGI:95556])

HSP 1 Score: 1296.18 bits (3353), Expect = 0.000e+0
Identity = 772/2019 (38.24%), Postives = 1156/2019 (57.26%), Query Frame = 3
Query:  855 LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSG----DKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKL--LSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTTGVVGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIEC-------CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLS-NDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKV--FVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKT---------KSQFASFRNETTDYTNGM-----YPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISG-------SVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
             +P++V+  GPG+E   +   + AEFTVDA  AG+  L + + DN G  ++  +++  +    Y C+Y P     +T  V +    IP SPF+V +   S  P+KVKV GPG+ + G+     TYF +   +AG G++S  +    G     +  I+  I +    ++ V+YT    G ++I +  +      SP  V V P  +A  V   G G+   G+ +G    F ++ + AG GKL+V+   L+   +   V I + + N +   YIP + G   + + Y    + +SPF + V P+   S I   G G    V GK   F   + G    G +   I  PS A + C        DN    + + + P   G Y V +  DG  +P SP+ +  + P    T  SK+K +GPG+Q  G    SP  FTID     +          C   E  +     G+      Y P   G++ + +   +  +P SPFK  VA   + + V+  G GL  AT      F +D ++AG   L +EI  E G  LP  +   D       + Y P   G  Y  +I+Y G  +P  P  +Q++P +D S V  +   ++   +F+E+   F V+A+A+   G   VKA   +PS   + + V+  GDG+Y   Y+PY+ G + +DVTY+  P+ +SPF + V  GCDPS+V V G G++ G TN+PN FT++  GAG G LGLA+EGPS+AK++C DN DG+C+VEY     GTY + + +    V GSPFK+P+ D  + + VKC G  L+PG + R + P +F VD S+AG APL+   +  +G   P+++    +   G   + +VP+  G ++I + +    VP +PF   +LP  +  KVK  G G+  TG  +  S+PV+F ID  +AG+G + + +++P+       I D   G +   Y P   G++ I + +    +   P+ V  +  GDA+KC +   G+   I +  ET+IT++T  AG+GK++C +   T +G       + V++  N +GT  I+Y+  +  +Y++ ++FGG  +PN  F+   +  +    +     +           SQ            NG+      P +  +P ++    +   V  PSG      + DN +G+VT+RY P E G+HEM++  D + I GSP +F+ +    G + AYGPGL+HG    PA FT+ TKDAG GGLSLAIEGPSKAEI C DN++G+C V+Y P++PGDYSI++K+ D +IPGSPF A + G+   R S + +GS +D+P+ I+  D+S LTA+V  PSG+EE C+LK++ N ++GISF P+E G H ++V ++G H+  SP  +V+ Q+EIGDAS+VRV G+GL  G + E   F +DTR+AGYGGLSLSIEGPSK +I   D  DGTC+V+Y P+EPG Y+INIK+A++HV GSPF+VK+TGE   ++ E I  ++ A  +  +GS C+L+LK+P     DM A VT+  G T   EI++ ++  Y I+F+P EMG+HTV V+++  H+PGSPFQFTVGP+ +GGAHKV A G GL+      P EF I+TREAGAGGL+IA+EGPSKAEI FEDRKDGSCGV Y V EPG+Y  S+KFN++HI +SPF + V     D   ++V+S+ ++ L     + +PA+F V+        + G + A +  PS   E   +  I++++YA+RFIP+E+G +LI+V  +    HIPGSPF++ +G+     DPG+V A G GL  G  G    FIVNT N+G G L+VTIDGPSKV++  QE  EGY   Y P APG Y I++KYGG YHI GSPF A ++G       S++++S ++V   S  KV TV     TS P  + V+ KV   GLG+ KA + Q + F VD S+AGN++L VG+ GP++ CEE+ VKHMG   + ++YL+++KG + L+VKWG+++IPGSP+ + V
Sbjct:  670 FHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKD--NGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS-HPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDV-GKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAP----TKPSKVKAFGPGLQ--GGNAGSPARFTIDTKGAGTGGLGLTVEGPC---EAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAG--LPAEVYIQDHGDGTHTITYIPLCPG-AYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMV-RANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNAD---GTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG--VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTV--CTPDGS-----EVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGE--GRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGL----KVNQPASFAVSLNG-----AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDV--KFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFV--DSLTKVATV-PQHATSGPGPADVS-KVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2638          

HSP 2 Score: 1139.41 bits (2946), Expect = 0.000e+0
Identity = 772/2302 (33.54%), Postives = 1139/2302 (49.48%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHA-NKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINC-------TDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAG--------EAPLKAC--CKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVA-PTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG--RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVPLKI--------NNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGIS-NEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADIT---------------------QVGSQCELTLKVPGT-HHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNAL-AKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  ++ I +LQ D SDG+RL+ L+EVLS+ K     N+R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ E+      KQTPKQR++ WI  ++P+  + N + DW  G A+GALVDSCAPGLCPDW  W     + + +EAM  A+ WL +PQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YGPGIE    +  + AEFTV+  SAG+G + + + D AG   + K+    DK   +   Y P   GT+ +TV +A + I +SPF+V +DK+ GD SKV  +GPG+E +G I + +TYF I T  AG GE+  V+  P+G K  + P++     ++YR  Y     GVH++++  +   I  SP+ V V    N       GRG+Q  G+RV + A+F + T+ AG+G+L V +  P K EE VK  ++    +   Y P+ PG Y + I +    + RSPF++ V        + A+GPGL  G+VGK+A FV +  G ++G+LGFS+EGPS+AKIEC D  DGS  + YWP   GEYAVH+LC+ EDI  SP+MA+I  + +     ++K  GPG++K GVA+N P EFT+D  ++              G  +   +   GN  Y C Y P     H   VS    S+P SPF+V V   S+PN V+V G G+       + P YF++D T AG G++++ I    G + P     D      D+D F V Y P  +G  Y   + +     P SP  ++++P  D SKV  E     +T +       F VNAK     GKG +   F   S    G  V+      + D +Y+  Y P   G   ++VTY    I  SPF++ V P  D SK+ V G G +        F        GQG +   I  PS A + C        DN      V +     G Y++ + ++ V V GSPF L    P   + VK FG  L  G+      P  FT+D   AG        E P +A   C DN                 G   +++VPTE G + I I  A+  +PG+PF  ++ P  +  KVK  G G+   T G +      QF +D S AG  ++ + + +   L     I D G G     Y P   G + +T+ +   PV N P  ++V    D +      GV+ Y        +    T   E  +  R +  T    VK+ ++ P        +++ G+GT  + Y+P E   + VD+ + G  +P+  F+           E  +  + +      ++ TT+  N  + VE R     G   +   V  PS  + S +  DN +GS ++ Y P E G + +NVT  G Q+ GSP+K    +     KV   GPGLS G  R  LP  F + T  AG   L + ++GP      +   DN +G+  V Y P   G YSI + + +  +P SPF   ++           G   +T+ VP  +         +     L   +  P GK +   ++   +    +++ P   G + I +   G  I  SP+++       GDASK  V G G+   I   E    TVDT+ AG G ++ ++  P  S+ +++  +N DGT  + YT  +PG Y+I +++  EHV  SPF V         +   +  QQ A                          V S     L +P T    ++   V    G      I D  DG  ++++ P E GLH + +++ NMHIPGSP QF V  +  G    + A G GL  G  + P  F++ T++AG GGLS+AIEGPSKAEI   D +DG+C V Y    PG+Y   +K+ND HI  SPF   V             GD+++      +G  A   +N  +T        L AT+V PS  EEP +++ +      I F+PKE+GEHL++V      +H+  SP  VVI Q    D   V   G GL  G   +   FI++T ++G G L+++I+GPSKV + +++ E+G     Y P+ PG Y I +K+  + H+ GSPF+  ++G                  +   K  +T      SVA       L +K   + +++  ++ A           +  P  +  E  +     + + I ++  E G H + VK+  +++PGSPF
Sbjct:   31 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLD-RESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWD-EEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDA-KHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAG-SYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAK---TAGKGKLDVQF---SGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNAG---SPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGD---------------GTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVG-----QFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTS------GVQCYGPGIEGQGVFREATT--EFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQ-------VPVTEGCDPSRVRVHGPGIQSGTTNKPN-KFTVETR---GAGTGGLGLAVEGPSEAKMSCM--DNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRA--VPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCG---HITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVT------------GDDSMRMSHLKVGSAADIPINISETDL----SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKK--NGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKF-ADQHVPGSPFSVKVTG------------------EGRVKESITRRRRAPSVANIGSHCDLSLK---IPEISIQDMTAQ----------VTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPF 2218          

HSP 3 Score: 337.035 bits (863), Expect = 3.577e-92
Identity = 357/1356 (26.33%), Postives = 576/1356 (42.48%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE-LGSLGFSIEGP--SEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKV--------YGPGVQK-----------EGVALNS--PNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPG--CDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINR---------VDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE--PDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGK-GVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQ-VGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDG-IQIQGSPYK-------------------FFAEN-----------------AGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF 4658
            P+T   +P++VRV+GPGI+S      +  +FTV+   AG G L + +   +    + K+  + +K       Y P   GTY++ V Y    +P SPFKV +   + D SKVK  GPG+    V  +    F + T  AG   +   V  P G  + ++  +   +  +  V Y     G +SI++     ++  SPF V V P  +A  V  SG G+ + G+      EF ID ++AG G L V++  PE   +   I + +   +   Y+P  PG Y + I Y    +  SP+++  +PT   S     G G+   + +G+  +   DT     G +  ++  P  SE  ++  +N+DG+  I Y    PG+Y + +   GE +PNSP+    +  ++ T  + ++         Y  G Q+            G+ + S  P +  I     K +I  E    +    +  +  +  G    R  Y P   G H++ +  DN  +P SP +  V    N  ++   G GL       PA F+++T +AG G L++ I       +  T   D       V Y P   G  Y+  ++Y+  +IPGSPFT ++  +     + + +L+      S     +N    D      + A    PS  +   ++K   +G    S+ P + G +++ V      + +SP  + +      D S+V V G+GL  G T +P  F ID   AG G L L+IEGPS   IN  D  DGTC V Y  T PG Y I IKF D  V GSPF           +VK  GE     SI R         +      ++         + A      G  +  EI   EN     Y I FVP E+G H + +K+    VPG+PF F + P  E    KV+  G G+  A  G      VP +F I   EAG G + +++  P    + F+   +G  GV    Y   + G + ++V FN+  + + PF+V V    GDA +  +   ++E  L   +      +    +G I  ++   + +G ++       EI+ +     ++ + P E   YL+D+KF G  IP   FK +  +P +  +  +      +  A      T       P EF +  S  GA  +   +  PS ++      +   G   + Y P   G + +++   G   I GSP+K                    F ++                 A + KV A G GLS    G  + FT+    AG   L + + GP     EI+ K   +    V+Y     G+Y++++K+ D +IPGSP+
Sbjct: 1348 PVTEGCDPSRVRVHGPGIQSG--TTNKPNKFTVETRGAGTGGLGLAVEGPS----EAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVT-DASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVD--VVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVR--YSPSEAGLHEMDIRYDNMHIPGSPLQFYVDY-VNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCT---DNQDGTCSVSYLPVLPGD-YSILVKYNDQHIPGSPFTARVTGD---DSMRMSHLKVG----SAADIPINISETDLS---LLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPF-----------SVKVTGEGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHT---YCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVG------VPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGV---AYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSS-LQESGLKVNQPASFAVSLNGAKGAIDAKV--HSPSGALEECYV--TEIDQD---KYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGL----VSAYGAGLEGGVTG-----SPAEFIVNTSNAGAGALSVTIDGPSKVKMDC--QECPEG-YRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPY 2634          

HSP 4 Score: 312.768 bits (800), Expect = 8.903e-85
Identity = 347/1352 (25.67%), Postives = 574/1352 (42.46%), Query Frame = 3
Query: 2895 PGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPI-RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLE--IKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG----KVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGLSLAIE------GPSKAEIVCK--DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQR-------------RSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMP-----NDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAG-YGGLSLSIEGPSKAEIECR-------DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITG--EPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEV-CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAI--EGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATL--NQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P  +P K   +G G+E  G    +   FT++   AGQG + + +E P+    +AK+   ++ + T +V Y   + GT+ + + F    +  SPF++ + +   + + V   G  L P S N  ++   F +  + AG   ++   +D  G +  +E  +++R ++    Y  ++ PT  G H + +  A + +P +P+   +     P   + IG G+ P G  +  +    F +    AG G++++++  P            G GV+  +Y PT  G + +T+ +    +   PF V+V       +C  +  V+ +       I+  +     E  I   +  L  + E  S     +E ++ G+G+  + Y P E  EY V +      I    F    +       +    ++ K++                P EF +     G   +   V    G    A V DN NG+ +  Y PR+   H   V+  G+ I  SP++    N G G    KV  YGPG++  +TGL    P  FT+   +AG G +S+ I+      GP++A+I      N+N +  V Y P   G Y+I++ FAD   P SP    +  EP               R+ + +G  +   +         L       SG  +   ++ +      ++   + + P + G   +NV   G HI  SPF   VG +   D SK++V G G K  +  +   FTV ++ AG  G ++  I  PS A + C+       DN      V + P E G Y + + Y    V GSPF ++     +PS     K+            GS    T+    T  +        + G  E   E +D  DG  S+ ++P E G + + +   + HIPGSPF+  V P  D  A KV  SG GL+        +F +    AG+  L+I I  E    AE+  +D  DG+  + Y    PG Y  +IK+    + N P ++ V E  +D   V   G     +         F+V+  +  T      ++A +  PS       +Q+     Y + + P E G H ++VT +     +P SPF+V +  +  DP  V   G G+ SG   K N F V T  +GTG L + ++GPS+ ++   +N++G   + YIP   G Y + V YGG + + GSPF            ++ VH  ++                    A KV+C G G+    +  N   +F VD S+AG   L V + GPK   E V V         +NY+   +G + + V +GE+ +P SPF V VL
Sbjct:  277 PKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEP-SGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDST---YRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVKETA--DFKVYTKGAGSGELKVTVKGPKGEERVKQKDL-GDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKV-----GTECGNQK-VRAWGPGLEGGIVGKSADFVVEA-IGDDVGTLGFSVEGPSQAK--IECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPF----MADIREAPQDFHPDRVKARGPGLEKTGVAVNK---PAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRV---NVGAGSHPNKVKVYGPGVA--KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKV--EPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQF---SGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFS--VGVSPSLDLSKIKVSGLGDKVDVGKDQE-FTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPS-----KVKAFGPGLQGGNAGSPARFTID---TKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFD--ASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQV-EPAVDTSGVQCYGPGIEGQGVFREATTEFSVDA-RALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYD--GSPVPSSPFQVPV-TEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGG-HQVPGSPF------------KVPVHDVTD--------------------ASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVL 1540          

HSP 5 Score: 275.789 bits (704), Expect = 1.518e-73
Identity = 310/1165 (26.61%), Postives = 482/1165 (41.37%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDI--QXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIV---PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTD---YTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQ--------------RRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIE------GPSKAEIE---CRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADIT--QVGSQCELTL--KVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEIDFEDR----KDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMV----NEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIK-KATLNQVNT-FNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +      +F ++   AGQG++   +               ++    F   Y P   G H +TV F    +   PF V V +  GDA+K   +    E                AG G     +V   P  + G V+  L      E  G+ T    Y P     + V + F GV IP   +        N           + +    + ET D   YT G            G+  ++  V  P G  E     D  +G     Y P   G + + +T  G  I  SP++       G  KV A+GPGL  G  G  A+F +       G L  ++EGPS+A+I C D  +GSCDV Y+P   G+Y++ +     +I  SPF+A+I   PQ               ++ + +   ++  +   +   + L   V+   G      +K   N     S+ PR+   H   V   G  I  SPF++ VG       +KV+V+G G+ K G+ ++E   FTVD  EAG G +S+ I+      GP++A+I+    R++ D T  V YTP   G+Y I + +A++    SP  VK+  EPS     K+  +    + T  ++G     T+  K  G    D++ +           +IID  D  Y++K+IP + G   V V +   HIP SPF   V P +D    KV   G+ + +G      EF++ ++ AG  G ++  I  PS A +  +       D S  V++   E G Y   + ++   +  SPF +         ++        G NA       G PA FT++    T     G L  T+ GP   +   +         ++ ++P E G++ IN+     + HIPGSPF+  +     D   V   G GL     G+   F V+  ++G+  L + I  +     ++Y Q++ +G   I YIP  PG Y +T+KYGG       P         N  S++ V       VDT G                VQC+G GI+ +    +  T F+VDA   +Q G   +   +A P     +  V+  G   + + Y   E+G H + V +    +P SPF V V
Sbjct:  269 LKPGAP----LRPKLNPKKARAYGPGIEPTGNMVKKRA--EFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQL------EARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVK-ETADFKVYTKGA-----------GSGELKVTVKGPKG-EERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS--HPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDND-TFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKV--EPSHD-ASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKD---QEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADNSV-VRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNA-------GSPARFTID----TKGAGTGGLGLTVEGPCEAQLECLDNG--DGTCSVSYVPTEPGDYNINIL--FADTHIPGSPFKAHVAPCF-DASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQ------PVP-------NFPSKLQVEP----AVDTSG----------------VQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPV 1349          

HSP 6 Score: 191.815 bits (486), Expect = 5.056e-48
Identity = 205/794 (25.82%), Postives = 338/794 (42.57%), Query Frame = 3
Query:  669 KPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDG-VNIPGSPFTIQIK-PEI-------DISKVFVENLQ--TTIFQESFIR-FVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            KP    ++TK+A +     L +    K E     N D    ++YL   P         N +  PG+P T+++  +        +    L  G  A+  ++        L  T+   +G+     ++ +  +      ++ P   G + + V+   + +  SP  V I ++  GD S+V+V G G+ +          FII T DAG G +S  +  PS  K  IN +  ++   + RV Y   E G + INI  +   +  SPF V V+     K  +++ R    +   +G   +  +         +  ++ SP       +I E   + +   ++P++ GM+ + + Y    V  SPF+  V P        + A GPGL    VG  A F +       G L  ++EGPS+A+I   D +DGS  + Y    PG+Y V +  + E IP+SP++  +  ++   D  ++ V    +Q+ G+ +N P  F +     K  I  +A   + SG      ++     KY   + P  +G + + V  +   +P SPFK++V +P    +P  V   G GL      +PA F ++T+NAG G L+V I+       P  +  D     + + V Y P   G  Y  SI+Y G  +I GSPF  ++  P +       + S VFV++L    T+ Q +       +   + AKG G  KA     S+F     K+G+                 +VK  G   YS SY   D G Y L V + D  I  SP+ I V
Sbjct: 1874 KPATFTVNTKDAGEGGLS-LAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDD------SMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRL--RNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAE--FIIDTRDAGYGGLSLSIEGPS--KVDINTEDLEDG--TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKE-SITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPV--ASPSGDARRLTVSS--LQESGLKVNQPASFAVSLNGAKGAI--DAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDG------PSKVKMDCQECPEGYRVTYTPMAPG-SYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2638          
BLAST of Filamin vs. Ensembl Mouse
Match: Flna (filamin, alpha [Source:MGI Symbol;Acc:MGI:95556])

HSP 1 Score: 1296.18 bits (3353), Expect = 0.000e+0
Identity = 771/2005 (38.45%), Postives = 1153/2005 (57.51%), Query Frame = 3
Query:  855 LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSG----DKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKL--LSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTTGVVGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIEC-------CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLS-NDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKV--FVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISG-------SVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
             +P++V+  GPG+E   +   + AEFTVDA  AG+  L + + DN G  ++  +++  +    Y C+Y P     +T  V +    IP SPF+V +   S  P+KVKV GPG+ + G+     TYF +   +AG G++S  +    G     +  I+  I +    ++ V+YT    G ++I +  +      SP  V V P  +A  V   G G+   G+ +G    F ++ + AG GKL+V+   L+   +   V I + + N +   YIP + G   + + Y    + +SPF + V P+   S I   G G    V GK   F   + G    G +   I  PS A + C        DN    + + + P   G Y V +  DG  +P SP+ +  + P    T  SK+K +GPG+Q  G    SP  FTID     +          C   E  +     G+      Y P   G++ + +   +  +P SPFK  VA   + + V+  G GL  AT      F +D ++AG   L +EI  E G  LP  +   D       + Y P   G  Y  +I+Y G  +P  P  +Q++P +D S V  +   ++   +F+E+   F V+A+A+   G   VKA   +PS   + + V+  GDG+Y   Y+PY+ G + +DVTY+  P+ +SPF + V  GCDPS+V V G G++ G TN+PN FT++  GAG G LGLA+EGPS+AK++C DN DG+C+VEY     GTY + + +    V GSPFK+P+ D  + + VKC G  L+PG + R + P +F VD S+AG APL+   +  +G   P+++    +   G   + +VP+  G ++I + +    VP +PF   +LP  +  KVK  G G+  TG  +  S+PV+F ID  +AG+G + + +++P+       I D   G +   Y P   G++ I + +    +   P+ V  +  GDA+KC +   G+   I +  ET+IT++T  AG+GK++C +   T +G       + V++  N +GT  I+Y+  +  +Y++ ++FGG  +PN  F+                  T  +         D T+ + P +  +P ++    +   V  PSG      + DN +G+VT+RY P E G+HEM++  D + I GSP +F+ +    G + AYGPGL+HG    PA FT+ TKDAG GGLSLAIEGPSKAEI C DN++G+C V+Y P++PGDYSI++K+ D +IPGSPF A + G+   R S + +GS +D+P+ I+  D+S LTA+V  PSG+EE C+LK++ N ++GISF P+E G H ++V ++G H+  SP  +V+ Q+EIGDAS+VRV G+GL  G + E   F +DTR+AGYGGLSLSIEGPSK +I   D  DGTC+V+Y P+EPG Y+INIK+A++HV GSPF+VK+TGE   ++ E I  ++ A  +  +GS C+L+LK+P     DM A VT+  G T   EI++ ++  Y I+F+P EMG+HTV V+++  H+PGSPFQFTVGP+ +GGAHKV A G GL+      P EF I+TREAGAGGL+IA+EGPSKAEI FEDRKDGSCGV Y V EPG+Y  S+KFN++HI +SPF + V     D   ++V+S+ ++ L     + +PA+F V+        + G + A +  PS   E   +  I++++YA+RFIP+E+G +LI+V  +    HIPGSPF++ +G+     DPG+V A G GL  G  G    FIVNT N+G G L+VTIDGPSKV++  QE  EGY   Y P APG Y I++KYGG YHI GSPF A ++G       S++++S ++V   S  KV TV     TS P  + V+ KV   GLG+ KA + Q + F VD S+AGN++L VG+ GP++ CEE+ VKHMG   + ++YL+++KG + L+VKWG+++IPGSP+ + V
Sbjct:  646 FHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKD--NGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS-HPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDV-GKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAP----TKPSKVKAFGPGLQ--GGNAGSPARFTIDTKGAGTGGLGLTVEGPC---EAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAG--LPAEVYIQDHGDGTHTITYIPLCPG-AYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMV-RANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNAD---GTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG--VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTV--CTPDGS-----EVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQ-----------------VTIPERPMVGVNGLDVTS-LRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGE--GRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGL----KVNQPASFAVSLNG-----AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDV--KFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFV--DSLTKVATV-PQHATSGPGPADVS-KVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2582          

HSP 2 Score: 1143.64 bits (2957), Expect = 0.000e+0
Identity = 772/2281 (33.84%), Postives = 1140/2281 (49.98%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHA-NKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINC-------TDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAG--------EAPLKAC--CKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV-APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG--RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVPLKI--------NNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGIS-NEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGT-HHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNAL-AKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  ++ I +LQ D SDG+RL+ L+EVLS+ K     N+R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ E+      KQTPKQR++ WI  ++P+  + N + DW  G A+GALVDSCAPGLCPDW  W     + + +EAM  A+ WL +PQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YGPGIE    +  + AEFTV+  SAG+G + + + D AG   + K+    DK   +   Y P   GT+ +TV +A + I +SPF+V +DK+ GD SKV  +GPG+E +G I + +TYF I T  AG GE+  V+  P+G K  + P++     ++YR  Y     GVH++++  +   I  SP+ V V    N       GRG+Q  G+RV + A+F + T+ AG+G+L V +  P K EE VK  ++    +   Y P+ PG Y + I +    + RSPF++ V        + A+GPGL  G+VGK+A FV +  G ++G+LGFS+EGPS+AKIEC D  DGS  + YWP   GEYAVH+LC+ EDI  SP+MA+I  + +     ++K  GPG++K GVA+N P EFT+D  ++              G  +   +   GN  Y C Y P     H   VS    S+P SPF+V V   S+PN V+V G G+       + P YF++D T AG G++++ I    G + P     D      D+D F V Y P  +G  Y   + +     P SP  ++++P  D SKV  E     +T +       F VNAK     GKG +   F   S    G  V+      + D +Y+  Y P   G   ++VTY    I  SPF++ V P  D SK+ V G G +        F        GQG +   I  PS A + C        DN      V +     G Y++ + ++ V V GSPF L    P   + VK FG  L  G+      P  FT+D   AG        E P +A   C DN                 G   +++VPTE G + I I  A+  +PG+PF  ++ P  +  KVK  G G+   T G +      QF +D S AG  ++ + + +   L     I D G G     Y P   G + +T+ +   PV N P  ++V    D +      GV+ Y        +    T   E  +  R +  T    VK+ ++ P        +++ G+GT  + Y+P E   + VD+ + G  +P+  F+           E  +  + +      ++ TT+  N  + VE R     G   +   V  PS  + S +  DN +GS ++ Y P E G + +NVT  G Q+ GSP+K    +     KV   GPGLS G  R  LP  F + T  AG   L + ++GP      +   DN +G+  V Y P   G YSI + + +  +P SPF   ++           G   +T+ VP  +         +     L   +  P GK +   ++   +    +++ P   G + I +   G  I  SP+++       GDASK  V G G+   I   E    TVDT+ AG G ++ ++  P  S+ +++  +N DGT  + YT  +PG Y+I +++  EHV  SPF V I         E+ +      D+T   S     L +P T    ++   V    G      I D  DG  ++++ P E GLH + +++ NMHIPGSP QF V  +  G    + A G GL  G  + P  F++ T++AG GGLS+AIEGPSKAEI   D +DG+C V Y    PG+Y   +K+ND HI  SPF   V             GD+++      +G  A   +N  +T        L AT+V PS  EEP +++ +      I F+PKE+GEHL++V      +H+  SP  VVI Q    D   V   G GL  G   +   FI++T ++G G L+++I+GPSKV + +++ E+G     Y P+ PG Y I +K+  + H+ GSPF+  ++G                  +   K  +T      SVA       L +K   + +++  ++ A           +  P  +  E  +     + + I ++  E G H + VK+  +++PGSPF
Sbjct:    7 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLD-RESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWD-EEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDA-KHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAG-SYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAK---TAGKGKLDVQF---SGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNAG---SPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGD---------------GTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVG-----QFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTS------GVQCYGPGIEGQGVFREATT--EFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQ-------VPVTEGCDPSRVRVHGPGIQSGTTNKPN-KFTVETR---GAGTGGLGLAVEGPSEAKMSCM--DNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRA--VPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTIP--------ERPMVGVNGLDVT---SLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCG---HITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVT------------GDDSMRMSHLKVGSAADIPINISETDL----SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKK--NGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKF-ADQHVPGSPFSVKVTG------------------EGRVKESITRRRRAPSVANIGSHCDLSLK---IPEISIQDMTAQ----------VTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPF 2162          

HSP 3 Score: 338.191 bits (866), Expect = 1.352e-92
Identity = 357/1335 (26.74%), Postives = 568/1335 (42.55%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE-LGSLGFSIEGP--SEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPG--CDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINR---------VDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE--PDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGK-GVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQ-VGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDG-IQIQGSPYK-------------------FFAEN-----------------AGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF 4658
            P+T   +P++VRV+GPGI+S      +  +FTV+   AG G L + +   +    + K+  + +K       Y P   GTY++ V Y    +P SPFKV +   + D SKVK  GPG+    V  +    F + T  AG   +   V  P G  + ++  +   +  +  V Y     G +SI++     ++  SPF V V P  +A  V  SG G+ + G+      EF ID ++AG G L V++  PE   +   I + +   +   Y+P  PG Y + I Y    +  SP+++  +PT   S     G G+   + +G+  +   DT     G +  ++  P  SE  ++  +N+DG+  I Y    PG+Y + +   GE +PNSP+   I    E+  V        GV    V    P +  I     K +I  E    +    +  +  +  G    R  Y P   G H++ +  DN  +P SP +  V    N  ++   G GL       PA F+++T +AG G L++ I       +  T   D       V Y P   G  Y+  ++Y+  +IPGSPFT ++  +     + + +L+      S     +N    D      + A    PS  +   ++K   +G    S+ P + G +++ V      + +SP  + +      D S+V V G+GL  G T +P  F ID   AG G L L+IEGPS   IN  D  DGTC V Y  T PG Y I IKF D  V GSPF           +VK  GE     SI R         +      ++         + A      G  +  EI   EN     Y I FVP E+G H + +K+    VPG+PF F + P  E    KV+  G G+  A  G      VP +F I   EAG G + +++  P    + F+   +G  GV    Y   + G + ++V FN+  + + PF+V V    GDA +  +   ++E  L   +      +    +G I  ++   + +G ++       EI+ +     ++ + P E   YL+D+KF G  IP   FK +  +P +  +  +      +  A      T       P EF +  S  GA  +   +  PS ++      +   G   + Y P   G + +++   G   I GSP+K                    F ++                 A + KV A G GLS    G  + FT+    AG   L + + GP     EI+ K   +    V+Y     G+Y++++K+ D +IPGSP+
Sbjct: 1324 PVTEGCDPSRVRVHGPGIQSG--TTNKPNKFTVETRGAGTGGLGLAVEGPS----EAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVT-DASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVD--VVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTI---PERPMV--------GVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVR--YSPSEAGLHEMDIRYDNMHIPGSPLQFYVDY-VNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCT---DNQDGTCSVSYLPVLPGD-YSILVKYNDQHIPGSPFTARVTGD---DSMRMSHLKVG----SAADIPINISETDLS---LLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPF-----------SVKVTGEGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHT---YCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVG------VPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGV---AYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSS-LQESGLKVNQPASFAVSLNGAKGAIDAKV--HSPSGALEECYV--TEIDQD---KYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGL----VSAYGAGLEGGVTG-----SPAEFIVNTSNAGAGALSVTIDGPSKVKMDC--QECPEG-YRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPY 2578          

HSP 4 Score: 337.806 bits (865), Expect = 2.065e-92
Identity = 294/1026 (28.65%), Postives = 467/1026 (45.52%), Query Frame = 3
Query:  741 LIKPEEMIDPNVDEKAMMTY---------LSQFPNAKVNPGAPITSKLNP----NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTN--GELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQP--SNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQE--SFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCD--PSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSIN----RVDQPITFTVDASRA-GEAPLKACCKDNQGHE-YPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPK---SEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAF 3728
            L++P +++D N D    + Y         +S     +  P +P   K+ P    +KV+  GPG+ +  + A    EFT+DA  AG G L + ITD  GK     I++  +    Y   Y P   G YTI ++Y   +IP SP++V    T GD SK  V G GI    + +   T   + T+ AG G+++C V +P G +  ++  + +    ++ + YTA + G + I +      + NSPF V +  R    +V V+G  + S  +R  D    F   +    G++  ++  P        I +         Y PS+ G++E+ I YDN+ +  SP +  V      HI A+GPGLT GVV K A F  +T   GE G L  +IEGPS+A+I C DNQDG+ ++ Y P  PG+Y++ +  + + IP SP+ A +   ++   +S +KV        G A + P   +   +   +     A+    SG E P ++    N      + P   G H V V  + Q V  SP  V ++Q    + + VRV G+GLH    + PA F IDT +AG+G L++ I    G       + D +     V Y P   G  Y  +I++   ++PGSPF++++  E  + +      +        S     +    I  +    + A  T PS     + +    + +Y   + P + G + + V Y+   +  SPF   V P  +    KV   G GLE      P  F I    AG G L +A+EGPS A+I+  D  DG+C V Y    PG Y++ +KFN+  +  SPF +P+  P   A        LT  S+     +V+QP +F V  + A G    K         E Y  EI   +      Y + F+P E G + I++K     +PG+PF   +       +P  V   G G+    G +T S P +F ++ S AG G + +++  P  + +      EG   +   YTP   G + I++ +
Sbjct: 1469 LVEPVDVVD-NADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQD--NHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPT-GDASKCTVTGAGIGPT-IQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVD--VVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTIPERP---MVGVNGLDVTS--LRPFDLVIPFTIKK----GEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGE-GGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVT-GDDSMRMSHLKV--------GSAADIPINISETDLSLLT-----ATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIE---GPSKVDINTEDLEDGTCRVTYCPTEPG-NYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQ---DMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARR------LTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDK------YAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLE---GGVTGS-PAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEG---YRVTYTPMAPGSYLISIKY 2437          

HSP 5 Score: 311.612 bits (797), Expect = 1.779e-84
Identity = 347/1352 (25.67%), Postives = 572/1352 (42.31%), Query Frame = 3
Query: 2895 PGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPI-RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLE--IKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG----KVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGLSLAIE------GPSKAEIVCK--DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQR-------------RSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMP-----NDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAG-YGGLSLSIEGPSKAEIECR-------DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITG--EPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEV-CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAI--EGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATL--NQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P  +P K   +G G+E  G    +   FT++   AGQG + + +E P+    +AK+   ++ + T +V Y   + GT+ + + F    +  SPF++ + +   + + V   G  L P S N  ++   F +  + AG   ++   +D  G +  +E  +++R ++    Y  ++ PT  G H + +  A + +P +P+   +     P   + IG G+ P G  +  +    F +    AG G++++++  P            G GV+  +Y PT  G + +T+ +    +   PF V+V       +C  +  V+ +       I+  +     E  I   +  L  + E  S     +E ++ G+G+  + Y P E  EY V +      I    F     +            + K++                P EF +     G   +   V    G    A V DN NG+ +  Y PR+   H   V+  G+ I  SP++    N G G    KV  YGPG++  +TGL    P  FT+   +AG G +S+ I+      GP++A+I      N+N +  V Y P   G Y+I++ FAD   P SP    +  EP               R+ + +G  +   +         L       SG  +   ++ +      ++   + + P + G   +NV   G HI  SPF   VG +   D SK++V G G K  +  +   FTV ++ AG  G ++  I  PS A + C+       DN      V + P E G Y + + Y    V GSPF ++     +PS     K+            GS    T+    T  +        + G  E   E +D  DG  S+ ++P E G + + +   + HIPGSPF+  V P  D  A KV  SG GL+        +F +    AG+  L+I I  E    AE+  +D  DG+  + Y    PG Y  +IK+    + N P ++ V E  +D   V   G     +         F+V+  +  T      ++A +  PS       +Q+     Y + + P E G H ++VT +     +P SPF+V +  +  DP  V   G G+ SG   K N F V T  +GTG L + ++GPS+ ++   +N++G   + YIP   G Y + V YGG + + GSPF            ++ VH  ++                    A KV+C G G+    +  N   +F VD S+AG   L V + GPK   E V V         +NY+   +G + + V +GE+ +P SPF V VL
Sbjct:  253 PKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEP-SGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDST---YRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVKETA--DFKVYTKGAGSGELKVTVKGPKGEERVKQKDL-GDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKV-----GTECGNQK-VRAWGPGLEGGIVGKSADFVVEA-IGDDVGTLGFSVEGPSQAK--IECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPD----RVKARGPGLEKTGVAVNK---PAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRV---NVGAGSHPNKVKVYGPGVA--KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKV--EPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQF---SGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFS--VGVSPSLDLSKIKVSGLGDKVDVGKDQE-FTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPS-----KVKAFGPGLQGGNAGSPARFTID---TKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFD--ASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQV-EPAVDTSGVQCYGPGIEGQGVFREATTEFSVDA-RALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYD--GSPVPSSPFQVPV-TEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGG-HQVPGSPF------------KVPVHDVTD--------------------ASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVL 1516          

HSP 6 Score: 275.404 bits (703), Expect = 2.230e-73
Identity = 310/1165 (26.61%), Postives = 482/1165 (41.37%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDI--QXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIV---PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTD---YTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQ--------------RRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIE------GPSKAEIE---CRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADIT--QVGSQCELTL--KVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEIDFEDR----KDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMV----NEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIK-KATLNQVNT-FNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +      +F ++   AGQG++   +               ++    F   Y P   G H +TV F    +   PF V V +  GDA+K   +    E                AG G     +V   P  + G V+  L      E  G+ T    Y P     + V + F GV IP   +        N           + +    + ET D   YT G            G+  ++  V  P G  E     D  +G     Y P   G + + +T  G  I  SP++       G  KV A+GPGL  G  G  A+F +       G L  ++EGPS+A+I C D  +GSCDV Y+P   G+Y++ +     +I  SPF+A+I   PQ               ++ + +   ++  +   +   + L   V+   G      +K   N     S+ PR+   H   V   G  I  SPF++ VG       +KV+V+G G+ K G+ ++E   FTVD  EAG G +S+ I+      GP++A+I+    R++ D T  V YTP   G+Y I + +A++    SP  VK+  EPS     K+  +    + T  ++G     T+  K  G    D++ +           +IID  D  Y++K+IP + G   V V +   HIP SPF   V P +D    KV   G+ + +G      EF++ ++ AG  G ++  I  PS A +  +       D S  V++   E G Y   + ++   +  SPF +         ++        G NA       G PA FT++    T     G L  T+ GP   +   +         ++ ++P E G++ IN+     + HIPGSPF+  +     D   V   G GL     G+   F V+  ++G+  L + I  +     ++Y Q++ +G   I YIP  PG Y +T+KYGG       P         N  S++ V       VDT G                VQC+G GI+ +    +  T F+VDA   +Q G   +   +A P     +  V+  G   + + Y   E+G H + V +    +P SPF V V
Sbjct:  245 LKPGAP----LRPKLNPKKARAYGPGIEPTGNMVKKRA--EFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQL------EARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVK-ETADFKVYTKGA-----------GSGELKVTVKGPKG-EERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS--HPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDND-TFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKV--EPSHD-ASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKD---QEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADNSV-VRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNA-------GSPARFTID----TKGAGTGGLGLTVEGPCEAQLECLDNG--DGTCSVSYVPTEPGDYNINIL--FADTHIPGSPFKAHVAPCF-DASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQ------PVP-------NFPSKLQVEP----AVDTSG----------------VQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPV 1325          

HSP 7 Score: 191.43 bits (485), Expect = 8.080e-48
Identity = 205/794 (25.82%), Postives = 338/794 (42.57%), Query Frame = 3
Query:  669 KPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDG-VNIPGSPFTIQIK-PEI-------DISKVFVENLQ--TTIFQESFIR-FVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            KP    ++TK+A +     L +    K E     N D    ++YL   P         N +  PG+P T+++  +        +    L  G  A+  ++        L  T+   +G+     ++ +  +      ++ P   G + + V+   + +  SP  V I ++  GD S+V+V G G+ +          FII T DAG G +S  +  PS  K  IN +  ++   + RV Y   E G + INI  +   +  SPF V V+     K  +++ R    +   +G   +  +         +  ++ SP       +I E   + +   ++P++ GM+ + + Y    V  SPF+  V P        + A GPGL    VG  A F +       G L  ++EGPS+A+I   D +DGS  + Y    PG+Y V +  + E IP+SP++  +  ++   D  ++ V    +Q+ G+ +N P  F +     K  I  +A   + SG      ++     KY   + P  +G + + V  +   +P SPFK++V +P    +P  V   G GL      +PA F ++T+NAG G L+V I+       P  +  D     + + V Y P   G  Y  SI+Y G  +I GSPF  ++  P +       + S VFV++L    T+ Q +       +   + AKG G  KA     S+F     K+G+                 +VK  G   YS SY   D G Y L V + D  I  SP+ I V
Sbjct: 1818 KPATFTVNTKDAGEGGLS-LAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDD------SMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRL--RNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAE--FIIDTRDAGYGGLSLSIEGPS--KVDINTEDLEDG--TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKE-SITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPV--ASPSGDARRLTVSS--LQESGLKVNQPASFAVSLNGAKGAI--DAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDG------PSKVKMDCQECPEGYRVTYTPMAPG-SYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2582          
BLAST of Filamin vs. Ensembl Mouse
Match: Flna (filamin, alpha [Source:MGI Symbol;Acc:MGI:95556])

HSP 1 Score: 1296.18 bits (3353), Expect = 0.000e+0
Identity = 772/2019 (38.24%), Postives = 1156/2019 (57.26%), Query Frame = 3
Query:  855 LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSG----DKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKL--LSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTTGVVGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIEC-------CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLS-NDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKV--FVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKT---------KSQFASFRNETTDYTNGM-----YPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISG-------SVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
             +P++V+  GPG+E   +   + AEFTVDA  AG+  L + + DN G  ++  +++  +    Y C+Y P     +T  V +    IP SPF+V +   S  P+KVKV GPG+ + G+     TYF +   +AG G++S  +    G     +  I+  I +    ++ V+YT    G ++I +  +      SP  V V P  +A  V   G G+   G+ +G    F ++ + AG GKL+V+   L+   +   V I + + N +   YIP + G   + + Y    + +SPF + V P+   S I   G G    V GK   F   + G    G +   I  PS A + C        DN    + + + P   G Y V +  DG  +P SP+ +  + P    T  SK+K +GPG+Q  G    SP  FTID     +          C   E  +     G+      Y P   G++ + +   +  +P SPFK  VA   + + V+  G GL  AT      F +D ++AG   L +EI  E G  LP  +   D       + Y P   G  Y  +I+Y G  +P  P  +Q++P +D S V  +   ++   +F+E+   F V+A+A+   G   VKA   +PS   + + V+  GDG+Y   Y+PY+ G + +DVTY+  P+ +SPF + V  GCDPS+V V G G++ G TN+PN FT++  GAG G LGLA+EGPS+AK++C DN DG+C+VEY     GTY + + +    V GSPFK+P+ D  + + VKC G  L+PG + R + P +F VD S+AG APL+   +  +G   P+++    +   G   + +VP+  G ++I + +    VP +PF   +LP  +  KVK  G G+  TG  +  S+PV+F ID  +AG+G + + +++P+       I D   G +   Y P   G++ I + +    +   P+ V  +  GDA+KC +   G+   I +  ET+IT++T  AG+GK++C +   T +G       + V++  N +GT  I+Y+  +  +Y++ ++FGG  +PN  F+   +  +    +     +           SQ            NG+      P +  +P ++    +   V  PSG      + DN +G+VT+RY P E G+HEM++  D + I GSP +F+ +    G + AYGPGL+HG    PA FT+ TKDAG GGLSLAIEGPSKAEI C DN++G+C V+Y P++PGDYSI++K+ D +IPGSPF A + G+   R S + +GS +D+P+ I+  D+S LTA+V  PSG+EE C+LK++ N ++GISF P+E G H ++V ++G H+  SP  +V+ Q+EIGDAS+VRV G+GL  G + E   F +DTR+AGYGGLSLSIEGPSK +I   D  DGTC+V+Y P+EPG Y+INIK+A++HV GSPF+VK+TGE   ++ E I  ++ A  +  +GS C+L+LK+P     DM A VT+  G T   EI++ ++  Y I+F+P EMG+HTV V+++  H+PGSPFQFTVGP+ +GGAHKV A G GL+      P EF I+TREAGAGGL+IA+EGPSKAEI FEDRKDGSCGV Y V EPG+Y  S+KFN++HI +SPF + V     D   ++V+S+ ++ L     + +PA+F V+        + G + A +  PS   E   +  I++++YA+RFIP+E+G +LI+V  +    HIPGSPF++ +G+     DPG+V A G GL  G  G    FIVNT N+G G L+VTIDGPSKV++  QE  EGY   Y P APG Y I++KYGG YHI GSPF A ++G       S++++S ++V   S  KV TV     TS P  + V+ KV   GLG+ KA + Q + F VD S+AGN++L VG+ GP++ CEE+ VKHMG   + ++YL+++KG + L+VKWG+++IPGSP+ + V
Sbjct:  670 FHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKD--NGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS-HPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDV-GKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAP----TKPSKVKAFGPGLQ--GGNAGSPARFTIDTKGAGTGGLGLTVEGPC---EAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAG--LPAEVYIQDHGDGTHTITYIPLCPG-AYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMV-RANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNAD---GTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG--VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTV--CTPDGS-----EVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGE--GRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGL----KVNQPASFAVSLNG-----AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDV--KFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFV--DSLTKVATV-PQHATSGPGPADVS-KVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2638          

HSP 2 Score: 1139.41 bits (2946), Expect = 0.000e+0
Identity = 772/2302 (33.54%), Postives = 1139/2302 (49.48%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHA-NKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINC-------TDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAG--------EAPLKAC--CKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVA-PTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG--RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVPLKI--------NNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGIS-NEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADIT---------------------QVGSQCELTLKVPGT-HHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNAL-AKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  ++ I +LQ D SDG+RL+ L+EVLS+ K     N+R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ E+      KQTPKQR++ WI  ++P+  + N + DW  G A+GALVDSCAPGLCPDW  W     + + +EAM  A+ WL +PQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YGPGIE    +  + AEFTV+  SAG+G + + + D AG   + K+    DK   +   Y P   GT+ +TV +A + I +SPF+V +DK+ GD SKV  +GPG+E +G I + +TYF I T  AG GE+  V+  P+G K  + P++     ++YR  Y     GVH++++  +   I  SP+ V V    N       GRG+Q  G+RV + A+F + T+ AG+G+L V +  P K EE VK  ++    +   Y P+ PG Y + I +    + RSPF++ V        + A+GPGL  G+VGK+A FV +  G ++G+LGFS+EGPS+AKIEC D  DGS  + YWP   GEYAVH+LC+ EDI  SP+MA+I  + +     ++K  GPG++K GVA+N P EFT+D  ++              G  +   +   GN  Y C Y P     H   VS    S+P SPF+V V   S+PN V+V G G+       + P YF++D T AG G++++ I    G + P     D      D+D F V Y P  +G  Y   + +     P SP  ++++P  D SKV  E     +T +       F VNAK     GKG +   F   S    G  V+      + D +Y+  Y P   G   ++VTY    I  SPF++ V P  D SK+ V G G +        F        GQG +   I  PS A + C        DN      V +     G Y++ + ++ V V GSPF L    P   + VK FG  L  G+      P  FT+D   AG        E P +A   C DN                 G   +++VPTE G + I I  A+  +PG+PF  ++ P  +  KVK  G G+   T G +      QF +D S AG  ++ + + +   L     I D G G     Y P   G + +T+ +   PV N P  ++V    D +      GV+ Y        +    T   E  +  R +  T    VK+ ++ P        +++ G+GT  + Y+P E   + VD+ + G  +P+  F+           E  +  + +      ++ TT+  N  + VE R     G   +   V  PS  + S +  DN +GS ++ Y P E G + +NVT  G Q+ GSP+K    +     KV   GPGLS G  R  LP  F + T  AG   L + ++GP      +   DN +G+  V Y P   G YSI + + +  +P SPF   ++           G   +T+ VP  +         +     L   +  P GK +   ++   +    +++ P   G + I +   G  I  SP+++       GDASK  V G G+   I   E    TVDT+ AG G ++ ++  P  S+ +++  +N DGT  + YT  +PG Y+I +++  EHV  SPF V         +   +  QQ A                          V S     L +P T    ++   V    G      I D  DG  ++++ P E GLH + +++ NMHIPGSP QF V  +  G    + A G GL  G  + P  F++ T++AG GGLS+AIEGPSKAEI   D +DG+C V Y    PG+Y   +K+ND HI  SPF   V             GD+++      +G  A   +N  +T        L AT+V PS  EEP +++ +      I F+PKE+GEHL++V      +H+  SP  VVI Q    D   V   G GL  G   +   FI++T ++G G L+++I+GPSKV + +++ E+G     Y P+ PG Y I +K+  + H+ GSPF+  ++G                  +   K  +T      SVA       L +K   + +++  ++ A           +  P  +  E  +     + + I ++  E G H + VK+  +++PGSPF
Sbjct:   31 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLD-RESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWD-EEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDA-KHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAG-SYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAK---TAGKGKLDVQF---SGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNAG---SPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGD---------------GTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVG-----QFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTS------GVQCYGPGIEGQGVFREATT--EFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQ-------VPVTEGCDPSRVRVHGPGIQSGTTNKPN-KFTVETR---GAGTGGLGLAVEGPSEAKMSCM--DNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRA--VPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCG---HITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVT------------GDDSMRMSHLKVGSAADIPINISETDL----SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKK--NGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKF-ADQHVPGSPFSVKVTG------------------EGRVKESITRRRRAPSVANIGSHCDLSLK---IPEISIQDMTAQ----------VTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPF 2218          

HSP 3 Score: 337.035 bits (863), Expect = 3.577e-92
Identity = 357/1356 (26.33%), Postives = 576/1356 (42.48%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE-LGSLGFSIEGP--SEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKV--------YGPGVQK-----------EGVALNS--PNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPG--CDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINR---------VDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE--PDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGK-GVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQ-VGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDG-IQIQGSPYK-------------------FFAEN-----------------AGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF 4658
            P+T   +P++VRV+GPGI+S      +  +FTV+   AG G L + +   +    + K+  + +K       Y P   GTY++ V Y    +P SPFKV +   + D SKVK  GPG+    V  +    F + T  AG   +   V  P G  + ++  +   +  +  V Y     G +SI++     ++  SPF V V P  +A  V  SG G+ + G+      EF ID ++AG G L V++  PE   +   I + +   +   Y+P  PG Y + I Y    +  SP+++  +PT   S     G G+   + +G+  +   DT     G +  ++  P  SE  ++  +N+DG+  I Y    PG+Y + +   GE +PNSP+    +  ++ T  + ++         Y  G Q+            G+ + S  P +  I     K +I  E    +    +  +  +  G    R  Y P   G H++ +  DN  +P SP +  V    N  ++   G GL       PA F+++T +AG G L++ I       +  T   D       V Y P   G  Y+  ++Y+  +IPGSPFT ++  +     + + +L+      S     +N    D      + A    PS  +   ++K   +G    S+ P + G +++ V      + +SP  + +      D S+V V G+GL  G T +P  F ID   AG G L L+IEGPS   IN  D  DGTC V Y  T PG Y I IKF D  V GSPF           +VK  GE     SI R         +      ++         + A      G  +  EI   EN     Y I FVP E+G H + +K+    VPG+PF F + P  E    KV+  G G+  A  G      VP +F I   EAG G + +++  P    + F+   +G  GV    Y   + G + ++V FN+  + + PF+V V    GDA +  +   ++E  L   +      +    +G I  ++   + +G ++       EI+ +     ++ + P E   YL+D+KF G  IP   FK +  +P +  +  +      +  A      T       P EF +  S  GA  +   +  PS ++      +   G   + Y P   G + +++   G   I GSP+K                    F ++                 A + KV A G GLS    G  + FT+    AG   L + + GP     EI+ K   +    V+Y     G+Y++++K+ D +IPGSP+
Sbjct: 1348 PVTEGCDPSRVRVHGPGIQSG--TTNKPNKFTVETRGAGTGGLGLAVEGPS----EAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVT-DASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVD--VVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVR--YSPSEAGLHEMDIRYDNMHIPGSPLQFYVDY-VNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCT---DNQDGTCSVSYLPVLPGD-YSILVKYNDQHIPGSPFTARVTGD---DSMRMSHLKVG----SAADIPINISETDLS---LLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPF-----------SVKVTGEGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHT---YCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVG------VPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGV---AYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSS-LQESGLKVNQPASFAVSLNGAKGAIDAKV--HSPSGALEECYV--TEIDQD---KYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGL----VSAYGAGLEGGVTG-----SPAEFIVNTSNAGAGALSVTIDGPSKVKMDC--QECPEG-YRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPY 2634          

HSP 4 Score: 312.768 bits (800), Expect = 8.903e-85
Identity = 347/1352 (25.67%), Postives = 574/1352 (42.46%), Query Frame = 3
Query: 2895 PGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPI-RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLE--IKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG----KVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGLSLAIE------GPSKAEIVCK--DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQR-------------RSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMP-----NDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAG-YGGLSLSIEGPSKAEIECR-------DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITG--EPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEV-CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAI--EGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATL--NQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P  +P K   +G G+E  G    +   FT++   AGQG + + +E P+    +AK+   ++ + T +V Y   + GT+ + + F    +  SPF++ + +   + + V   G  L P S N  ++   F +  + AG   ++   +D  G +  +E  +++R ++    Y  ++ PT  G H + +  A + +P +P+   +     P   + IG G+ P G  +  +    F +    AG G++++++  P            G GV+  +Y PT  G + +T+ +    +   PF V+V       +C  +  V+ +       I+  +     E  I   +  L  + E  S     +E ++ G+G+  + Y P E  EY V +      I    F    +       +    ++ K++                P EF +     G   +   V    G    A V DN NG+ +  Y PR+   H   V+  G+ I  SP++    N G G    KV  YGPG++  +TGL    P  FT+   +AG G +S+ I+      GP++A+I      N+N +  V Y P   G Y+I++ FAD   P SP    +  EP               R+ + +G  +   +         L       SG  +   ++ +      ++   + + P + G   +NV   G HI  SPF   VG +   D SK++V G G K  +  +   FTV ++ AG  G ++  I  PS A + C+       DN      V + P E G Y + + Y    V GSPF ++     +PS     K+            GS    T+    T  +        + G  E   E +D  DG  S+ ++P E G + + +   + HIPGSPF+  V P  D  A KV  SG GL+        +F +    AG+  L+I I  E    AE+  +D  DG+  + Y    PG Y  +IK+    + N P ++ V E  +D   V   G     +         F+V+  +  T      ++A +  PS       +Q+     Y + + P E G H ++VT +     +P SPF+V +  +  DP  V   G G+ SG   K N F V T  +GTG L + ++GPS+ ++   +N++G   + YIP   G Y + V YGG + + GSPF            ++ VH  ++                    A KV+C G G+    +  N   +F VD S+AG   L V + GPK   E V V         +NY+   +G + + V +GE+ +P SPF V VL
Sbjct:  277 PKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEP-SGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDST---YRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVKETA--DFKVYTKGAGSGELKVTVKGPKGEERVKQKDL-GDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKV-----GTECGNQK-VRAWGPGLEGGIVGKSADFVVEA-IGDDVGTLGFSVEGPSQAK--IECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPF----MADIREAPQDFHPDRVKARGPGLEKTGVAVNK---PAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRV---NVGAGSHPNKVKVYGPGVA--KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKV--EPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQF---SGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFS--VGVSPSLDLSKIKVSGLGDKVDVGKDQE-FTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPS-----KVKAFGPGLQGGNAGSPARFTID---TKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFD--ASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQV-EPAVDTSGVQCYGPGIEGQGVFREATTEFSVDA-RALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYD--GSPVPSSPFQVPV-TEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGG-HQVPGSPF------------KVPVHDVTD--------------------ASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVL 1540          

HSP 5 Score: 275.789 bits (704), Expect = 1.518e-73
Identity = 310/1165 (26.61%), Postives = 482/1165 (41.37%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDI--QXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIV---PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTD---YTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQ--------------RRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIE------GPSKAEIE---CRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADIT--QVGSQCELTL--KVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEIDFEDR----KDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMV----NEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIK-KATLNQVNT-FNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +      +F ++   AGQG++   +               ++    F   Y P   G H +TV F    +   PF V V +  GDA+K   +    E                AG G     +V   P  + G V+  L      E  G+ T    Y P     + V + F GV IP   +        N           + +    + ET D   YT G            G+  ++  V  P G  E     D  +G     Y P   G + + +T  G  I  SP++       G  KV A+GPGL  G  G  A+F +       G L  ++EGPS+A+I C D  +GSCDV Y+P   G+Y++ +     +I  SPF+A+I   PQ               ++ + +   ++  +   +   + L   V+   G      +K   N     S+ PR+   H   V   G  I  SPF++ VG       +KV+V+G G+ K G+ ++E   FTVD  EAG G +S+ I+      GP++A+I+    R++ D T  V YTP   G+Y I + +A++    SP  VK+  EPS     K+  +    + T  ++G     T+  K  G    D++ +           +IID  D  Y++K+IP + G   V V +   HIP SPF   V P +D    KV   G+ + +G      EF++ ++ AG  G ++  I  PS A +  +       D S  V++   E G Y   + ++   +  SPF +         ++        G NA       G PA FT++    T     G L  T+ GP   +   +         ++ ++P E G++ IN+     + HIPGSPF+  +     D   V   G GL     G+   F V+  ++G+  L + I  +     ++Y Q++ +G   I YIP  PG Y +T+KYGG       P         N  S++ V       VDT G                VQC+G GI+ +    +  T F+VDA   +Q G   +   +A P     +  V+  G   + + Y   E+G H + V +    +P SPF V V
Sbjct:  269 LKPGAP----LRPKLNPKKARAYGPGIEPTGNMVKKRA--EFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQL------EARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVK-ETADFKVYTKGA-----------GSGELKVTVKGPKG-EERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS--HPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDND-TFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKV--EPSHD-ASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKD---QEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADNSV-VRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNA-------GSPARFTID----TKGAGTGGLGLTVEGPCEAQLECLDNG--DGTCSVSYVPTEPGDYNINIL--FADTHIPGSPFKAHVAPCF-DASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQ------PVP-------NFPSKLQVEP----AVDTSG----------------VQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPV 1349          

HSP 6 Score: 191.815 bits (486), Expect = 5.056e-48
Identity = 205/794 (25.82%), Postives = 338/794 (42.57%), Query Frame = 3
Query:  669 KPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDG-VNIPGSPFTIQIK-PEI-------DISKVFVENLQ--TTIFQESFIR-FVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            KP    ++TK+A +     L +    K E     N D    ++YL   P         N +  PG+P T+++  +        +    L  G  A+  ++        L  T+   +G+     ++ +  +      ++ P   G + + V+   + +  SP  V I ++  GD S+V+V G G+ +          FII T DAG G +S  +  PS  K  IN +  ++   + RV Y   E G + INI  +   +  SPF V V+     K  +++ R    +   +G   +  +         +  ++ SP       +I E   + +   ++P++ GM+ + + Y    V  SPF+  V P        + A GPGL    VG  A F +       G L  ++EGPS+A+I   D +DGS  + Y    PG+Y V +  + E IP+SP++  +  ++   D  ++ V    +Q+ G+ +N P  F +     K  I  +A   + SG      ++     KY   + P  +G + + V  +   +P SPFK++V +P    +P  V   G GL      +PA F ++T+NAG G L+V I+       P  +  D     + + V Y P   G  Y  SI+Y G  +I GSPF  ++  P +       + S VFV++L    T+ Q +       +   + AKG G  KA     S+F     K+G+                 +VK  G   YS SY   D G Y L V + D  I  SP+ I V
Sbjct: 1874 KPATFTVNTKDAGEGGLS-LAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDD------SMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRL--RNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAE--FIIDTRDAGYGGLSLSIEGPS--KVDINTEDLEDG--TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKE-SITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPV--ASPSGDARRLTVSS--LQESGLKVNQPASFAVSLNGAKGAI--DAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDG------PSKVKMDCQECPEGYRVTYTPMAPG-SYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2638          
BLAST of Filamin vs. Ensembl Mouse
Match: Flna (filamin, alpha [Source:MGI Symbol;Acc:MGI:95556])

HSP 1 Score: 1289.63 bits (3336), Expect = 0.000e+0
Identity = 771/2027 (38.04%), Postives = 1155/2027 (56.98%), Query Frame = 3
Query:  855 LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSG----DKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKL--LSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTTGVVGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIEC-------CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLS-NDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKV--FVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXX---------XXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKT---------KSQFASFRNETTDYTNGM-----YPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISG-------SVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
             +P++V+  GPG+E   +   + AEFTVDA  AG+  L + + DN G  ++  +++  +    Y C+Y P     +T  V +    IP SPF+V +   S  P+KVKV GPG+ + G+     TYF +   +AG G++S  +    G     +  I+  I +    ++ V+YT    G ++I +  +      SP  V V P  +A  V   G G+   G+ +G    F ++ + AG GKL+V+   L+   +   V I + + N +   YIP + G   + + Y    + +SPF + V P+   S I   G G    V GK   F   + G    G +   I  PS A + C        DN    + + + P   G Y V +  DG  +P SP+ +  + P    T  SK+K +GPG+Q  G    SP  FTID     +          C   E  +     G+      Y P   G++ + +   +  +P SPFK  VA   + + V+  G GL  AT      F +D ++AG   L +EI  E G  LP  +   D       + Y P   G  Y  +I+Y G  +P  P  +Q++P +D S V  +   ++   +F+E+   F V+A+A+   G   VKA   +PS   + + V+  GDG+Y   Y+PY+ G + +DVTY+  P+ +SPF + V  GCDPS+V V G G++ G TN+PN FT++  GAG G LGLA+EGPS+AK++C DN DG+C+VEY     GTY + + +    V GSPFK+P+ D  + + VKC G  L+PG + R + P +F VD S+AG APL+   +  +G   P+++    +   G   + +VP+  G ++I + +    VP +PF   +LP  +  KVK  G G+  TG  +  S+PV+F ID  +AG+G + + +++P+       I D   G +   Y P   G++ I + +    +   P+ V  +  GDA+KC +   +  + L            ET+IT++T  AG+GK++C +   T +G       + V++  N +GT  I+Y+  +  +Y++ ++FGG  +PN  F+   +  +    +     +           SQ            NG+      P +  +P ++    +   V  PSG      + DN +G+VT+RY P E G+HEM++  D + I GSP +F+ +    G + AYGPGL+HG    PA FT+ TKDAG GGLSLAIEGPSKAEI C DN++G+C V+Y P++PGDYSI++K+ D +IPGSPF A + G+   R S + +GS +D+P+ I+  D+S LTA+V  PSG+EE C+LK++ N ++GISF P+E G H ++V ++G H+  SP  +V+ Q+EIGDAS+VRV G+GL  G + E   F +DTR+AGYGGLSLSIEGPSK +I   D  DGTC+V+Y P+EPG Y+INIK+A++HV GSPF+VK+TGE   ++ E I  ++ A  +  +GS C+L+LK+P     DM A VT+  G T   EI++ ++  Y I+F+P EMG+HTV V+++  H+PGSPFQFTVGP+ +GGAHKV A G GL+      P EF I+TREAGAGGL+IA+EGPSKAEI FEDRKDGSCGV Y V EPG+Y  S+KFN++HI +SPF + V     D   ++V+S+ ++ L     + +PA+F V+        + G + A +  PS   E   +  I++++YA+RFIP+E+G +LI+V  +    HIPGSPF++ +G+     DPG+V A G GL  G  G    FIVNT N+G G L+VTIDGPSKV++  QE  EGY   Y P APG Y I++KYGG YHI GSPF A ++G       S++++S ++V   S  KV TV     TS P  + V+ KV   GLG+ KA + Q + F VD S+AGN++L VG+ GP++ CEE+ VKHMG   + ++YL+++KG + L+VKWG+++IPGSP+ + V
Sbjct:  670 FHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKD--NGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS-HPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDV-GKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAP----TKPSKVKAFGPGLQ--GGNAGSPARFTIDTKGAGTGGLGLTVEGPC---EAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAG--LPAEVYIQDHGDGTHTITYIPLCPG-AYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMV-RANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNAD---GTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG--VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTV--CTPDGS-----EVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGE--GRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGL----KVNQPASFAVSLNG-----AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDV--KFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFV--DSLTKVATV-PQHATSGPGPADVS-KVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2646          

HSP 2 Score: 1126.31 bits (2912), Expect = 0.000e+0
Identity = 771/2313 (33.33%), Postives = 1139/2313 (49.24%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHA-NKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINC-------TDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAG--------EAPLKAC--CKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV-APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG--RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVPLKI--------NNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRV------------FGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADIT---------------------QVGSQCELTLKVPGT-HHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNAL-AKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  ++ I +LQ D SDG+RL+ L+EVLS+ K     N+R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ E+      KQTPKQR++ WI  ++P+  + N + DW  G A+GALVDSCAPGLCPDW  W     + + +EAM  A+ WL +PQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YGPGIE    +  + AEFTV+  SAG+G + + + D AG   + K+    DK   +   Y P   GT+ +TV +A + I +SPF+V +DK+ GD SKV  +GPG+E +G I + +TYF I T  AG GE+  V+  P+G K  + P++     ++YR  Y     GVH++++  +   I  SP+ V V    N       GRG+Q  G+RV + A+F + T+ AG+G+L V +  P K EE VK  ++    +   Y P+ PG Y + I +    + RSPF++ V        + A+GPGL  G+VGK+A FV +  G ++G+LGFS+EGPS+AKIEC D  DGS  + YWP   GEYAVH+LC+ EDI  SP+MA+I  + +     ++K  GPG++K GVA+N P EFT+D  ++              G  +   +   GN  Y C Y P     H   VS    S+P SPF+V V   S+PN V+V G G+       + P YF++D T AG G++++ I    G + P     D      D+D F V Y P  +G  Y   + +     P SP  ++++P  D SKV  E     +T +       F VNAK     GKG +   F   S    G  V+      + D +Y+  Y P   G   ++VTY    I  SPF++ V P  D SK+ V G G +        F        GQG +   I  PS A + C        DN      V +     G Y++ + ++ V V GSPF L    P   + VK FG  L  G+      P  FT+D   AG        E P +A   C DN                 G   +++VPTE G + I I  A+  +PG+PF  ++ P  +  KVK  G G+   T G +      QF +D S AG  ++ + + +   L     I D G G     Y P   G + +T+ +   PV N P  ++V    D +      GV+ Y        +    T   E  +  R +  T    VK+ ++ P        +++ G+GT  + Y+P E   + VD+ + G  +P+  F+           E  +  + +      ++ TT+  N  + VE R     G   +   V  PS  + S +  DN +GS ++ Y P E G + +NVT  G Q+ GSP+K    +     KV   GPGLS G  R  LP  F + T  AG   L + ++GP      +   DN +G+  V Y P   G YSI + + +  +P SPF   ++           G   +T+ VP  +         +     L   +  P GK +   ++   +    +++ P   G + I +   G  I  SP+++       GDASK  V             G  ++ G   E    TVDT+ AG G ++ ++  P  S+ +++  +N DGT  + YT  +PG Y+I +++  EHV  SPF V         +   +  QQ A                          V S     L +P T    ++   V    G      I D  DG  ++++ P E GLH + +++ NMHIPGSP QF V  +  G    + A G GL  G  + P  F++ T++AG GGLS+AIEGPSKAEI   D +DG+C V Y    PG+Y   +K+ND HI  SPF   V             GD+++      +G  A   +N  +T        L AT+V PS  EEP +++ +      I F+PKE+GEHL++V      +H+  SP  VVI Q    D   V   G GL  G   +   FI++T ++G G L+++I+GPSKV + +++ E+G     Y P+ PG Y I +K+  + H+ GSPF+  ++G                  +   K  +T      SVA       L +K   + +++  ++ A           +  P  +  E  +     + + I ++  E G H + VK+  +++PGSPF
Sbjct:   31 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLD-RESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWD-EEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDA-KHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAG-SYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAK---TAGKGKLDVQF---SGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNAG---SPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGD---------------GTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVG-----QFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTS------GVQCYGPGIEGQGVFREATT--EFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQ-------VPVTEGCDPSRVRVHGPGIQSGTTNKPN-KFTVETR---GAGTGGLGLAVEGPSEAKMSCM--DNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRA--VPTGDASKCTVTVSIGGHGLGAGIGPTIQIG---EETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCG---HITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVT------------GDDSMRMSHLKVGSAADIPINISETDL----SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKK--NGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKF-ADQHVPGSPFSVKVTG------------------EGRVKESITRRRRAPSVANIGSHCDLSLK---IPEISIQDMTAQ----------VTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPF 2226          

HSP 3 Score: 329.331 bits (843), Expect = 7.978e-90
Identity = 355/1364 (26.03%), Postives = 574/1364 (42.08%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLT----------TGVVGKAAIFVTDTNGE-LGSLGFSIEGP--SEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKV--------YGPGVQK-----------EGVALNS--PNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPG--CDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINR---------VDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE--PDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGK-GVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQ-VGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDG-IQIQGSPYK-------------------FFAEN-----------------AGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF 4658
            P+T   +P++VRV+GPGI+S      +  +FTV+   AG G L + +   +    + K+  + +K       Y P   GTY++ V Y    +P SPFKV +   + D SKVK  GPG+    V  +    F + T  AG   +   V  P G  + ++  +   +  +  V Y     G +SI++     ++  SPF V V P  +A  V  SG G+ + G+      EF ID ++AG G L V++  PE   +   I + +   +   Y+P  PG Y + I Y    +  SP+++  +PT  +        +           T  +G+  +   DT     G +  ++  P  SE  ++  +N+DG+  I Y    PG+Y + +   GE +PNSP+    +  ++ T  + ++         Y  G Q+            G+ + S  P +  I     K +I  E    +    +  +  +  G    R  Y P   G H++ +  DN  +P SP +  V    N  ++   G GL       PA F+++T +AG G L++ I       +  T   D       V Y P   G  Y+  ++Y+  +IPGSPFT ++  +     + + +L+      S     +N    D      + A    PS  +   ++K   +G    S+ P + G +++ V      + +SP  + +      D S+V V G+GL  G T +P  F ID   AG G L L+IEGPS   IN  D  DGTC V Y  T PG Y I IKF D  V GSPF           +VK  GE     SI R         +      ++         + A      G  +  EI   EN     Y I FVP E+G H + +K+    VPG+PF F + P  E    KV+  G G+  A  G      VP +F I   EAG G + +++  P    + F+   +G  GV    Y   + G + ++V FN+  + + PF+V V    GDA +  +   ++E  L   +      +    +G I  ++   + +G ++       EI+ +     ++ + P E   YL+D+KF G  IP   FK +  +P +  +  +      +  A      T       P EF +  S  GA  +   +  PS ++      +   G   + Y P   G + +++   G   I GSP+K                    F ++                 A + KV A G GLS    G  + FT+    AG   L + + GP     EI+ K   +    V+Y     G+Y++++K+ D +IPGSP+
Sbjct: 1348 PVTEGCDPSRVRVHGPGIQSG--TTNKPNKFTVETRGAGTGGLGLAVEGPS----EAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVT-DASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVD--VVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVR--YSPSEAGLHEMDIRYDNMHIPGSPLQFYVDY-VNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCT---DNQDGTCSVSYLPVLPGD-YSILVKYNDQHIPGSPFTARVTGD---DSMRMSHLKVG----SAADIPINISETDLS---LLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPF-----------SVKVTGEGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHT---YCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVG------VPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGV---AYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSS-LQESGLKVNQPASFAVSLNGAKGAIDAKV--HSPSGALEECYV--TEIDQD---KYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGL----VSAYGAGLEGGVTG-----SPAEFIVNTSNAGAGALSVTIDGPSKVKMDC--QECPEG-YRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPY 2642          

HSP 4 Score: 312.383 bits (799), Expect = 1.296e-84
Identity = 347/1352 (25.67%), Postives = 574/1352 (42.46%), Query Frame = 3
Query: 2895 PGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPI-RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLE--IKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG----KVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGLSLAIE------GPSKAEIVCK--DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQR-------------RSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMP-----NDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAG-YGGLSLSIEGPSKAEIECR-------DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITG--EPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEV-CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAI--EGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATL--NQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P  +P K   +G G+E  G    +   FT++   AGQG + + +E P+    +AK+   ++ + T +V Y   + GT+ + + F    +  SPF++ + +   + + V   G  L P S N  ++   F +  + AG   ++   +D  G +  +E  +++R ++    Y  ++ PT  G H + +  A + +P +P+   +     P   + IG G+ P G  +  +    F +    AG G++++++  P            G GV+  +Y PT  G + +T+ +    +   PF V+V       +C  +  V+ +       I+  +     E  I   +  L  + E  S     +E ++ G+G+  + Y P E  EY V +      I    F    +       +    ++ K++                P EF +     G   +   V    G    A V DN NG+ +  Y PR+   H   V+  G+ I  SP++    N G G    KV  YGPG++  +TGL    P  FT+   +AG G +S+ I+      GP++A+I      N+N +  V Y P   G Y+I++ FAD   P SP    +  EP               R+ + +G  +   +         L       SG  +   ++ +      ++   + + P + G   +NV   G HI  SPF   VG +   D SK++V G G K  +  +   FTV ++ AG  G ++  I  PS A + C+       DN      V + P E G Y + + Y    V GSPF ++     +PS     K+            GS    T+    T  +        + G  E   E +D  DG  S+ ++P E G + + +   + HIPGSPF+  V P  D  A KV  SG GL+        +F +    AG+  L+I I  E    AE+  +D  DG+  + Y    PG Y  +IK+    + N P ++ V E  +D   V   G     +         F+V+  +  T      ++A +  PS       +Q+     Y + + P E G H ++VT +     +P SPF+V +  +  DP  V   G G+ SG   K N F V T  +GTG L + ++GPS+ ++   +N++G   + YIP   G Y + V YGG + + GSPF            ++ VH  ++                    A KV+C G G+    +  N   +F VD S+AG   L V + GPK   E V V         +NY+   +G + + V +GE+ +P SPF V VL
Sbjct:  277 PKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEP-SGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDST---YRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVKETA--DFKVYTKGAGSGELKVTVKGPKGEERVKQKDL-GDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKV-----GTECGNQK-VRAWGPGLEGGIVGKSADFVVEA-IGDDVGTLGFSVEGPSQAK--IECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPF----MADIREAPQDFHPDRVKARGPGLEKTGVAVNK---PAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRV---NVGAGSHPNKVKVYGPGVA--KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKV--EPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQF---SGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFS--VGVSPSLDLSKIKVSGLGDKVDVGKDQE-FTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPS-----KVKAFGPGLQGGNAGSPARFTID---TKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFD--ASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQV-EPAVDTSGVQCYGPGIEGQGVFREATTEFSVDA-RALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYD--GSPVPSSPFQVPV-TEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGG-HQVPGSPF------------KVPVHDVTD--------------------ASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVL 1540          

HSP 5 Score: 275.404 bits (703), Expect = 2.134e-73
Identity = 310/1165 (26.61%), Postives = 482/1165 (41.37%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDI--QXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIV---PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTD---YTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQ--------------RRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIE------GPSKAEIE---CRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADIT--QVGSQCELTL--KVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEIDFEDR----KDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMV----NEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIK-KATLNQVNT-FNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +      +F ++   AGQG++   +               ++    F   Y P   G H +TV F    +   PF V V +  GDA+K   +    E                AG G     +V   P  + G V+  L      E  G+ T    Y P     + V + F GV IP   +        N           + +    + ET D   YT G            G+  ++  V  P G  E     D  +G     Y P   G + + +T  G  I  SP++       G  KV A+GPGL  G  G  A+F +       G L  ++EGPS+A+I C D  +GSCDV Y+P   G+Y++ +     +I  SPF+A+I   PQ               ++ + +   ++  +   +   + L   V+   G      +K   N     S+ PR+   H   V   G  I  SPF++ VG       +KV+V+G G+ K G+ ++E   FTVD  EAG G +S+ I+      GP++A+I+    R++ D T  V YTP   G+Y I + +A++    SP  VK+  EPS     K+  +    + T  ++G     T+  K  G    D++ +           +IID  D  Y++K+IP + G   V V +   HIP SPF   V P +D    KV   G+ + +G      EF++ ++ AG  G ++  I  PS A +  +       D S  V++   E G Y   + ++   +  SPF +         ++        G NA       G PA FT++    T     G L  T+ GP   +   +         ++ ++P E G++ IN+     + HIPGSPF+  +     D   V   G GL     G+   F V+  ++G+  L + I  +     ++Y Q++ +G   I YIP  PG Y +T+KYGG       P         N  S++ V       VDT G                VQC+G GI+ +    +  T F+VDA   +Q G   +   +A P     +  V+  G   + + Y   E+G H + V +    +P SPF V V
Sbjct:  269 LKPGAP----LRPKLNPKKARAYGPGIEPTGNMVKKRA--EFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQL------EARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVK-ETADFKVYTKGA-----------GSGELKVTVKGPKG-EERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS--HPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDND-TFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKV--EPSHD-ASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKD---QEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADNSV-VRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNA-------GSPARFTID----TKGAGTGGLGLTVEGPCEAQLECLDNG--DGTCSVSYVPTEPGDYNINIL--FADTHIPGSPFKAHVAPCF-DASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQ------PVP-------NFPSKLQVEP----AVDTSG----------------VQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPV 1349          

HSP 6 Score: 191.43 bits (485), Expect = 6.972e-48
Identity = 205/794 (25.82%), Postives = 338/794 (42.57%), Query Frame = 3
Query:  669 KPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDG-VNIPGSPFTIQIK-PEI-------DISKVFVENLQ--TTIFQESFIR-FVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            KP    ++TK+A +     L +    K E     N D    ++YL   P         N +  PG+P T+++  +        +    L  G  A+  ++        L  T+   +G+     ++ +  +      ++ P   G + + V+   + +  SP  V I ++  GD S+V+V G G+ +          FII T DAG G +S  +  PS  K  IN +  ++   + RV Y   E G + INI  +   +  SPF V V+     K  +++ R    +   +G   +  +         +  ++ SP       +I E   + +   ++P++ GM+ + + Y    V  SPF+  V P        + A GPGL    VG  A F +       G L  ++EGPS+A+I   D +DGS  + Y    PG+Y V +  + E IP+SP++  +  ++   D  ++ V    +Q+ G+ +N P  F +     K  I  +A   + SG      ++     KY   + P  +G + + V  +   +P SPFK++V +P    +P  V   G GL      +PA F ++T+NAG G L+V I+       P  +  D     + + V Y P   G  Y  SI+Y G  +I GSPF  ++  P +       + S VFV++L    T+ Q +       +   + AKG G  KA     S+F     K+G+                 +VK  G   YS SY   D G Y L V + D  I  SP+ I V
Sbjct: 1882 KPATFTVNTKDAGEGGLS-LAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDD------SMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRL--RNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAE--FIIDTRDAGYGGLSLSIEGPS--KVDINTEDLEDG--TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKE-SITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPV--ASPSGDARRLTVSS--LQESGLKVNQPASFAVSLNGAKGAI--DAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDG------PSKVKMDCQECPEGYRVTYTPMAPG-SYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2646          
BLAST of Filamin vs. UniProt/SwissProt
Match: sp|Q9VEN1|FLNA_DROME (Filamin-A OS=Drosophila melanogaster OX=7227 GN=cher PE=1 SV=2)

HSP 1 Score: 1818.51 bits (4709), Expect = 0.000e+0
Identity = 968/2246 (43.10%), Postives = 1406/2246 (62.60%), Query Frame = 3
Query:  111 ERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSK-VHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSK--IKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKP-EASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPA-YFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDA---KGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGP-HAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTP-SVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFR------LPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDV--PLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSD---GKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTV------GKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            ER+LA+DAQWK IQ+NTFTRW N HLK  ++SIN+L+ D SDG+RL+ LIEVLS+ +    NKR  FR+QKLENV++ L+FL++ EG+K++NIDSSDIVDC+LKLILGL+W LILHYSISMP+W+GED K ++ S  TPKQR+++WI  ++P+  + N T DW  G A+GALVD+CAPGLCPDW  W P DA+ +  EAM  A+ WLNV QLIKPEE+++PNVDE++MMTYLSQ+PN+K+  GAP+  K NPN+VR YGPGIE    + G  A FTV+ FSAG+G++D+ I    G++    +    DK   Y  +Y P  +G++ + V+++ +DIP+SPF V ++  +GD SKVKV GPGI+ NGV +   T+F I  +DAG G    +++ P+  K  +  K+ Q    ++R EY     G+HS+N+F +   I NSPF V V+P S+A+ V  SGRG+Q+ G+RVGD A+F I T+ AG G+  V+++ P    ++V  ++++ N +EC Y P+K G Y + + +    V +SPF++ V P K S I A+GPGL++GV+G  A FV +TNGE G+LGF++ GPS+A+IEC DN DGSA + Y PTA GEYAVHILCD EDIP SP++A I+P   +TD     +K  GPG++K GV +N P  FT+D    K+   P +       G ++PV + +  +   +  Y P +   H V V+    S P SP +V V  P +   V+  G  L    R   A +F++D   AG   L V+I  E   I       D + + + V   P + G  Y  ++ Y G  +P     + ++  +D+SK+ V+ L+ ++   +   F+V+   + +    GK +  AIF          +V+   D  +   Y+P++AG + +++ Y+++P+  SPF + V  GCDP++   +G GLE G TNQ N FT++  GAG G L LAIEGPS+AK+ CTDN DG+C V+Y +T PG YDI I+F D  + GSPF++ + + ++ + VK +G  +  G + R   P  F VD   AG   +     +++G   P++    E+    IY + +VP + G     ++K + + VP +PF+  + PKSEP KVKV G          TP S+P +F ID  +AGQ DI +++ NP    +   + +   G +   + P + G +  ++ + D  ++  PF +E    G+A KC + +   +     +++ + ++  EAG+G ++C+I     +  V  ++     IE   +G   I Y+ N+  +Y +++KFGG  IPNG F  K ++          IE+  ++    +   ++  NG   + +R      LP+     NV A V  PSG  +  ++ DN +G+V+++Y+PRE G HE+ V  +G  +QGSP+KF  ++   G V AYGPGL+HG TG PA FTI TK A AGGL++A+EGPSKA+I   DN++G+  V Y P  PG+Y + ++F D +I GSP+ A I GE ++R+QI +GS S+V  P  I + D+  L AS++APSG EE C LK+MP  N+GISFTPRE+G H ++V + G HI  SPFK+ V + E+GDA KV+V G GLK G ++  N F+VDTR AG+GGLS+SIEGPSKAEI+C D  DGT  +SY P+EPG Y++N+K+A+ HV GSPF VK+ GE S +  EKI  +++A  IT++GSQC+LT K+PG    D+ A VT+    TE  EI +++DG Y++ F+PKE+G+HTV V++  MHIPGSPFQFTVGP+ D G+H V A G+GL+ G      EF+++TREAG G L+I++EGPSKA+I+F+DRKDGSC V Y VTEPGEY   +KFND HI +SPF++ V+    D   +         +++  G   A   + P    +R +   G+L A IV PS T++   IQ I+   Y++RF P+E+G H I+V  +    HIP SPFR+ +G+  ADP  VHA G+GL     G K  FI+NT N+G G L V+IDGPSKV +   E EEGY+  Y P  PGE+ ITVKY  N HI GSPF  N +G  +  ++    + S + V+TV      GK+    +PT  S A KV   G+G+KKA + + N F++ A+ AGN+IL+VG+ GPK  CEE  VKH G N + + YLV+++G++ L++KWGE++IPGSPF +DV
Sbjct:    4 ERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQD-EGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGHTPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYVTALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILP---RTDFHPELVKASGPGLEKNGVTINQPTSFTVD--PSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKG-AYTTTMTYGGQRVPLGEKVV-VEQTVDVSKIKVDGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSC-AIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHGQV-RESVPTFFNVDVGEAGPGRIAVKLTNSEG--IPVDNLRVEDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK----TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDV-----IEK--DGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQ-QTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLE-------VQQFPQGNIQA---DAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHV--KFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKY-NNMHIVGSPFKVNATG--DKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV 2210          
BLAST of Filamin vs. UniProt/SwissProt
Match: sp|Q80X90|FLNB_MOUSE (Filamin-B OS=Mus musculus OX=10090 GN=Flnb PE=1 SV=3)

HSP 1 Score: 1317.75 bits (3409), Expect = 0.000e+0
Identity = 776/2015 (38.51%), Postives = 1148/2015 (56.97%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQDGS---ATICYWPTAPGEYAVHILCDGEDIPNSPYM--ANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQ-TTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG-EVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNE-----TTDYTN-GMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANIS-------GSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P T   NP+ V+ YGPG+E         AEF VD   AG   L I   D  G+ ID++++   D    Y C+YTP     +TI V +   +IP SP++V I + S  P KVKV GPG+E++G+  +  T+F +   +AG G++S    C     S D++ ++  I   +  ++ V+Y     G ++I +  +S +I  SPF V V P  +A  V   G G+   G+  G    F + T+ AG   LNV+  SP   E +VK  +I  NY       Y P++ G  ++ + Y   P+ +SPF + V  P   S I   G  L   V VGK   F  DTNG    G L  +I  PS   + C          +T  + P   G +AV +  DG  +P SPY   A++ P     D +K+K +GPG+  EG  +  P EFTID     +          C   E  +  S  G+      Y P   G + V +  +   +P SPFK  +  P +P+ V   G GL       P    +D + AG G L +E   + G     ++ N+ D   + V Y P T+G +Y  +++Y G  +P  P  ++++P ID S  K F   ++   +F+E+   F V+++ +   G   +KA  T+PS   +   VK N DG+Y   Y+P++ G ++++VTY+D+PI NSPF + V  GC PS+V   G GL+  FTN+ N FT+   GAG G LG+ +EGPS++KINC DN DG+C+ EY    PG YD+ I +  V + GSPF++P +D ++ + VK  G  L+  S  R   P +FTVD+S+AG APL+      +G   P+ +    +   G + +T+ P++ GP+ + +K+A+  +P +PF   +LP  +  KV   G G++  G  +  S+PV+F ID  +AG+G + + +++ +       + D   G +   Y P   G++ I V +    +   P+ +   Q GDA+KC     G+   +    E    ++   AG+GK++C I  LT +G E ++++     IEN  +GT  I+Y+  +   Y++ ++FGGV IPN  F     D      E   +      F  +  E      +D    G  P +  +P ++    +   V  PSG + +  + DN +G+VT+RY P E G+HEM++   G  I  SP +F+      G V+AYGPGL +G     A FTIVT+DAG GGL LAIEGPSKAEI C DN++G+C VTY P +PGDYSI++K+ D +IPGSPF A I  + +R SQ+ +GS +D  L I+  D+STLTAS++APSG++E C+LK++PN+++GISF PREVG H +++ ++G H+  SP  I+V Q+EIGDA + +V+G+GL  G + EM+ F VDTR+AGYGG+SL++EGPSK +I+  D  DGTC+VSY P+ PG Y+++ K+A+EHV GSPF VKI+GE   ++ E I     A  +  VGS C+L LK+P  + SDM A VT+  G     EI+ +    + ++F+P+EMG+HTV V++R  H+ GSPFQFTVGP+ +GGAHKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI F+D K+GSCGV Y   EPG Y  SIKFND+HI +SP+           + V +  D+A        + +   VN P +  IR   + GK+ A +  PS   E   +  +E ++YA+RFIP E+G H I+V  +    H+ GSPF+V +G+  Q  +P +V A G GL +G  G ++ F +NT  +G G L+VTI+GPSKV++  QE  EGY+ +Y P APG Y I VKYGG  HI+ SPF A ++       GS N++S I V   +    +T      +++P  SS A KV   G G+ KA + Q ++F VD S+AG+++L +G+ GP + CEEVS+KH+G+ Q+ + Y+V+E+G + L VKWGE++IPGSPF V V
Sbjct:  638 PATGDYNPDLVQAYGPGLEKSGCTINNPAEFIVDPKDAGSAPLKILAQDGEGQPIDIQMKSRMD--GTYACSYTPLKAIKHTIAVVWGGVNIPHSPYRVNIGQGS-HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPLPGE-AVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKING--LENRVEVGKDQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTYDGHPVPGSPYTVEASLPP-----DPTKVKAHGPGL--EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPC---EAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKD-GTYAVTYVPLTAG-MYTLTMKYGGELVPHFPAWVKVEPAIDTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVHAQGPGLKEAFTNKSNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLS--SCVRACIPQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGD---GTHTVTYTPSQEGPYIVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSAYG--VPASLPVEFAIDARDAGEGLLAVQITDQEGKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLATGPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVI--LTPDGTEAEADV-----IENE-DGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAMEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYRGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDNRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGE--GRVRESITRTSRAPAVATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPY----------LVPVIAPSDDARCLTVLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDV--KFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLETGTTGIQSEFFINTTQAGPGTLSVTIEGPSKVKMDCQEIPEGYKVMYTPMAPGNYLIGVKYGGPNHISRSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETC----YSAIPKSSSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2601          

HSP 2 Score: 1097.8 bits (2838), Expect = 0.000e+0
Identity = 760/2290 (33.19%), Postives = 1129/2290 (49.30%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHA-NKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSD-IKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTD----------HDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGF-TNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIP---GTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG--EVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII---------GEPQRRSQICIGSTSDVPLKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGI-SNEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKII----------CQQEA----ADITQVGSQCELTLKVP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ +  H  ++R  FR  KLENV++ L FL+  E +KL++IDS  IVD  LKLILGLVW LILHYSISMP+WE E       KQTPKQR++ WI  ++P   + N   +W DG A+GALVDSCAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE+I P+VDE ++MTYLSQFP AK+ PGAP+  KLNP K R YG GIE    +  Q A+FTVD  SAG+G++ + + D  G   + ++    DK   Y   Y P   G + + V +A + I +SPF+V +DK  GD SKV  KGPG+E  G I +  TYF I T  AG G+I   V  P G K+ +   +       YR  Y   + G H + +  +   I  SPFGV +    N      SGRG+Q  G+R+ + A+F +DT+ AG+G+L V +  P+  EE VK        +   Y PS PG Y + + +    + +SPF++ V P      + A+GPGL  G+VG++A FV ++ G E+G+LGF+IEGPS+AKIE  D  DGS  + YWP  PGEYAVHI+CD EDI +SPYMA I P+    +   ++ YGPG++K G  +N+P EF +D  +  S  +K  A      G  I + + S  +  Y C Y PL    H + V     ++P SP++V + Q S+P  V+V G G+  +      P +F++D T AG G+++V I  +        LS+D +          +D F V Y P   G  Y   + +    IP SPF +++ P  D SKV  E     +  +       F V+ K     GK  +   F+ P     G  VK      N D S++  Y+P   G   + VTY   PI  SPF + V    D SK+ +   GLE      +   F ID +GA GQG L + I  PS   + C            +  IP   G + + + ++   V GSP+ +    P +   VK  G  L  G + +   P  FT+D   AG   L          E P E K    +   G   ++++PT+ G + + I    + +PG+PF  +I    +P KV   G G+   G    P +     +D SEAG G + L   +         I +   G +   Y P  AG + +T+ +    V + P  V+V    D +      G+K +        +    T   +  +  R  PLT+ G   +K+ ++ P        +++N +GT  + Y+P E   ++V++ +  V IPN  FK    +         +    K  F +  N  T  T G            G   +   V  PS   ES +   DN +GS +  Y P   G +++N+T  G+ I GSP++  +++     KV   GPGLS   R  +P  FT+ +  AG   L + + GP      +   DN +G+  VTY P   G Y + +K+AD  IP SPF   ++               S   + ++  V   I+  D     L   +    GK +   +    +    +++ P + G + I V   G +I  SP++I   Q   GDASK    G G+   + + E   F VD + AG G ++  I  P  ++AE +  +N DGT  + YT ++PGTY+I +++    +  SPF V  T      + E  +            +EA    +D+  +G +    L +P      ++  TV    G     EI+D  DG  ++++ P E+GLH + +++R  HIP SP QF V     G    V A G GL  G  +    F+I T +AG GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +K+ND HI  SPF   + +            DN    +  +G  A F ++  +T        L A+I  PS  +EP +++ +  N   I FIP+E GEHL+++       H+  SP  +++ Q    D       G GL  G   + + FIV+T ++G G +++ ++GPSKV + +++ E+G  +  Y P+ PG Y ++ K+  + H+ GSPFT  IS                      G+  V    T++S A  V         AT+  +   N+   +  +  +   +  P     E  +  MG+N   + ++ QE G H + VK+  +++ GSPF
Sbjct:    4 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMHHKYHQRPTFRQMKLENVSVALEFLDH-ESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDD-DAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAKGPGLETTGNIANKPTYFDIYTAGAGVGDIGIEVEDPQG-KNSVELLVEDRGNQVYRCVYKPVQPGPHVVKVSFAGDAIPKSPFGVQIGEACNPNACRASGRGLQPKGVRIRETADFKVDTKAAGSGELGVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGCTINNPAEFIVDPKDAGSAPLKILAQ--DGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDA-----RVLSDDEEDVDFDIIHNANDTFTVKYVPPAPG-RYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVHTK---GAGKAPLNVQFSSP---LPGEAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKI--NGLENRVEVGKDQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTYDGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGK---PAEFTIDTKGAGTGGLGLTV------EGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLE-HGKVGEPGI---LCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPAWVKVEPAIDTS------GIKAFGPGIEGKDVFREATT--DFTVDSR--PLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVHAQGPGLKEAFTNKSNVFTVVTRGA-----------GIGGLGITVEGPS---ESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLSSCVRACIPQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYIVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQT--GDASKCLATGPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAMEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFK-PFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYRGSHIPESPLQFYVNYPNSG---SVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITD------------DNRRCSQVKLGSAADFLLDISETDL----STLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK--NGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKF-ADEHVPGSPFTVKIS----------------------GEGRVRESITRTSRAPAV---------ATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPF 2181          

HSP 3 Score: 280.026 bits (715), Expect = 6.570e-74
Identity = 304/1153 (26.37%), Postives = 487/1153 (42.24%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEG--KGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI--------------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKA--------EIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQ----CELTLKVPGTHHSDMRATVTNLYGTTEV--CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEID--FEDRKDGSCGVKYFV-TEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +    P +F +D   AGQGD+ + + +P+       +  +      +  +Y P   G H + V F    +   PF V V +  GDA+K   +    E            +   AG G     I    E+ + K+++ L VE  + GN      Y P +   ++V + F G +IP   F  +  +  N           + +    R ET D+      V+ +   + G+  +   V  P G+ E        +G  +  Y P   G + + VT  G  I  SP++      AG+ KV A+GPGL  G  G  A+F + +  +  G L  AIEGPS+A+I   D  +GSCDV Y+P  PG+Y++ I   D +I  SP++A I               G    +S   I + ++  +   +   + L    +   G+     +K   +     S+TP +   H I V   G +I  SP+++ +GQ       KV+VFG G+ + G+ +NE   FTVD  EAG G +S+ I+  ++         + +   N + T  V Y P  PG Y I + +A++ +  SPF VK+  +PS    +    + E   +++ G +       T+   G   + +    ++      V   +IID  D  +++K+ P + G   V+V +    IP SPF   V   +D    K+    N +++G      EF+I T  AG  G L + I  PS+  +           C    F+  E G +   + ++   +  SP+ +  +    D   V + G     +   +GKPA FT++    T     G L  T+ GP   E      +      ++ ++P + GE+ +N+  E    HIPGSPF+  I +   DP  V A G GL  G VG+     V+   +G G L +    D  +K ++  Q N++G Y   Y+P   G Y +T+KYGG                     E+  H  + +KV+          P   +   K    G+  K         F VD+   +Q G D +   I  P     E  VK      + + Y   EKG H + V + +  IP SPF V V
Sbjct:  242 LKPGAP----LKPKLNPKKARAYGRGIEPTGNMV--KQPAKFTVDTISAGQGDVMVFVEDPEGNKEEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAKGPGLETTGNIANKPTYFDIYTAGAGVGDIGI--EVEDPQGKNSVELLVE--DRGNQVYRCVYKPVQPGPHVVKVSFAGDAIPKSPFGVQIGEACNPNACRASGRGLQPKGVRIR-ETADFK-----VDTK---AAGSGELGVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGCTINNPAEFIVDPKDAGSAPLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAVVWGGVNIPHSPYRVNIGQGS--HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASQEIPASPFRVKV--DPSHDASK---VKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPLPGEAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGKD---QEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTYDGHPVPGSPYTVEASLPP-DPTKVKAHGPGL--EGGLVGKPAEFTID----TKGAGTGGLGLTVEGP--CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFE--EVHIPGSPFKADI-EMPFDPSKVVASGPGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGG---------------------ELVPHFPAWVKVE----------PAIDTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKVAV 1322          

HSP 4 Score: 182.57 bits (462), Expect = 2.330e-44
Identity = 193/762 (25.33%), Postives = 319/762 (41.86%), Query Frame = 3
Query:  771 NVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAK-LVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIM-PSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDGVN-IPGSPFTIQIKPEI--------DISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            N D    +TYL   P         N K  PG+P T+K+  +  R          +  G  A+F +D        L  +I   +G+     ++ +P+  N    ++ P   G + ++++     +  SP  + + ++  GD  + KV G G+ +      +   FI+ T DAG G IS  V  PS    K++ +       + +V Y     GV+ ++   +   +  SPF V +S     +  +T + R        VG   +  +      +  ++  + SP       +I  +  N     ++P + G++ + + Y    VT SPF+  V P        + A GPGL  G  G  A F +       G L  ++EGPS+A+I   D+++GS  + Y    PG Y V I  + E IP+SPY+  ++ PS++   ++ + +     Q+ G+ +N P  F I     K  I  +A   + SG      +S     KY   + P  +G H + V  +   V  SPFKV+V +P    NP  V   G GL + T    + F I+TT AG G L+V I        P  +  D     + + V Y P   G  Y   ++Y G N I  SPF  ++  +         + S + VE++    T     +  +   +A  + +KG G  KA     SSF     K+GS                  +K  G   Y+ +Y   + G Y+L V + +  I  SPF++ V
Sbjct: 1871 NKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDNRRC-------SQVKLGSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPN--NHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSD--FIVDTRDAGYGGISLAVEGPS----KVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVRESITRTSRAPAV--ATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPVIAPSDDARCLTVLSL-----QESGLKVNQPASFAIRLNGAKGKI--DAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLETGTTGIQSEFFINTTQAGPGTLSVTIEG------PSKVKMDCQEIPEGYKVMYTPMAPG-NYLIGVKYGGPNHISRSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKSSSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2601          
BLAST of Filamin vs. UniProt/SwissProt
Match: sp|O75369|FLNB_HUMAN (Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2)

HSP 1 Score: 1310.82 bits (3391), Expect = 0.000e+0
Identity = 777/2015 (38.56%), Postives = 1146/2015 (56.87%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQ---DGSATICYWPTAPGEYAVHILCDGEDIPNSPYM--ANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQ-TTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG-EVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNE-----TTDYTN-GMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANIS-------GSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P T   NP+ VR YGPG+E    I    AEFTVD   AG+  L I   D  G+ ID++++   D    Y C+YTP     +TI V +   +IP SP++V I + S  P KVKV GPG+E++G+  +  T+F +   +AG G++S    C     S D++ ++  I   +  ++ V+Y     G ++I +  +S +I  SPF V V P  +A  V   G G+   G+  G    F + T+ AG   LNV+  SP   + +VK  +I  NY       Y P++ G  ++ + Y   P+ +SPF + V  P   S I   G  L   V VGK   F  DT G    G L  +I  PS   + C         ++T  + P   G YAV +  DG  +P SPY   A++ P     D SK+K +GPG+  EG  +  P EFTID     +          C   E  +  S  G+      Y P   G + V +  +   +P SPFK  +  P +P+ V   G GL           S+D + AG G L +E   + G     ++ N+ D   + V Y P T+G +Y  +++Y G  +P  P  ++++P +D S  KVF   ++   +F+E+   F V+++ +   G   +KA   +PS   +   V  N DG+Y   Y+P++ G ++++VTY+D+PI NSPF + V  GC PS+V   G GL+  FTN+PN FT+   GAG G LG+ +EGPS++KINC DN DG+C+ EY    PG YD+ I +    + GSPF++P++D ++ + VK  G  L  G   RV Q  +FTVD+S+AG APL+      +G   P+ +    +   G + +T+ P++ GP+ + +K+A+  +P +PF   +LP  +  KV   G G++  G  +  S+PV F ID  +AG+G + + +++ +       + D   G +   Y P   G++ I V +    +   P+ +   Q GDA+KC     G+   +    E    ++   AG+GK++C +  LT +G E ++++     IEN  +GT  I+Y+  +   Y++ ++FGGV IPN  F     D      E   +      F  +  E      +D    G  P +  +P ++    +   V  PSG   +  + DN +G+VT+RY P E G+HEM++   G  I  SP +F+      G V+AYGPGL +G     A FTIVT+DAG GGL LAIEGPSKAEI C DN++G+C VTY P +PGDYSI++K+ D +IPGSPF A I  + +R SQ+ +GS +D  L I+  D+S+LTAS++APSG++E C+LK++PN+++GISF PREVG H +++ ++G H+  SP  I+V Q+EIGDA + +V+G GL  G + EM+ F VDTR+AGYGG+SL++EGPSK +I+  D  DGTC+VSY P+ PG Y+++ K+A+EHV GSPF VKI+GE   ++ E I     A  +  VGS C+L LK+P  + SDM A VT+  G     EI+ +    + ++F+P+EMG+HTV V++R  H+ GSPFQFTVGP+ +GGAHKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI F+D K+GSCGV Y   EPG Y  SIKFND+HI  SP+           + V +  D+A        + +   VN P +  IR   + GK+ A +  PS   E   +  +E ++YA+RFIP E+G H I+V  +    H+ GSPF+V +G+  Q  +P +V A G GL  G  G ++ F +NT  +G G L+VTI+GPSKV++  QE  EGY+ +Y P APG Y I+VKYGG  HI GSPF A ++       GS N++S I V   +    +T      +++P  SS A KV   G G+ KA + Q ++F VD S+AG+++L +G+ GP + CEEVS+KH+G  Q+ + Y+V+E+G + L VKWGE++IPGSPF V V
Sbjct:  638 PATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMD--GTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS-HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGD-AVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNG--LENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-----DPSKVKAHGPGL--EGGLVGKPAEFTIDTKGAGTGGLGLTVEGPC---EAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKD-GTYAVTYVPLTAG-MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQ--SFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGD---GTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYG--VPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTV--LTPDGTEAEADV-----IENE-DGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGE--GRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPY----------LVPVIAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDV--KFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETC----YSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTV 2601          

HSP 2 Score: 1085.09 bits (2805), Expect = 0.000e+0
Identity = 762/2299 (33.14%), Postives = 1134/2299 (49.33%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTD-----HDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGF-TNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSST---IP---GTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV----APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI-------EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG--EVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVP------LKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGI-SNEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKII----------CQQEA----ADITQVGSQCELTLKVP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ + +   ++R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGLVW LILHYSISMP+WE E       KQTPKQR++ WI  ++P   + N   +W DG A+GALVDSCAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE+I P+VDE ++MTYLSQFP AK+ PGAP+  KLNP K R YG GIE    +  Q A+FTVD  SAG+G++ + + D  G   + ++    DK   Y   Y P   G + +TV +A + I +SPF+V++DK  GD SKV  KGPG+E  G I +  TYF I T  AG G+I   V  P G K+ +   +  +    YR  Y   + G H + IF +   I  SPF V V    N      SGRG+Q  G+R+ +  +F +DT+ AG+G+L V +  P+  EE VK  +     +   Y PS PG Y + I +    + +SPF++ V P      + A+GPGL  G+VG++A FV ++ G E+GSLGF+IEGPS+AKIE  D  DGS  + YWP  PGEYAVHI+CD EDI +SPYMA I P+    +   ++ YGPG++K G  +N+  EFT+D  +  K+ +K  A      G  I + + +  +  Y C Y P+    H + V     ++P SP++V + Q S+P  V+V G G+  +      P +F++D T AG G+++V I  +   +       D D     +D F V Y P  +G  Y   + +    IP SPF +++ P  D SKV  E     +  +       F V  K     GK  +   F  P     G  VK      N D S++  Y+P   G   + VTY   PI  SPF + V    D SK+ +   GLE      +   FT+D  GA GQG L + I  PS   + C   L    T   +ST   IP   G Y + + ++   V GSP+ +    P + + VK  G  L  G + +   P  FT+D   AG   L          E P E K    +   G   ++++PT+ G + + I    + +PG+PF  +I    +P KV   G G+        G L+        +D SEAG G + L   +         I +   G +   Y P  AG + +T+ +    V + P  V+V    D ++  +       +D  +E                  +  +  R  PLT+ G   +K++++ P        + +N +GT  + Y+P E   ++V++ +  V IPN  FK    +         +    K  F +  N  T  T G            G   +   V  PS   ES +   DN +GS +  Y P   G +++N+T  G  I GSP++   ++     KV   GPGL  G R  +   FT+ +  AG   L + + GP      +   DN +G+  VTY P   G Y + +K+AD  IP SPF   ++           G   S+  VP        I+  D     L   +    GK +  I+    +    +++ P + G + I V   G  I  SP++I   Q   GDASK    G G+   + + E   F VD + AG G ++ ++  P  ++AE +  +N DGT  + YT ++PGTY+I +++    +  SPF V  T      + E  +            +EA    +D+  +G +    L +P      ++   V    G T   EI+D  DG  ++++ P E+GLH + +++   HIP SP QF V     G    V A G GL  G  +    F+I T +AG GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +K+ND HI  SPF   + +            D+    +  +G  A F ++  +T        L A+I  PS  +EP +++ +  N   I FIP+E GEHL+++       H+  SP  +++ Q    D       G GL  G   + + FIV+T ++G G +++ ++GPSKV + +++ E+G  +  Y P+ PG Y ++ K+  + H+ GSPFT  IS                      G+  V    T++S A  V         AT+  +   N+   +  +  +   +  P  +  E  +  MG+N   + ++ QE G H + VK+  +++ GSPF
Sbjct:    4 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMYRKYHQRPTFRQMQLENVSVALEFLD-RESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDD-DAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQG-KNTVELLVEDKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTKAAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQ--DGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAG-RYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVYTK---GAGKAPLNVQFNSP---LPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKL--NGLENRVEVGKDQEFTVDTRGAGGQGKLDVTILSPSRKVVPC---LVTPVTGRENSTAKFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGK---PAEFTIDTKGAGTGGLGLTV------EGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEAGLLS--------VDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATT---------------DFTVDSR--PLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGA-----------GIGGLGITVEGPS---ESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVLQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQT--GDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFK-PFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSG---SVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITD------------DSRRCSQVKLGSAADFLLDISETDL----SSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK--NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKF-ADEHVPGSPFTVKIS----------------------GEGRVKESITRTSRAPSV---------ATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPF 2181          

HSP 3 Score: 285.419 bits (729), Expect = 1.305e-75
Identity = 307/1157 (26.53%), Postives = 493/1157 (42.61%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEG--KGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEG--KISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI--------------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYD--------GTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQ----CELTLKVPGTHHSDMRATVTNLYGTTEV--CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEI-----DFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +    P +F +D   AGQGD+ + + +P+       +  +      +  +Y P   G H +TV F    +   PF V V +  GDA+K   +    E +          +   AG G   I   +    E+ + K+ + L VE  + GN      Y P +   ++V I F G +IP   F  +  +  N           + +    R ETTD+      V+ +   + G+  +   +  P G+ E     D  +G     Y P   G + + +T  G  I  SP++      AG+ KV A+GPGL  G  G  A+F + +  +  G L  AIEGPS+A+I   D  +GSCDV Y+P  PG+Y++ I   D +I  SP++A I               G    +S   + + ++  +   +   + L    +   G+     +K   +     S+TP +   H I V   G +I  SP+++ +GQ       KV+VFG G+ + G+ +NE   FTVD  EAG G +S+ I+  ++   E  ++ D         T  V Y P   G Y I + +A++ +  SPF VK+  +PS    +    + E   +++ G +       T+   G   + +     +      V   +IID  D  +++K+ P + G   V+V +    IP SPF   V   +D    K+    N +++G      EF++ TR AG  G L + I  PS+  +         R++ +   K+   E G Y   + ++   +  SP+ +  +    D   V + G     +   +GKPA FT++    T     G L  T+ GP   E      +      ++ ++P + GE+ +N+  E    HIPGSPF+  I +   DP  V A G GL  G VG+     V+   +G G L +    D  +K ++  Q N++G Y   Y+P   G Y +T+KYGG                     E+  H  + +KV+          P   +   KV   G+  K         F VD+   +Q G D +   IA P     E  V       + + Y   EKG H + V + +  IP SPF V V
Sbjct:  242 LKPGAP----LKPKLNPKKARAYGRGIEPTGNMV--KQPAKFTVDTISAGQGDVMVFVEDPEGNKEEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAKGPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEV----EDPQGKNTVELLVE--DKGNQVYRCVYKPMQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIR-ETTDFK-----VDTK---AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWGGVNIPHSPYRVNIGQGS--HPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKV--DPSHDASK---VKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGKD---QEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTA--KFIPREEGLYAVDVTYDGHPVPGSPYTVEASLPP-DPSKVKAHGPG--LEGGLVGKPAEFTID----TKGAGTGGLGLTVEGP--CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFE--EVHIPGSPFKADI-EMPFDPSKVVASGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGG---------------------ELVPHFPARVKVE----------PAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKVAV 1322          
BLAST of Filamin vs. UniProt/SwissProt
Match: sp|P21333|FLNA_HUMAN (Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4)

HSP 1 Score: 1293.1 bits (3345), Expect = 0.000e+0
Identity = 769/2028 (37.92%), Postives = 1160/2028 (57.20%), Query Frame = 3
Query:  855 LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CV--VLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKL--LSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTTGVVGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIEC-------CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLS-NDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKV--FVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXX---------XXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFK-EKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYT--------NGM-----YPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSV------AQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
             +P++V+  GPG+E   +   + AEFTVDA   G+  L + + DN G  ++  +++  +    Y C+Y P     +T  V +    IP SPF+V +   S  P+KVKV GPG+ + G+     TYF +   +AG G++S    C   V+ P+  +  I+  I +    ++ V+YT    G ++I +  +      SP  V V P  +A  V   G G+   G+ +G    F ++ + AG GKL+V+   L+   +   V I + + N +   Y P + G   + + Y   P+ +SPF + V P+   S I   G G    V GK   F   + G    G +   I GPS A + C        DN    + + + P   G Y V +  DG  +P SP+ +  + P    T  SK+K +GPG+Q  G +  SP  FTID     +          C   E  +     G+      Y P   G++ + +   +  +P SPFK  V    + + V+  G GL  AT      F +D ++AG   L +EI  E G  LP  +   D       + Y P   G  Y  +I+Y G  +P  P  +Q++P +D S V  +   ++   +F+E+   F V+A+A+   G   VKA   +PS   + + V+  GDG Y   Y+PY+ G + +DVTY+  P+ +SPF + V  GCDPS+V V G G++ G TN+PN FT++  GAG G LGLA+EGPS+AK++C DN DG+C+VEY     GTY + + +    V GSPFK+P+ D  + + VKC G  L+PG + R + P +F VD S+AG APL+   +  +G   P+++    +   G   + +VP+  GP++I + + +  VP +PF   +LP  +  KVK  G G+  TG  +  S+PV+F ID  +AG+G + + +++P+       I D   G +   Y P   G++ I + +    +   P+ V  +  GDA+KC +   +  + L            ET+IT++T  AG+GK++C +   T +G       + V++  N +GT  I+Y+  +  +Y++ ++FGG  +PN  F+           +  +  ++   Q+   +     +         NG+      P +  +P ++    +   V  PSG      + DN +G+VT+RY P E G+HEM++  D + I GSP +F+ +    G V AYGPGL+HG    PA FT+ TKDAG GGLSLAIEGPSKAEI C DN++G+C V+Y P++PGDYSI++K+ + ++PGSPF A + G+   R S + +GS +D+P+ I+  D+S LTA+V  PSG+EE C+LK++ N ++GISF P+E G H ++V ++G H+  SP  +V+ Q+EIGDAS+VRV G+GL  G + E   F +DTR+AGYGGLSLSIEGPSK +I   D  DGTC+V+Y P+EPG Y+INIK+A++HV GSPF+VK+TGE   ++ E I  ++ A  +  VGS C+L+LK+P     DM A VT+  G T   EI++ ++  Y I+F+P EMG HTV V+++  H+PGSPFQFTVGP+ +GGAHKV A G GL+      P EFSI+TREAGAGGL+IA+EGPSKAEI FEDRKDGSCGV Y V EPG+Y  S+KFN++HI +SPF + V     D   ++V+S+ ++ L     + +PA+F V+        + G + A +  PS   E   +  I++++YA+RFIP+E+G +LI+V  +    HIPGSPF++ +G+     DPG+V A G GL  G  G    F+VNT N+G G L+VTIDGPSKV++  QE  EGY   Y P APG Y I++KYGG YHI GSPF A ++G    S+   +H+ S++ VD++ K+  T  P   +       A KV   GLG+ KA + Q ++F VD S+AGN++L VG+ GP++ CEE+ VKH+G   + ++YL+++KG + L+VKWG+++IPGSP+ V V
Sbjct:  670 FHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKD--NGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS-HPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPA--EADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDV-GKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADN----SVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAP----TKPSKVKAFGPGLQ--GGSAGSPARFTIDTKGAGTGGLGLTVEGPC---EAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAG--LPAEVYIQDHGDGTHTITYIPLCPG-AYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMV-RANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNAD---GTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG--VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTV--CTPDGS-----EVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGE--GRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGL----KVNQPASFAVSLNG-----AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDV--KFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNH-SLHETSSVFVDSLTKA--TCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVV 2646          

HSP 2 Score: 1142.49 bits (2954), Expect = 0.000e+0
Identity = 781/2314 (33.75%), Postives = 1149/2314 (49.65%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHA-NKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINC-------TDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAG--------EAPLKAC--CKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVA-PTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG--RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVPLKI--------NNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRV------------FGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADIT--QVGSQC-------------------ELTLKVPGT-HHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNAL-AKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  ++ I +LQ D SDG+RL+ L+EVLS+ K     N+R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ E+      KQTPKQR++ WI  ++P+  + N + DW  G A+GALVDSCAPGLCPDW  W     + + +EAM  A+ WL +PQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YGPGIE    +  + AEFTV+  SAG+G + + + D AG   + K+    DK   +   Y P   GT+ +TV +A + I +SPF+V +DK+ GD SKV  +GPG+E +G I + +TYF I T  AGTGE+  V+  P G K  + P++     ++YR  Y     GVH++++  +   I  SP+ V V    N       GRG+Q  G+RV + A+F + T+ AG+G+L V +  P K EE VK  ++    +   Y P  PG Y + I +    + RSPF++ V        + A+GPGL  GVVGK+A FV +  G ++G+LGFS+EGPS+AKIEC D  DGS  + YWP   GEYAVH+LC+ EDI  SP+MA+I  + +     ++K  GPG++K GVA+N P EFT+D  ++              G  +  ++   GN  Y C Y P     H   VS    S+P SPF+V V   S+PN V+V G G+       + P YF++D   AG G++++ I    G + P     D      D+D F V Y P  +G  Y   + +     P SP  ++++P  D SKV  E     +T +       F VNAK   A GKG +   F   S    G  V+      + D +Y+  Y+P   G   ++VTY   PI  SPF++ V P  D SK+ V G G E     +   FT+   GA GQG +   I GPS A + C        DN      V +     G Y++ + ++ V V GSPF L    P   + VK FG  L  GS      P  FT+D   AG        E P +A   C DN                 G   +++VPTE G + I I  A+  +PG+PF  +++P  +  KVK  G G+   T G +      QF +D S AG  ++ + + +   L     I D G G     Y P   G + +T+ +   PV N P  ++V    D +      GV+ Y        +    T   E  +  R +  T    VK+ ++ P        +++ G+G   + Y+P E   + VD+ + G  +P+  F+           E  +  + +      ++ TT+  N  + VE R     G   +   V  PS  + S +  DN +GS ++ Y P E G + +NVT  G Q+ GSP+K    +     KV   GPGLS G  R  LP  F + T  AG   L + ++GP      +   DN +G+  V Y P   G YSI + + D  +P SPF   ++           G   +T+ VP  +         +     L   +  P GK +   ++   +    +++ P   G + I +   G  I  SP+++       GDASK  V             G  ++ G   E    TVDT+ AG G ++ ++  P  S+ +++  +N DGT  + YT  +PG Y+I +++  EHV  SPF V         +   +  QQ A   T  Q G Q                       L +P T    ++   V    G      I D  DG  ++++ P E GLH + +++ NMHIPGSP QF V  +  G    V A G GL  G  + P  F++ T++AG GGLS+AIEGPSKAEI   D +DG+C V Y    PG+Y   +K+N+ H+  SPF   V             GD+++      +G  A   +N  +T        L AT+V PS  EEP +++ +      I F+PKE+GEHL++V      +H+  SP  VVI Q    D   V   G GL  G   +   FI++T ++G G L+++I+GPSKV + +++ E+G     Y P+ PG Y I +K+  + H+ GSPF+  ++G                  +   K  +T      SVA       L +K   + +++  ++ A           +  P  +  E  +     + + I ++  E G H + VK+  +++PGSPF
Sbjct:   31 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLD-RESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWD-EEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDA-KHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAG-SYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK---AAGKGKLDVQF---SGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLG-EKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADN----SVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGSAG---SPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGD---------------GTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVG-----QFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTS------GVQCYGPGIEGQGVFREATT--EFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQ-------VPVTEGCDPSRVRVHGPGIQSGTTNKPN-KFTVETR---GAGTGGLGLAVEGPSEAKMSCM--DNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRA--VPTGDASKCTVTVSIGGHGLGAGIGPTIQIG---EETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCG---HVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVT------------GDDSMRMSHLKVGSAADIPINISETDL----SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKK--NGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKF-ADQHVPGSPFSVKVTG------------------EGRVKESITRRRRAPSVANVGSHCDLSLK---IPEISIQDMTAQ----------VTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPF 2226          

HSP 3 Score: 325.865 bits (834), Expect = 6.780e-88
Identity = 354/1362 (25.99%), Postives = 567/1362 (41.63%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLT----------TGVVGKAAIFVTDTNGE-LGSLGFSIEGP--SEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMA--------NIMPSNEKTDVSKIKVYGPGVQK-----------EGVALNS--PNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPG--CDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINR---------VDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE--PDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGK-GVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQ-VGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDG-IQIQGSPYK-------------------FFAEN-----------------AGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF 4658
            P+T   +P++VRV+GPGI+S      +  +FTV+   AG G L + +   +    + K+  + +K       Y P   GTY++ V Y    +P SPFKV +   + D SKVK  GPG+    V  +    F + T  AG   +   V  P G  + ++  +   +  +  V Y     G +SI++     ++  SPF V V P  +A  V  SG G+ + G+      EF ID ++AG G L V++  PE   +   I + +   +   Y+P   G Y + I Y    +  SP+++  +PT  +        +           T  +G+  +   DT     G +  ++  P  SE  ++  +N+DG+  I Y    PG+Y + +   GE +PNSP+          ++ P      ++    Y  G Q+            G+ + S  P +  I     K +I  E      SG      I+   +      Y P   G H++ +  DN  +P SP +  V    N  +V   G GL       PA F+++T +AG G L++ I       +  T   D       V Y P   G  Y+  ++Y+  ++PGSPFT ++  +     + + +L+      S     +N    D      + A    PS  +   ++K   +G    S+ P + G +++ V      + +SP  + +      D S+V V G+GL  G T +P  F ID   AG G L L+IEGPS   IN  D  DGTC V Y  T PG Y I IKF D  V GSPF           +VK  GE     SI R         V      ++         + A      G  +  EI   EN     Y I FVP E+G H + +K+    VPG+PF F + P  E    KV+  G G+          VP +F I   EAG G + +++  P    + F+   +G  GV    Y   + G + ++V FN+  + + PF+V V    GDA +  +   ++E  L   +      +    +G I  ++   + +G ++       EI+ +     ++ + P E   YL+D+KF G  IP   FK +  +P +  +  +      +  A      T       P EF +  S  GA  +   +  PS ++      +   G   + Y P   G + +++   G   I GSP+K                    F ++                 A   KV A G GLS    G  + FT+    AG   L + + GP     EI+ K   +    V+Y     G+Y++++K+ D +IPGSP+
Sbjct: 1348 PVTEGCDPSRVRVHGPGIQSG--TTNKPNKFTVETRGAGTGGLGLAVEGPS----EAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVT-DASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVD--VVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVR--MPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDY-VNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCT---DNQDGTCSVSYLPVLPGD-YSILVKYNEQHVPGSPFTARVTGD---DSMRMSHLKVG----SAADIPINISETDLS---LLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPF-----------SVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHT---YCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLE----RAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGV---AYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSS-LQESGLKVNQPASFAVSLNGAKGAIDAKV--HSPSGALEECYV--TEIDQD---KYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGL----VSAYGAGLEGGVTG-----NPAEFVVNTSNAGAGALSVTIDGPSKVKMDC--QECPEG-YRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPY 2642          

HSP 4 Score: 310.842 bits (795), Expect = 2.700e-83
Identity = 344/1352 (25.44%), Postives = 578/1352 (42.75%), Query Frame = 3
Query: 2895 PGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPI-RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLE--IKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQN-VEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG----KVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGLSLAIE------GPSKAEIVCK--DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQR-------------RSQICIGSTSDVPLKIN-----NLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAG-YGGLSLSIEGPSKAEIECR-------DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITG--EPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEV-CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAI--EGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATL--NQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P  +P K   +G G+E  G    +   FT++   AGQG + + +E P+    +AK+   ++ + T +V Y   + GT+ + + F    +  SPF++ + +   + + V   G  L P S N  ++   F +  + AG   ++   +D  G +  +E  +++R ++    Y  ++ PT  G H + +  A + +P +P+   +     P   + +G G+ P G  +  +    F +    AG G++++++  P            G GV+  +Y P   G + +T+ +    +   PF V+V       +C  +  V+ +       ++  +     E  I   +  L  + E  S     +E ++ G+G+  + Y P E  EY V +      I    F    +       +    ++ K++                P EF +    G +  +   V    G    ALV DN NG+ +  Y PR+   H   V+  G+ I  SP++    N G G    KV  YGPG++  +TGL    P  FT+   +AG G +S+ I+      GP++A+I      N+N +  V Y P   G Y+I++ FAD   P SP    +  EP               R+ + +G  +   +         LD+   +   +  + ++   I     ++   + +TP + G   +NV   G  I  SPF + V  +   D SK++V G G K  +  +   FTV ++ AG  G ++  I GPS A + C+       DN      V + P E G Y + + Y    V GSPF ++     +PS     K+            GS    T+    T  +        + G  E   E +D  DG  S+ ++P E G + + +   + HIPGSPF+  V P  D  A KV  SG GL+        +F +    AG+  L+I I  E    AE+  +D  DG+  + Y    PG Y  +IK+    + N P ++ V E  +D   V   G     +         F+V+  +  T      ++A +  PS       +Q+     Y + + P E G H ++VT +     +P SPF+V +  +  DP  V   G G+ SG   K N F V T  +GTG L + ++GPS+ ++   +N++G   + YIP   G Y + V YGG + + GSPF            ++ VH  ++                    A KV+C G G+    +  N   +F VD S+AG   L V + GPK   E V V         +NY+   +G + + V +G++ +P SPF V VL
Sbjct:  277 PKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEP-SGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQLEARGDST---YRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVKETA--DFKVYTKGAGSGELKVTVKGPKGEERVKQKDL-GDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKV-----GTECGNQK-VRAWGPGLEGGVVGKSADFVVEA-IGDDVGTLGFSVEGPSQAK--IECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPF----MADIRDAPQDFHPDRVKARGPGLEKTGVAVNK---PAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRV---NVGAGSHPNKVKVYGPGVA--KTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKV--EPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQ-FSGLTKGDAVRDVDIIDHH--DNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSL--DLSKIKVSGLGEKVDVGKDQE-FTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADN----SVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPS-----KVKAFGPGLQGGSAGSPARFTID---TKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVVPCFD--ASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQV-EPAVDTSGVQCYGPGIEGQGVFREATTEFSVDA-RALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYD--GSPVPSSPFQVPV-TEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGG-HQVPGSPF------------KVPVHDVTD--------------------ASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVL 1540          

HSP 5 Score: 274.633 bits (701), Expect = 2.519e-72
Identity = 307/1164 (26.37%), Postives = 482/1164 (41.41%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDI--QXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIV---PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTD---YTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQ--------------RRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIE------GPSKAEIE---CRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVG------SQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEIDFEDR----KDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRI-MVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIK-KATLNQVNT-FNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +      +F ++   AGQG++   +               ++    F   Y P   G H +TV F    +   PF V V +  GDA+K   +    E                AG G     +V   P+ + G V+  L      E  G+ T    Y P     + V + F GV IP   +        N           + +    + ET D   YT G            G+  ++  V  P G  E     D  +G     Y P   G + + +T  G  I  SP++       G  KV A+GPGL  G  G  A+F +       G L  ++EGPS+A+I C D  +GSCDV Y+P   G+Y++ +     +I  SPF+A+I   PQ               ++ + +   ++  +   +   + L   V+   G     ++K   N     S+ PR+   H   V   G  I  SPF++ VG       +KV+V+G G+ K G+ ++E   FTVD  EAG G +S+ I+      GP++A+I+    R++ D T  V YTP   G+Y I + +A++    SP  VK+  EPS    +    + E   +++ G      +   +  K  G    D++ +           +IID  D  Y++K+ P + G   V V +    IP SPF   V P +D    KV   G  + +G      EF++ ++ AG  G ++  I GPS A +  +       D S  V++   E G Y   + ++   +  SPF +  V   +   +     G     +  + G PA FT++    T     G L  T+ GP   +   +         ++ ++P E G++ IN+     + HIPGSPF+  +     D   V   G GL     G+   F V+  ++G+  L + I  +     ++Y Q++ +G   I YIP  PG Y +T+KYGG       P         N  S++ V       VDT G                VQC+G GI+ +    +  T F+VDA   +Q G   +   +A P     E  V+  G   + + Y   E+G H + V +    +P SPF V V
Sbjct:  269 LKPGAP----LRPKLNPKKARAYGPGIEPTGNMVKKRA--EFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVIQDPMGQKGTVEPQL------EARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPSACRAVGRGLQPKGVRVK-ETADFKVYTKGA-----------GSGELKVTVKGPKG-EERVKQKDLGDGVYGFEYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVEALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS--HPNKVKVYGPGVAKTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDND-TFTVKYTPRGAGSYTIMVLFADQATPTSPIRVKV--EPSHDASK---VKAEGPGLSRTGVELGKPTHFTVNAKAAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSPFSVAVSPSLDLSKIKVSGLGEKVDVGKD---QEFTVKSKGAGGQGKVASKIVGPSGAAVPCKVEPGLGADNSV-VRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPG----LQGGSAGSPARFTID----TKGAGTGGLGLTVEGPCEAQLECLDNG--DGTCSVSYVPTEPGDYNINIL--FADTHIPGSPFKAHV-VPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQ------PVP-------NFPSKLQVEP----AVDTSG----------------VQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVEYTPYEEGLHSVDVTYDGSPVPSSPFQVPV 1349          

HSP 6 Score: 188.734 bits (478), Expect = 3.186e-46
Identity = 205/796 (25.75%), Postives = 334/796 (41.96%), Query Frame = 3
Query:  669 KPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDG-VNIPGSPFTIQIK-PEI-------DISKVFVENLQTTIFQESFIR---FVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVP 2897
            KP    ++TK+A +     L +    K E     N D    ++YL   P         N +  PG+P T+++  +        +    L  G  A+  ++        L  T+   +G+     ++ +  +      ++ P   G + + V+   + +  SP  V I ++  GD S+V+V G G+ +          FII T DAG G +S  +  PS  K  IN +  ++   + RV Y   E G + INI  +   +  SPF V V+     K  +++ R    +   VG   +  +         +  ++ SP       +I E   + +   ++P++ G + + + Y    V  SPF+  V P        + A GPGL     G  A F +       G L  ++EGPS+A+I   D +DGS  + Y    PG+Y V +  + E IP+SP++  +  ++   D  ++ V    +Q+ G+ +N P  F +     K  I  +A   + SG      ++     KY   + P  +G + + V  +   +P SPFK++V +P    +P  V   G GL       PA F ++T+NAG G L+V I+       P  +  D     + + V Y P   G  Y  SI+Y G  +I GSPF  ++  P +       + S VFV++L                 +A  + AKG G  KA     SSF     K+G+                 +VK  G   YS SY   D G Y L V + D  I  SP+ + VVP
Sbjct: 1882 KPATFTVNTKDAGEGGLS-LAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDD------SMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRL--RNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAE--FIIDTRDAGYGGLSLSIEGPS--KVDINTEDLEDG--TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKE-SITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPV--ASPSGDARRLTVSS--LQESGLKVNQPASFAVSLNGAKGAI--DAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDG------PSKVKMDCQECPEGYRVTYTPMAPG-SYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRV-VVP 2647          
BLAST of Filamin vs. UniProt/SwissProt
Match: sp|Q8BTM8|FLNA_MOUSE (Filamin-A OS=Mus musculus OX=10090 GN=Flna PE=1 SV=5)

HSP 1 Score: 1289.63 bits (3336), Expect = 0.000e+0
Identity = 771/2027 (38.04%), Postives = 1155/2027 (56.98%), Query Frame = 3
Query:  855 LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSG----DKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKL--LSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTTGVVGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIEC-------CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLS-NDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKV--FVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXX---------XXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKT---------KSQFASFRNETTDYTNGM-----YPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISG-------SVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
             +P++V+  GPG+E   +   + AEFTVDA  AG+  L + + DN G  ++  +++  +    Y C+Y P     +T  V +    IP SPF+V +   S  P+KVKV GPG+ + G+     TYF +   +AG G++S  +    G     +  I+  I +    ++ V+YT    G ++I +  +      SP  V V P  +A  V   G G+   G+ +G    F ++ + AG GKL+V+   L+   +   V I + + N +   YIP + G   + + Y    + +SPF + V P+   S I   G G    V GK   F   + G    G +   I  PS A + C        DN    + + + P   G Y V +  DG  +P SP+ +  + P    T  SK+K +GPG+Q  G    SP  FTID     +          C   E  +     G+      Y P   G++ + +   +  +P SPFK  VA   + + V+  G GL  AT      F +D ++AG   L +EI  E G  LP  +   D       + Y P   G  Y  +I+Y G  +P  P  +Q++P +D S V  +   ++   +F+E+   F V+A+A+   G   VKA   +PS   + + V+  GDG+Y   Y+PY+ G + +DVTY+  P+ +SPF + V  GCDPS+V V G G++ G TN+PN FT++  GAG G LGLA+EGPS+AK++C DN DG+C+VEY     GTY + + +    V GSPFK+P+ D  + + VKC G  L+PG + R + P +F VD S+AG APL+   +  +G   P+++    +   G   + +VP+  G ++I + +    VP +PF   +LP  +  KVK  G G+  TG  +  S+PV+F ID  +AG+G + + +++P+       I D   G +   Y P   G++ I + +    +   P+ V  +  GDA+KC +   +  + L            ET+IT++T  AG+GK++C +   T +G       + V++  N +GT  I+Y+  +  +Y++ ++FGG  +PN  F+   +  +    +     +           SQ            NG+      P +  +P ++    +   V  PSG      + DN +G+VT+RY P E G+HEM++  D + I GSP +F+ +    G + AYGPGL+HG    PA FT+ TKDAG GGLSLAIEGPSKAEI C DN++G+C V+Y P++PGDYSI++K+ D +IPGSPF A + G+   R S + +GS +D+P+ I+  D+S LTA+V  PSG+EE C+LK++ N ++GISF P+E G H ++V ++G H+  SP  +V+ Q+EIGDAS+VRV G+GL  G + E   F +DTR+AGYGGLSLSIEGPSK +I   D  DGTC+V+Y P+EPG Y+INIK+A++HV GSPF+VK+TGE   ++ E I  ++ A  +  +GS C+L+LK+P     DM A VT+  G T   EI++ ++  Y I+F+P EMG+HTV V+++  H+PGSPFQFTVGP+ +GGAHKV A G GL+      P EF I+TREAGAGGL+IA+EGPSKAEI FEDRKDGSCGV Y V EPG+Y  S+KFN++HI +SPF + V     D   ++V+S+ ++ L     + +PA+F V+        + G + A +  PS   E   +  I++++YA+RFIP+E+G +LI+V  +    HIPGSPF++ +G+     DPG+V A G GL  G  G    FIVNT N+G G L+VTIDGPSKV++  QE  EGY   Y P APG Y I++KYGG YHI GSPF A ++G       S++++S ++V   S  KV TV     TS P  + V+ KV   GLG+ KA + Q + F VD S+AGN++L VG+ GP++ CEE+ VKHMG   + ++YL+++KG + L+VKWG+++IPGSP+ + V
Sbjct:  670 FHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKD--NGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS-HPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDV-GKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAP----TKPSKVKAFGPGLQ--GGNAGSPARFTIDTKGAGTGGLGLTVEGPC---EAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAG--LPAEVYIQDHGDGTHTITYIPLCPG-AYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMV-RANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNAD---GTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG--VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTV--CTPDGS-----EVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGE--GRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGL----KVNQPASFAVSLNG-----AKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDV--KFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFV--DSLTKVATV-PQHATSGPGPADVS-KVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2646          

HSP 2 Score: 1126.31 bits (2912), Expect = 0.000e+0
Identity = 771/2313 (33.33%), Postives = 1139/2313 (49.24%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHA-NKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINC-------TDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAG--------EAPLKAC--CKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV-APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG--RTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVPLKI--------NNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRV------------FGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADIT---------------------QVGSQCELTLKVPGT-HHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNAL-AKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  ++ I +LQ D SDG+RL+ L+EVLS+ K     N+R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ E+      KQTPKQR++ WI  ++P+  + N + DW  G A+GALVDSCAPGLCPDW  W     + + +EAM  A+ WL +PQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YGPGIE    +  + AEFTV+  SAG+G + + + D AG   + K+    DK   +   Y P   GT+ +TV +A + I +SPF+V +DK+ GD SKV  +GPG+E +G I + +TYF I T  AG GE+  V+  P+G K  + P++     ++YR  Y     GVH++++  +   I  SP+ V V    N       GRG+Q  G+RV + A+F + T+ AG+G+L V +  P K EE VK  ++    +   Y P+ PG Y + I +    + RSPF++ V        + A+GPGL  G+VGK+A FV +  G ++G+LGFS+EGPS+AKIEC D  DGS  + YWP   GEYAVH+LC+ EDI  SP+MA+I  + +     ++K  GPG++K GVA+N P EFT+D  ++              G  +   +   GN  Y C Y P     H   VS    S+P SPF+V V   S+PN V+V G G+       + P YF++D T AG G++++ I    G + P     D      D+D F V Y P  +G  Y   + +     P SP  ++++P  D SKV  E     +T +       F VNAK     GKG +   F   S    G  V+      + D +Y+  Y P   G   ++VTY    I  SPF++ V P  D SK+ V G G +        F        GQG +   I  PS A + C        DN      V +     G Y++ + ++ V V GSPF L    P   + VK FG  L  G+      P  FT+D   AG        E P +A   C DN                 G   +++VPTE G + I I  A+  +PG+PF  ++ P  +  KVK  G G+   T G +      QF +D S AG  ++ + + +   L     I D G G     Y P   G + +T+ +   PV N P  ++V    D +      GV+ Y        +    T   E  +  R +  T    VK+ ++ P        +++ G+GT  + Y+P E   + VD+ + G  +P+  F+           E  +  + +      ++ TT+  N  + VE R     G   +   V  PS  + S +  DN +GS ++ Y P E G + +NVT  G Q+ GSP+K    +     KV   GPGLS G  R  LP  F + T  AG   L + ++GP      +   DN +G+  V Y P   G YSI + + +  +P SPF   ++           G   +T+ VP  +         +     L   +  P GK +   ++   +    +++ P   G + I +   G  I  SP+++       GDASK  V             G  ++ G   E    TVDT+ AG G ++ ++  P  S+ +++  +N DGT  + YT  +PG Y+I +++  EHV  SPF V         +   +  QQ A                          V S     L +P T    ++   V    G      I D  DG  ++++ P E GLH + +++ NMHIPGSP QF V  +  G    + A G GL  G  + P  F++ T++AG GGLS+AIEGPSKAEI   D +DG+C V Y    PG+Y   +K+ND HI  SPF   V             GD+++      +G  A   +N  +T        L AT+V PS  EEP +++ +      I F+PKE+GEHL++V      +H+  SP  VVI Q    D   V   G GL  G   +   FI++T ++G G L+++I+GPSKV + +++ E+G     Y P+ PG Y I +K+  + H+ GSPF+  ++G                  +   K  +T      SVA       L +K   + +++  ++ A           +  P  +  E  +     + + I ++  E G H + VK+  +++PGSPF
Sbjct:   31 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLD-RESIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWD-EEEDEEAKKQTPKQRLLGWIQNKLPQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGP-KGEERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDA-KHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAG-SYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAK---TAGKGKLDVQF---SGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNAG---SPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGD---------------GTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVG-----QFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTS------GVQCYGPGIEGQGVFREATT--EFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQ-------VPVTEGCDPSRVRVHGPGIQSGTTNKPN-KFTVETR---GAGTGGLGLAVEGPSEAKMSCM--DNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRA--VPTGDASKCTVTVSIGGHGLGAGIGPTIQIG---EETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCG---HITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVT------------GDDSMRMSHLKVGSAADIPINISETDL----SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKK--NGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKF-ADQHVPGSPFSVKVTG------------------EGRVKESITRRRRAPSVANIGSHCDLSLK---IPEISIQDMTAQ----------VTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPF 2226          

HSP 3 Score: 329.331 bits (843), Expect = 5.580e-89
Identity = 355/1364 (26.03%), Postives = 574/1364 (42.08%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLT----------TGVVGKAAIFVTDTNGE-LGSLGFSIEGP--SEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKV--------YGPGVQK-----------EGVALNS--PNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPG--CDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINR---------VDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE--PDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGK-GVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQ-VGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDG-IQIQGSPYK-------------------FFAEN-----------------AGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSK--AEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF 4658
            P+T   +P++VRV+GPGI+S      +  +FTV+   AG G L + +   +    + K+  + +K       Y P   GTY++ V Y    +P SPFKV +   + D SKVK  GPG+    V  +    F + T  AG   +   V  P G  + ++  +   +  +  V Y     G +SI++     ++  SPF V V P  +A  V  SG G+ + G+      EF ID ++AG G L V++  PE   +   I + +   +   Y+P  PG Y + I Y    +  SP+++  +PT  +        +           T  +G+  +   DT     G +  ++  P  SE  ++  +N+DG+  I Y    PG+Y + +   GE +PNSP+    +  ++ T  + ++         Y  G Q+            G+ + S  P +  I     K +I  E    +    +  +  +  G    R  Y P   G H++ +  DN  +P SP +  V    N  ++   G GL       PA F+++T +AG G L++ I       +  T   D       V Y P   G  Y+  ++Y+  +IPGSPFT ++  +     + + +L+      S     +N    D      + A    PS  +   ++K   +G    S+ P + G +++ V      + +SP  + +      D S+V V G+GL  G T +P  F ID   AG G L L+IEGPS   IN  D  DGTC V Y  T PG Y I IKF D  V GSPF           +VK  GE     SI R         +      ++         + A      G  +  EI   EN     Y I FVP E+G H + +K+    VPG+PF F + P  E    KV+  G G+  A  G      VP +F I   EAG G + +++  P    + F+   +G  GV    Y   + G + ++V FN+  + + PF+V V    GDA +  +   ++E  L   +      +    +G I  ++   + +G ++       EI+ +     ++ + P E   YL+D+KF G  IP   FK +  +P +  +  +      +  A      T       P EF +  S  GA  +   +  PS ++      +   G   + Y P   G + +++   G   I GSP+K                    F ++                 A + KV A G GLS    G  + FT+    AG   L + + GP     EI+ K   +    V+Y     G+Y++++K+ D +IPGSP+
Sbjct: 1348 PVTEGCDPSRVRVHGPGIQSG--TTNKPNKFTVETRGAGTGGLGLAVEGPS----EAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKVPVHDVT-DASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVD--VVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTILIKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAGKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPSITDNKDGTVTVR--YSPSEAGLHEMDIRYDNMHIPGSPLQFYVDY-VNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCT---DNQDGTCSVSYLPVLPGD-YSILVKYNDQHIPGSPFTARVTGD---DSMRMSHLKVG----SAADIPINISETDLS---LLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPF-----------SVKVTGEGRVKESITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHT---YCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVG------VPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGV---AYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSS-LQESGLKVNQPASFAVSLNGAKGAIDAKV--HSPSGALEECYV--TEIDQD---KYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGL----VSAYGAGLEGGVTG-----SPAEFIVNTSNAGAGALSVTIDGPSKVKMDC--QECPEG-YRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPY 2642          

HSP 4 Score: 312.383 bits (799), Expect = 9.069e-84
Identity = 347/1352 (25.67%), Postives = 574/1352 (42.46%), Query Frame = 3
Query: 2895 PGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPI-RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLE--IKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG----KVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGLSLAIE------GPSKAEIVCK--DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQR-------------RSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMP-----NDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAG-YGGLSLSIEGPSKAEIECR-------DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITG--EPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEV-CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAI--EGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATL--NQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P  +P K   +G G+E  G    +   FT++   AGQG + + +E P+    +AK+   ++ + T +V Y   + GT+ + + F    +  SPF++ + +   + + V   G  L P S N  ++   F +  + AG   ++   +D  G +  +E  +++R ++    Y  ++ PT  G H + +  A + +P +P+   +     P   + IG G+ P G  +  +    F +    AG G++++++  P            G GV+  +Y PT  G + +T+ +    +   PF V+V       +C  +  V+ +       I+  +     E  I   +  L  + E  S     +E ++ G+G+  + Y P E  EY V +      I    F    +       +    ++ K++                P EF +     G   +   V    G    A V DN NG+ +  Y PR+   H   V+  G+ I  SP++    N G G    KV  YGPG++  +TGL    P  FT+   +AG G +S+ I+      GP++A+I      N+N +  V Y P   G Y+I++ FAD   P SP    +  EP               R+ + +G  +   +         L       SG  +   ++ +      ++   + + P + G   +NV   G HI  SPF   VG +   D SK++V G G K  +  +   FTV ++ AG  G ++  I  PS A + C+       DN      V + P E G Y + + Y    V GSPF ++     +PS     K+            GS    T+    T  +        + G  E   E +D  DG  S+ ++P E G + + +   + HIPGSPF+  V P  D  A KV  SG GL+        +F +    AG+  L+I I  E    AE+  +D  DG+  + Y    PG Y  +IK+    + N P ++ V E  +D   V   G     +         F+V+  +  T      ++A +  PS       +Q+     Y + + P E G H ++VT +     +P SPF+V +  +  DP  V   G G+ SG   K N F V T  +GTG L + ++GPS+ ++   +N++G   + YIP   G Y + V YGG + + GSPF            ++ VH  ++                    A KV+C G G+    +  N   +F VD S+AG   L V + GPK   E V V         +NY+   +G + + V +GE+ +P SPF V VL
Sbjct:  277 PKLNPKKARAYGPGIEPTGNMVKKRAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEP-SGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQLEARGDST---YRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVKETA--DFKVYTKGAGSGELKVTVKGPKGEERVKQKDL-GDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKV-----GTECGNQK-VRAWGPGLEGGIVGKSADFVVEA-IGDDVGTLGFSVEGPSQAK--IECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPF----MADIREAPQDFHPDRVKARGPGLEKTGVAVNK---PAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRV---NVGAGSHPNKVKVYGPGVA--KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKV--EPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQF---SGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFS--VGVSPSLDLSKIKVSGLGDKVDVGKDQE-FTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADN----SVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPS-----KVKAFGPGLQGGNAGSPARFTID---TKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILFADTHIPGSPFKAHVAPCFD--ASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQV-EPAVDTSGVQCYGPGIEGQGVFREATTEFSVDA-RALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYD--GSPVPSSPFQVPV-TEGCDPSRVRVHGPGIQSGTTNKPNKFTVETRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGG-HQVPGSPF------------KVPVHDVTD--------------------ASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVL 1540          

HSP 5 Score: 275.404 bits (703), Expect = 1.493e-72
Identity = 310/1165 (26.61%), Postives = 482/1165 (41.37%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDI--QXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIV---PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTD---YTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQ--------------RRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIE------GPSKAEIE---CRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADIT--QVGSQCELTL--KVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEIDFEDR----KDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMV----NEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI--DGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIK-KATLNQVNT-FNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            L PGAP    + PK  P K +  G G+ PTG  +      +F ++   AGQG++   +               ++    F   Y P   G H +TV F    +   PF V V +  GDA+K   +    E                AG G     +V   P  + G V+  L      E  G+ T    Y P     + V + F GV IP   +        N           + +    + ET D   YT G            G+  ++  V  P G  E     D  +G     Y P   G + + +T  G  I  SP++       G  KV A+GPGL  G  G  A+F +       G L  ++EGPS+A+I C D  +GSCDV Y+P   G+Y++ +     +I  SPF+A+I   PQ               ++ + +   ++  +   +   + L   V+   G      +K   N     S+ PR+   H   V   G  I  SPF++ VG       +KV+V+G G+ K G+ ++E   FTVD  EAG G +S+ I+      GP++A+I+    R++ D T  V YTP   G+Y I + +A++    SP  VK+  EPS     K+  +    + T  ++G     T+  K  G    D++ +           +IID  D  Y++K+IP + G   V V +   HIP SPF   V P +D    KV   G+ + +G      EF++ ++ AG  G ++  I  PS A +  +       D S  V++   E G Y   + ++   +  SPF +         ++        G NA       G PA FT++    T     G L  T+ GP   +   +         ++ ++P E G++ IN+     + HIPGSPF+  +     D   V   G GL     G+   F V+  ++G+  L + I  +     ++Y Q++ +G   I YIP  PG Y +T+KYGG       P         N  S++ V       VDT G                VQC+G GI+ +    +  T F+VDA   +Q G   +   +A P     +  V+  G   + + Y   E+G H + V +    +P SPF V V
Sbjct:  269 LKPGAP----LRPKLNPKKARAYGPGIEPTGNMVKKRA--EFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLFAGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGMGEVEVVIQDPTGQKGTVEPQL------EARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNPAACRAIGRGLQPKGVRVK-ETADFKVYTKGA-----------GSGELKVTVKGPKG-EERVKQKDLGDGVYGFEYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVEAIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFMADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSVEATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGS--HPNKVKVYGPGVAKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDND-TFTVKYTPCGAGSYTIMVLFADQATPTSPIRVKV--EPSHD-ASKVKAEGPGLNRTGVELGKPTHFTVNAKTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKSPFSVGVSPSLDLSKIKVSGLGDKVDVGKD---QEFTVKSKGAGGQGKVASKIVSPSGAAVPCKVEPGLGADNSV-VRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGGNA-------GSPARFTID----TKGAGTGGLGLTVEGPCEAQLECLDNG--DGTCSVSYVPTEPGDYNINIL--FADTHIPGSPFKAHVAPCF-DASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSEAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQ------PVP-------NFPSKLQVEP----AVDTSG----------------VQCYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVEYTPYEEGVHSVDVTYDGSPVPSSPFQVPV 1349          

HSP 6 Score: 191.43 bits (485), Expect = 4.877e-47
Identity = 205/794 (25.82%), Postives = 338/794 (42.57%), Query Frame = 3
Query:  669 KPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDG-VNIPGSPFTIQIK-PEI-------DISKVFVENLQ--TTIFQESFIR-FVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            KP    ++TK+A +     L +    K E     N D    ++YL   P         N +  PG+P T+++  +        +    L  G  A+  ++        L  T+   +G+     ++ +  +      ++ P   G + + V+   + +  SP  V I ++  GD S+V+V G G+ +          FII T DAG G +S  +  PS  K  IN +  ++   + RV Y   E G + INI  +   +  SPF V V+     K  +++ R    +   +G   +  +         +  ++ SP       +I E   + +   ++P++ GM+ + + Y    V  SPF+  V P        + A GPGL    VG  A F +       G L  ++EGPS+A+I   D +DGS  + Y    PG+Y V +  + E IP+SP++  +  ++   D  ++ V    +Q+ G+ +N P  F +     K  I  +A   + SG      ++     KY   + P  +G + + V  +   +P SPFK++V +P    +P  V   G GL      +PA F ++T+NAG G L+V I+       P  +  D     + + V Y P   G  Y  SI+Y G  +I GSPF  ++  P +       + S VFV++L    T+ Q +       +   + AKG G  KA     S+F     K+G+                 +VK  G   YS SY   D G Y L V + D  I  SP+ I V
Sbjct: 1882 KPATFTVNTKDAGEGGLS-LAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDD------SMRMSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRL--RNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDASRVRVSGQGLHEGHTFEPAE--FIIDTRDAGYGGLSLSIEGPS--KVDINTEDLEDG--TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKE-SITRRRRAPSVANIGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPV--ASPSGDARRLTVSS--LQESGLKVNQPASFAVSLNGAKGAI--DAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGIYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDG------PSKVKMDCQECPEGYRVTYTPMAPG-SYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMV 2646          
BLAST of Filamin vs. TrEMBL
Match: A0A4Z2CZ15 (Filamin-A isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_006234 PE=4 SV=1)

HSP 1 Score: 2250.32 bits (5830), Expect = 0.000e+0
Identity = 1121/2270 (49.38%), Postives = 1520/2270 (66.96%), Query Frame = 3
Query:  111 ERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPR------SNAKLVT----------------------------VSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSV-PVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRN-ETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEK--------QMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSV------NDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            ERELA+DA+WK+IQKNTFTRW N HLK  N +++DLQ D +DG+RL+ L+E LS  +F H N++ +FRTQKLENVTMVLRFLEE EGL+L+NIDSSDIVDCR KLILGL+W LILHYSI++P+WEGE         TPKQR+++W+  ++ ++ VKN TTDWNDG AIGALVD+CAPGLCPDW EW+P   L + +EAM  AEQWL+VPQLI+PEEMI+P VDEKAMMTYLSQFP+AK+  GAP+  K NP  VR YGPG+E      G  A FT+D FSAGRG +++ + +  G+     +    DK+  Y C Y P  +G Y + +++A K+I  SPFKV ++   GD SK    GPGIE  G  V   T+F I T  AG G   CV+L P G +D I P IT++   +Y VEYT ++ G+HS+N+F +  QI NSPFGVMV PR      S A LV                              +GRGIQ  GIRV D A+F + T++AG G L V +++P+         +     F+C Y P KPG +++ + Y    +  SPF + V P K S I AFGPGL  GVV K A+FV +TNGE G+LGFSIEGPSEA+I+C DN DGSAT+ YWPTAPGEYAVHILC+ E+IP SP+M  I P   K D  ++K +GPG+   G     P EF +D  +          C    G  + + +   G+  Y C Y P     H V VS    ++P+SPF+V+VA+PSNP  VRV G G+ + TR  P YF++D   AGHGN+ + + DE G  +    + D     F V Y  NT GP Y   + ++   +P SPF + +KP ID+SK+ VENL+ ++ +ESF +F V+AKA+D +G+G VKAI   P+  ++  ++++NGDG+Y CSYSP D G + ++VTY+  P+  S F + V PGCDP++V  +G GLEGG T++   FT+DLDGAGQG LGLA+EGP+DA+I C DN DGTCTV+Y  T  GTYDI++KFND+++ GSPF++PIRD ++   V+C+G  L P    R  QP  F VDAS+AG+AP++    D  G   P  I  R N  PG+YD+T+VP   GP  IE+K        +PF+ ++LP  EP +V+V GEGV PT     P+  P  F +D  +AG GD++LS+ + D   L  +++D G G + C YTP   G+H + V +    +   PF+V V   G AN C IE+G    I +  E +IT+NT +AG G+++CRIV         S  +  VE+    NG  +IYY+P    +YLV+I+FGG  IPNG+F +K + P  +  ++ +         S ++ +++  T G +PVEF+LP+     +VE +V TPSG      + DN +G+VT +++P E G+HE+ +T +G  I GSP++F+ E  G G V AYGPGLS GR G PA FT++T+DAGAGGLSL++EGPSKA+I C DN+NG+C V+Y PL+PG+Y+I IKF +++IPGSPF A+I GE +R +Q+C+G+TS++PL+I   DI  L A+VR+PSG E+   LK++PN +LGISFTP E+G HF+NV+++G HI  SPFKI VG++EIG+ASKVR++G GL+ G++N+   FTVDTR AGYGGL+LSIEGPSKA+IEC DN DGTC V+Y P+EPGTY+IN+KYA + V GSPF V I GEPS ++ME+I  Q+E AD T VGSQCEL LK+PG +  D+ A VT+  G ++ C+++  DD +Y+IKF+P+EMG+HTV V+HR  HI GSPFQFTVGPI +GGAHKV A+G GL+ G T  PN+FSIYTREAGAGGLSIAIEGPSKAEI+FEDRKDGSCGV Y VTEPGEY+CSI+FNDDHI NSP+R+++NE         +   +++ASV D  L    +IG+P AFTVNY   T     G++RA ++ PS  +  AI+  ++ +Q+A+RF P E+G HL++V   +  + IPGSPFRV++GQ+    G V A G+GL  G VG++N F VNT+ +G G L+VT+DGPSKVQL   E  +GY+F Y+P +PGEY I++KYG + HI GSP+ A ++G         D++ + V     L VD    +   S P       +V C G G+++A LN+ NTF V+ASQAG+D+L+VG++GP   CEEV++KHMG  Q+ I+Y V+++GRH +M+KWG++++PGSPF V+V+
Sbjct:   22 ERELAEDAEWKMIQKNTFTRWANEHLKPKNVTVDDLQFDLADGLRLIALVESLSGQQFKHVNRKPSFRTQKLENVTMVLRFLEENEGLRLVNIDSSDIVDCRSKLILGLIWTLILHYSITIPLWEGE-PDFGAQGPTPKQRLLAWLNNKLADRPVKNFTTDWNDGVAIGALVDACAPGLCPDWREWEPKQNLRNAREAMGAAEQWLDVPQLIRPEEMINPRVDEKAMMTYLSQFPSAKLKDGAPLRPKSNPGLVRAYGPGLEPHGNTVGNPARFTIDTFSAGRGGVEVIVLNPKGQREPCDVLSNNDKQQTYSCAYVPTQEGEYRVIIKFATKEILNSPFKVMVEGAQGDASKATASGPGIEPTGNQVGRRTFFNIFTAAAGPGNADCVILDPHGRRDAIKPLITRQGEDNYLVEYTPKDEGLHSVNVFYAGQQILNSPFGVMVGPRPPPVVQSPAPLVNQEAPFQATQAPRKMSQPQRPACDPKQAYATGRGIQPQGIRVKDLADFKVHTEDAGEGPLEVSVIAPDGRGIPCTSRKTGAYLFDCSYTPQKPGTHQVNVRYGGDHIMLSPFTVEVAPYKESRIRAFGPGLVGGVVNKPAVFVVETNGETGALGFSIEGPSEARIDCTDNGDGSATVAYWPTAPGEYAVHILCNDENIPKSPFMVPIEPDMGKCDPERVKAHGPGIMPTGNVAGQPTEFIVDIRDAGGPAPLTVECRDNEGEPVALKVRDNGDGTYTCSYTPKVPKKHTVLVSYGGVNIPRSPFRVEVAEPSNPGKVRVFGPGVENVTRGQPTYFTVDCKQAGHGNVGISVTDEAGRDVAMD-TQDMRDGTFKVAYTANTPGPYYTVQVFFNNQEVPRSPFKVPVKPNIDMSKIHVENLEPSVLKESFAKFTVDAKAVDPQGRGIVKAIVVSPNKQRTACLIQNNGDGTYKCSYSPIDDGLHHIEVTYDGAPVPGSSFPVNVAPGCDPTRVRAYGPGLEGGLTHELQRFTVDLDGAGQGALGLALEGPADAQIQCQDNKDGTCTVDYLPTRAGTYDIFVKFNDMNIPGSPFQVPIRDIVDPTRVRCYGPGLEPRGA-RAQQPAHFIVDASQAGDAPIQVTTVDRVGRTAPAHIVPRPN-QPGVYDVTYVPDTDGPCQIEVKQGGNHAARSPFMQHVLPAFEPQRVRVTGEGVHPTRPLGLPATQPTSFQVDTRDAGLGDLELSVMDTDGQPLQLEVVDVGDGTYICHYTPMIVGRHTVRVKYGGQEIPESPFLVPVAPSGRANLCRIENGNNSRIPVGQECVITVNTAQAGTGQLTCRIV-------TPSGATADVEVHEAPNGRVNIYYTPPIRGDYLVEIRFGGELIPNGRFNQKAVSPEELMNDMTDQRVQHINVQSMQSVQSSTITTGYHPVEFKLPVGPTFSHVEGLVRTPSGRILHPTLLDNGDGTVTAQFQPNEPGLHELEITYNGQPIPGSPFRFYVEAVGSGIVTAYGPGLSCGRAGEPANFTLITRDAGAGGLSLSVEGPSKADIQCDDNKNGTCSVSYLPLVPGEYTISIKFMENHIPGSPFTAHITGESRRFNQVCVGTTSEMPLRITETDIYNLVATVRSPSGLEQPSTLKRLPNGHLGISFTPHEIGEHFVNVFRNGRHIANSPFKIYVGESEIGNASKVRIYGTGLREGMANQNCQFTVDTRNAGYGGLNLSIEGPSKADIECHDNQDGTCLVTYRPTEPGTYIINVKYAEQPVPGSPFVVHIGGEPSLRMMERITRQRELADATYVGSQCELNLKIPGINIRDLTANVTSPSGVSQRCDVLATDDVNYTIKFVPQEMGVHTVSVRHRGSHISGSPFQFTVGPITEGGAHKVHAAGPGLQNGLTYSPNDFSIYTREAGAGGLSIAIEGPSKAEINFEDRKDGSCGVSYRVTEPGEYLCSIRFNDDHIPNSPYRVIINESMERTFYTPETKLLNIASVQDRGL----SIGRPTAFTVNYAGMT-----GRMRAYVIAPSGIQSDAIVHQVDVDQHAVRFTPNENGAHLVHVL--MDERPIPGSPFRVIVGQEGT--GQVTASGEGLTHGRVGERNRFFVNTVQAGNGALSVTVDGPSKVQLNCTERSDGYDFTYLPLSPGEYMISIKYGDSQHIVGSPYKAIVTGDAVHETITTDTTHVVVETGGRL-VDGPHSNFGPSRP------DRVTCSGPGLQQAYLNEANTFTVNASQAGHDVLYVGVSGPVVACEEVNIKHMGYGQYSISYTVRDRGRHLIMIKWGDQHVPGSPFTVNVI 2260          

HSP 2 Score: 494.967 bits (1273), Expect = 3.590e-138
Identity = 481/1786 (26.93%), Postives = 754/1786 (42.22%), Query Frame = 3
Query: 2010 PSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKK--YRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKV-AQPSNPNNVRVIGEGL----HSATRYTPAYFSIDTTNAGHGNLAVEINDEIGN---ILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPE---IDISKVFVENLQTTIFQESFI--------RFVVNAKAIDAKGKGTVKA--IFTDPSSFK-----------SGSMVKSNGDG-----------SYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTAN---VKCFGEPLTPGSINRVDQPITFTVDASRAG-EAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKH-CITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLS--HGRTGLPAEFTIVTKDAGAGGLSLA----IEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIG--EPQR----------RSQICIGSTSDVPLKINNLD--ISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQN--------EIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPS--KAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQ------------EAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGN--------YHIAGSP-------------------------------------FTANISG--SVNDSSEIYVHQQSNLKVDTVGKSM-------------VTSMPTQSSV-------AQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL*NMSTTV----PFVLNITFQFCDTSMQIVRNNSFLL 6866
            P   K++   ++ YGPG++  G  + +P  FTID          E       G   P  + S  +K+  Y C Y P  +G ++V +    + +  SPFKV V     + +     G G+    +   R T  +F+I T  AG GN    I D  G    I P       D+  + V Y P   G +++ ++ Y G  I  SPF + + P    +  S   + N Q   FQ +          R   + K   A G+G         D + FK             S++  +G G            + CSY+P   GT+ ++V Y    I  SPF +EV P  + S++  FG GL GG  N+P  F ++ +G   G LG +IEGPS+A+I+CTDN DG+ TV Y  T PG Y ++I  ND ++  SPF +PI   +   +   VK  G  + P + N   QP  F VD   AG  APL   C+DN+G   P+ +K R+N   G Y  ++ P     H + + +  + +P +PF   +   S P KV+V G GV      +T   P  F +D  +AG G++ +S+++     +  D  D   G F   YT    G +  + V FN+  V   PF V V    D +K  +E+     +  +             +G+   + + ++ N +  + L     I+NNG+GT    YSP +   + +++ + G  +P   F        +                  R        G+     R  + L      A+     G  ++ +   DN +G+ T+ Y P   G +++ V  + + I GSP++    +     +V  YGPGL     R   PA F +    AG   + +     +   + A IV + N+ G  DVTY P   G   I +K   ++   SPF+ +++   EPQR             + + +T     +++  D  +  L  SV    G+     +  + +      +TP  VG H + V   G  I  SPF + V  +        E G+ S++ V   G +C I       TV+T +AG G L+  I  PS   A++E  +  +G   + YTP   G Y++ I++  E +    F  K       +LM  +  Q+            +++ IT      E  L V G   S +   V    G      ++D  DG  + +F P E GLH + + +    IPGSPF+F V  +   G+  V A G GL  G    P  F++ TR+AGAGGLS+++EGPSKA+I  +D K+G+C V Y    PGEY  SIKF ++HI  SPF   +  +   F  V                    T   P   T      L AT+  PS  E+P+ ++ +      I F P E GEH +NV      +HI  SPF++ +G+    +   V   G GL  G   +   F V+T N+G G LN++I+GPSK  +   +N++G   + Y P+ PG Y I VKY            HI G P                                      TAN++    V+   ++      N  +  V + M             ++  P Q +V       A KV   G G++       N F++   +AG   L + I GP     E++ +        ++Y V E G +   +++ + +IP SP+ V +  +M  T       +LNI     D  + I R  +F +
Sbjct:  264 PLRPKSNPGLVRAYGPGLEPHGNTVGNPARFTIDTFSAGRG-GVEVIVLNPKGQREPCDVLSNNDKQQTYSCAYVPTQEGEYRVIIKFATKEILNSPFKVMVEGAQGDASKATASGPGIEPTGNQVGRRT--FFNIFTAAAGPGNADCVILDPHGRRDAIKPLITRQGEDN--YLVEYTPKDEG-LHSVNVFYAGQQILNSPFGVMVGPRPPPVVQSPAPLVN-QEAPFQATQAPRKMSQPQRPACDPKQAYATGRGIQPQGIRVKDLADFKVHTEDAGEGPLEVSVIAPDGRGIPCTSRKTGAYLFDCSYTPQKPGTHQVNVRYGGDHIMLSPFTVEVAPYKE-SRIRAFGPGLVGGVVNKPAVFVVETNGE-TGALGFSIEGPSEARIDCTDNGDGSATVAYWPTAPGEYAVHILCNDENIPKSPFMVPIEPDMGKCDPERVKAHGPGIMP-TGNVAGQPTEFIVDIRDAGGPAPLTVECRDNEGE--PVALKVRDNG-DGTYTCSYTPKVPKKHTVLVSYGGVNIPRSPFRVEVAEPSNPGKVRVFGPGVE----NVTRGQPTYFTVDCKQAGHGNVGISVTDEAGRDVAMDTQDMRDGTFKVAYTANTPGPYYTVQVFFNNQEVPRSPFKVPVKPNIDMSKIHVENLEPSVLKESFAKFTVDAKAVDPQGRGIVKAIVVSPNKQRTACL-----IQNNGDGTYKCSYSPIDDGLHHIEVTYDGAPVPGSSFPVNVAPGCDP--------------TRVRAYGPGLEGGLTHELQRFTVDLDGAGQGALGLALEGPADAQIQCQDNKDGTCTVDYLPTRAGTYDIFVKFNDMNIPGSPFQVPIRDIVDPTRVRCYGPGLEPRGARAQQPAHFIVDASQAGDAPIQVTTVDRVGRTAPAHIVPRPNQPGVYDVTYVPDTDGPCQIEVKQGGNHAARSPFMQHVLPAFEPQRVRVTGEGVHPTRPLGLPATQPTSFQVDTRDAGLGDLELSVMDTDGQPLQLEVVDVGDGTYICHYTPMIVGRHTVRVKYGGQEIPESPFLVPVAPSGRANLCRIENGNNSRIPV---GQECVI-------TVNTAQAGTGQLTCRIVTPSGATADVEVHEAPNGRVNIYYTPPIRGDYLVEIRFGGELIPNGRFNQKAVS--PEELMNDMTDQRVQHINVQSMQSVQSSTITTGYHPVEFKLPV-GPTFSHVEGLVRTPSGRILHPTLLDNGDGTVTAQFQPNEPGLHELEITYNGQPIPGSPFRFYVEAV---GSGIVTAYGPGLSCGRAGEPANFTLITRDAGAGGLSLSVEGPSKADIQCDDNKNGTCSVSYLPLVPGEYTISIKFMENHIPGSPFTAHITGESRRFNQVC----------------VGTTSEMPLRITETDIYNLVATVRSPSGLEQPSTLKRLPNGHLGISFTPHEIGEHFVNVFR--NGRHIANSPFKIYVGESEIGNASKVRIYGTGLREGMANQNCQFTVDTRNAGYGGLNLSIEGPSKADIECHDNQDGTCLVTYRPTEPGTYIINVKYAEQPVPGSPFVVHIGGEPSLRMMERITRQRELADATYVGSQCELNLKIPGINIRDLTANVTSPSGVSQRCDVLATDDVNYTIKFVPQEMGVHTVSVRHRGSHISGSPFQFTVGPITEGGAHKVHAAGPGLQNGLTYSPNDFSIYTREAGAGGLSIAIEGPSK--AEINFEDRKDGSCGVSYRVTEPGEYLCSIRFNDDHIPNSPYRVIINESMERTFYTPETKLLNIA-SVQDRGLSIGRPTAFTV 1976          
BLAST of Filamin vs. TrEMBL
Match: A0A4S2L3R6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010478 PE=4 SV=1)

HSP 1 Score: 2248.78 bits (5826), Expect = 0.000e+0
Identity = 1115/2278 (48.95%), Postives = 1530/2278 (67.16%), Query Frame = 3
Query:  111 ERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPR---------------------------------------------SNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPS-VPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEK--------QMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQ----KVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            ERELA+DA+WK+IQKNTFTRW N HLK  N ++ DLQ D +DG+RL+ L+E LS  +F H N++ +FRTQKLENVTMVLRFLEE EGL+L+NIDS+DIVDCR KLILGL+W LILHYSI++P+WEGE         TPKQR++SW+  ++ ++ VKN TTDWNDGTAIGALVD+CAPGLCPDW +W+P   L + +EAM+ AEQWL+VPQLI+PEEMI+P VDEKAMMTYLSQFP+AK+  GAP+  K  P  VR YGPG++      G  A FT+D FSAGRG +++ + +  G+    +I    D++  Y C Y P  +G Y + +++A K+I  SPFKV ++  +GD SK    GPGIE  G      T+F I T  AG G + CV+L P G +D I P IT++   +Y VEYT  + G+HS+N+F +  QI NSPFGVMV P+                                              +AK    +GRGIQ  G+RV D A+F + T++AG G L V +++P+  E      +     F+C Y P + G++++ + Y    +  SPF ++V P K S I AFGPGL+ GVV K A+FV +TNGE G+LGFSIEGPSEA+I+C DN DGSAT+ YWPTAPGEYAVHILC+ E+IP SP+M  I P   K D  ++KV+GPGV   G     P EF +D  +          C    G  + + +   G+  Y C Y P     H V VS    +VP+SPF+V+VA+PS P  VRV G G+ S  R  P +F++D   AG GN+ + + DE G  +    + D     F V Y  NT GP Y   + ++   +P SPF + +KP ID+SK+ VENL   + +ESF +F V+AK +D +G G VKAI  +P   ++  +V++NGDG++ CSYSP D G + ++VTY+  P++ SPF + V PGCDPS+V V+G GLEGG T++   FT+DLDGAGQG LGLAIEGP+DA+I C DN DGTCTV+Y  T  G YD+++KFND++V GSPF++PIRD ++ + V+C+G  L P    R  QP TFTVDAS+AG+AP+     D  G   P     R  + PG+YD+T+VP   GP  IE++  +  V  +PF  ++LP  EP +V+V GEGV PT     P+ +P  FH+D  +AG GD++LS+S+P+   L  +++D G G + C Y P   G+H + V F    +   PF+V V   G A+ C IE G    + +  E +IT+NT +AG G+++CRIV         S  +  VEI+   NG  ++YY+P    +YLV+++FGG  +PNG+F ++ +  + +  + +E         S ++ T     G +PV+F+LP+     +VE +V TPSG      + DN +G+VT +++P E G+HE+ +T +   I GSP++F+ E  G G V+AYGPGLS+GR G PAEFT++T++AGAGGLSL++EGPSKAEI C DN+NG+C V+Y PL+PG+Y+I IKF + +IPGSPF A++ GE +R +Q+C+G+TS++PL+I   DI  L A+VR+PSG+E+   LK++PN +LGISFTPRE+G H++NV+++G HI  SPFKI VG+ EIG+ASKVR++G GL  G +N+   FTVDTR AGYG LSLSIEGPSKA+IEC DN+DGTC V+Y P+EPGTY+IN+KYA++ V+GSPF V I GEPS ++ME+I  Q+E AD+T VGSQCEL LK+PG    D+ ATVT+  G T+ C+++ +DD +Y+I+F+P+EMG+HTV V+HR  HIPGSPFQFTVG I DGGAHKV A+G GL+ G T  PNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCG+ Y VTEPGEY CS++FND++I  SPFR+++NE         ++  +SVA+V D  L     IG+P AFTVNY  T+     G LRA  V PS  + PA +  ++ +Q+ +RF P+E+G HL++V   +  + IPGSPFR+++GQ+  D G+V A G+GL  G VG+KN F VNT  +G+G L+VT+DGPSKV+L   E  +GYEF Y+P APG+Y I +++G   HI GSPF A ++G  +   +IY    +++ V+T G    T    Q SV++    KV C G G+ +A LNQ NTFNV+A+QAG+D+L+VG++GP   CEEV++KH+G  Q+ +NYLV+++G+H +M+KWG++++PGSPF+V+V+
Sbjct:   27 ERELAEDAEWKLIQKNTFTRWANEHLKPKNVTVEDLQYDLADGLRLIGLVEALSGQQFKHVNRKPSFRTQKLENVTMVLRFLEENEGLRLVNIDSTDIVDCRSKLILGLIWTLILHYSITIPLWEGEIDHGQGQGPTPKQRLLSWLNNKLVDRPVKNFTTDWNDGTAIGALVDACAPGLCPDWRQWEPKQNLRNAREAMNAAEQWLDVPQLIRPEEMINPRVDEKAMMTYLSQFPSAKLKEGAPLRPKSTPELVRAYGPGLQPHGNTVGNPARFTIDTFSAGRGQVEVIVLNPKGQREPCEILTNNDRQQTYSCAYVPTQEGEYRVIIKFATKEILNSPFKVMVEGAAGDASKATASGPGIEPQGNQAGRRTFFNIFTAAAGPGNVDCVILDPHGGRDSIKPVITKQGEDNYLVEYTPRDEGLHSVNVFFAGQQIPNSPFGVMVGPKPAVQPPIQPSLQPLIQSPAPIMSIREEPVQAMTAPRKMSAPKRPVCDAKQAYATGRGIQPQGVRVKDLADFKVHTEDAGEGPLEVAVIAPDGREIPCTTRKTGAYLFDCSYNPQRAGLHQVHVRYGGDHIMLSPFNVDVGPYKDSRIRAFGPGLSGGVVNKPAVFVVETNGETGALGFSIEGPSEARIDCTDNGDGSATVAYWPTAPGEYAVHILCNDENIPKSPFMVPIEPDMGKCDPDRVKVHGPGVLPTGNVAGQPTEFVVDIRDAGGPAPLTVECRDNEGEPVALKVRDNGDGTYTCSYTPKVPRKHTVLVSYGTVNVPRSPFRVEVAEPSQPGKVRVFGPGVESVVRGEPTHFTVDCKQAGQGNVGISVTDETGRDVAMD-TQDMRDGTFRVAYTANTPGPTYTVHVFFNNQEVPRSPFRVPVKPNIDMSKIHVENLSPRVLKESFAKFTVDAKPVDPQGHGLVKAIVVNPHKQRTACLVQNNGDGTWKCSYSPVDDGLHHIEVTYDGAPVQGSPFPVNVAPGCDPSRVRVYGPGLEGGLTHELQRFTVDLDGAGQGALGLAIEGPADAQIQCHDNKDGTCTVDYLPTKAGPYDVFVKFNDMNVPGSPFQVPIRDRVDPSRVRCYGPGLEPRGA-RAQQPATFTVDASQAGDAPIYVATVDRLGRSTPAHTVPRP-SQPGVYDVTYVPATEGPCQIEVRQGSAHVARSPFTQHVLPAFEPQRVRVTGEGVHPTRPLGLPATLPTSFHVDTRDAGMGDLELSVSDPEAQPLQLEVVDHGDGTYTCHYRPIIVGRHTVRVKFGGQEIPESPFLVPVAPSGRADLCRIESGNDGRVPVGQECVITVNTLQAGLGQVTCRIV-------TPSGATADVEIQEAPNGRVNVYYTPPIRGDYLVEVRFGGDLVPNGRFNQRAVTTDELISDTVEERVQHVTTHSVQSSTI--VTGYHPVDFKLPVGPMFSHVEGLVRTPSGRTVQPNLIDNGDGTVTAQFQPTEPGLHELEITYNRQPIPGSPFRFYVEAVGSGNVSAYGPGLSYGRAGEPAEFTLITREAGAGGLSLSVEGPSKAEIQCHDNKNGTCSVSYLPLVPGEYTISIKFMERHIPGSPFTAHVGGETRRFNQVCVGTTSEMPLRITETDIYNLVATVRSPSGQEQPSSLKRLPNGHLGISFTPREIGEHYVNVFRNGRHIANSPFKIYVGEGEIGNASKVRIYGNGLHEGTANQNCQFTVDTRNAGYGSLSLSIEGPSKADIECHDNHDGTCLVTYRPTEPGTYIINVKYADQLVNGSPFVVHIGGEPSLRMMERITRQRELADVTHVGSQCELNLKIPGISLRDLTATVTSPSGVTQRCDVMPIDDVNYTIRFVPQEMGVHTVSVRHRGSHIPGSPFQFTVGAITDGGAHKVHAAGPGLQHGLTYTPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGISYRVTEPGEYQCSVRFNDENIPGSPFRVIINEAMERTFYSPEIRQLSVAAVQDRGLQ----IGRPTAFTVNYTGTS-----GTLRAYAVSPSGVQIPAYVHQVDIDQHGVRFTPQENGPHLVHVL--MDERPIPGSPFRIIVGQE--DLGLVTASGEGLTHGRVGEKNRFFVNTTQAGSGALSVTVDGPSKVKLNCTERPDGYEFTYLPLAPGDYMINIRHGDQRHIIGSPFKAYVTG--DAVQDIYNADTTHVVVET-GSRFATG--PQRSVSEARPDKVICTGSGLHQAFLNQTNTFNVNATQAGHDVLYVGVSGPVVACEEVNIKHLGLGQYAVNYLVRDRGQHLIMIKWGDEHVPGSPFVVNVV 2274          
BLAST of Filamin vs. TrEMBL
Match: A0A2C9KB45 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106052449 PE=4 SV=1)

HSP 1 Score: 2103.56 bits (5449), Expect = 0.000e+0
Identity = 1092/2233 (48.90%), Postives = 1493/2233 (66.86%), Query Frame = 3
Query:  120 LADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPT-----SYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSP--RSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEI--NPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATR-YTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYT--NGMY-PVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII-GEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSS-EIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            LADDAQWK+IQKNTFTRW N HLK  N+ + DL+ DFSDG+RL++LIEVLS  KF H NKR NFRTQKLENVTMVL+FLEE EG++++NIDS+DIVD +LKLILGL+W LILHYSISMP+WEGE+    E   TPKQR+++WI  ++P+  + N TTDWNDG AIGALVD+  PGLCPDW +W P     + KEAMD AE+WL+VPQLIKP+EM +P VD+ +MMTYLSQFPNAK+ PGAP+  +LNP +VR YGPG+E      G  A FTV+ FSAG+G+L++ + +  G   + ++    D+   Y C Y P  +G Y + ++++ ++IP+SP+ V ++  +GDPSKV   GPGIE++GV+    TYF + T+ AG G +   +L P G KDK+ P I   SP      +Y VEYTA + G+HS+N+F S  QI  SPFGV VSP   SNAK    +GRGIQ  GIRV D A F++ T+ AG+G++ V++  P   EE  +I  +  +   +EC+Y+PSK G Y + + + +  +++SPFK+ V PT  + I A+GPGL  GVV + A+F  +TNGE+G+LGFSIEGPS+AKI+C DN DGSA + YWPT  GEYAVH+LC+ +DIPNSPYMANI+P  +  +  K+   GPG++K GV  N   EFT+D            SC       + V +   GN  + C YQP  +  H V ++     +P +PF+V V++PSNP  V+V G G+    +   P +F +D   AG G++A+ + DE G  +P    ++ D   F + Y+P T G +Y   + + G  +P SP  ++++P ID+SK+ V  L+  +F E    F V+A+++    +G VKAI T PS  +  ++VK+NGDG+Y+  Y+P + G   +DVTYED+PI  +P  +   PG D S+V  +G GLEGG T++P  FT+D+ GAG+G LGL IEGP +  + C DN DGTC V Y  T  G YDI +KFND  + GSPF + I++P+N A VKC+G  L   ++ + + P  FTVDAS AG APL+    D  G + P EI   ++   G+Y +T+VPT  GP  +++K+AN  VP +PF  N  P  +  KVKV G GV+   G    S+P  F +D   AG  D+++ +  PDD  +   I D   G +   YTP D G + +TV +    V   PF V+    GDA+KC I DG  + + +  ET+IT++ + AG GK++CRI   + NG       + ++I   G+GT SI ++P     Y ++IKFGG  +PNG +  + +        +      +   ++ R ++   T   G++ PV+F LP+      V A V  PSG R    + DN +G+VT+RY+P E G+H++++  +  +I+GSP+ F  E    G V AYGPGLSHG     A FTI TK+AGAGGLSLAIEGPSK EI CKDNE+G+C V+Y P  PG+Y I +KFAD NI GSPF A I  GEP+R++QI +GS+S+V LK+   DI +LTA++ +PS +EE C LK++ N +LGI+FTPRE G H +NV+++G HI  SPFKIVVG++EIG+ASKV+V+G+GL+ G++NE+N F VDTREAGYGG+SLSIEGPSKA+IEC DN DGTC+V+Y P+EPGTY+INIK+A++HV GSPF+VKI GEPSAK+ E+I   +EAADIT VGSQCEL+LK+PGT   DM A+V +  G TEVC+++ LDD HYSIKF+PKEMG+HTV V+H++MHIPGSPF+FTVGPI  GGAHKV A+G GL+ G  + PNEF+IYTREAGAGGLSIA+EGPSKAEIDF+D+KDGSC V Y VTEPGEY  S+KFND+HI +SPFR+ V     D   ++V S+ D  L     +GKPAAF VN+       + G+L A +V PS +EE A++Q+++  +YA+RFIP+E+G H ++V     N HIP SPF++V+G+  AD G V A GDGL +G  G+   FIVNT+N+G+G L VT++GPSKV+L  +E EEGYEF Y P+APG+Y I ++Y G  +IAGSPF A I G    S+ + +          T   +  + +   SS A KV   G G+ KA   +  TF VDAS AGN+I+++G+ GPK  C+E+ VKH G  Q+ + Y+V+EKGR+ L+++WGE+ IPGSPF V+V
Sbjct:   22 LADDAQWKLIQKNTFTRWANEHLKTVNKQLADLEADFSDGLRLVSLIEVLSGKKFKHVNKRPNFRTQKLENVTMVLKFLEEDEGIRIVNIDSTDIVDKKLKLILGLIWTLILHYSISMPMWEGEEPTPSEKAPTPKQRLLNWIQSKVPDLPINNFTTDWNDGRAIGALVDAVGPGLCPDWEDWDPKKNKANAKEAMDAAEKWLDVPQLIKPDEMTNPKVDDLSMMTYLSQFPNAKLKPGAPVRPRLNPTRVRAYGPGLEPTGNQVGAPARFTVETFSAGKGSLEVIVLNPKGAKENCEVVFNNDRNMTYSCVYLPTQEGAYRVIIKFSGREIPKSPYTVQVEGAAGDPSKVTAAGPGIEKSGVVAGKKTYFEVYTQLAGKGTVDVAILDPHGHKDKVRPAI---SPVVGKEGTYLVEYTAIDAGLHSVNVFFSGQQIPGSPFGVNVSPAKTSNAKACYATGRGIQPRGIRVKDNAVFYVHTKGAGDGEVAVQIFGPGGVEEKCQIKPVKGDEGVYECVYVPSKVGNYIINVTFADQHISKSPFKVEVGPTWNTKIRAYGPGLEGGVVNQPAVFTVETNGEVGALGFSIEGPSQAKIDCKDNGDGSADVTYWPTQAGEYAVHVLCNDQDIPNSPYMANILPP-QPFNAGKVIAKGPGLEKTGVQANKWAEFTVDTRAGGPKAPLIISCMDVDYKPVEVQVKDNGNGTFSCRYQPTRNVKHTVSITYGGVMIPNAPFRVYVSEPSNPAKVKVFGPGVEKGVKTLRPTHFIVDCKEAGPGDVAIGLTDERGIDVPVKTIDNQD-GTFTIEYEPKTPG-LYTVLVYFAGKEVPQSPIKVKVEPHIDVSKIKVVGLEPRVFIECPNEFTVDARSVSPTAQGKVKAIVTSPSGQRYDTVVKNNGDGTYNVLYTPVEQGVQKIDVTYEDIPIPEAPLTVTAKPGSDASRVKAYGPGLEGGLTDKPAVFTVDMKGAGKGGLGLGIEGPVETPMKCQDNHDGTCQVVYEPTKAGPYDITVKFNDQHIPGSPFHVDIKNPVNPAKVKCYGPGLESANV-KANAPAVFTVDASEAGVAPLEVTYTDKTGVKRPAEIVPVDD---GVYQVTYVPTAEGPCQVDVKYANQAVPNSPFRVNAQPGVDASKVKVTGPGVS---GTTPASLPAAFKVDTRAAGDADLEVFVKRPDDTYIRPFIQDNNDGTYDVVYTPEDLGVYDVTVQYGGQNVPGSPFHVKTTPTGDASKCKITDGNDKVVPVGKETVITVDASAAGVGKVTCRI--RSPNG-----TDIDIDIIEQGDGTFSISFTPQFPGPYTIEIKFGGELVPNGSYTVEAVLEEEYARYLETKVGDE-MISADRVDSLLATAPGGLFQPVDFTLPVGPIFNFVSATVVMPSGKRAYPNIEDNKDGTVTVRYQPTEIGLHKLHMQYNNEEIEGSPFLFHVEAIDSGYVTAYGPGLSHGVVHELAVFTINTKNAGAGGLSLAIEGPSKTEIQCKDNEDGTCTVSYLPTAPGEYLITVKFADKNIAGSPFTAKITPGEPKRKNQIMVGSSSEVSLKVTEQDIESLTATIVSPSKREEPCFLKRLANGHLGITFTPRETGEHLVNVFRNGQHIANSPFKIVVGESEIGNASKVKVYGKGLEKGMANEVNEFIVDTREAGYGGMSLSIEGPSKADIECHDNEDGTCRVTYKPTEPGTYIINIKFADQHVPGSPFSVKIGGEPSAKITERITRHKEAADITHVGSQCELSLKIPGTTPYDMTASVKSPSGVTEVCDVVSLDDSHYSIKFVPKEMGVHTVSVKHKDMHIPGSPFEFTVGPIAGGGAHKVHAAGPGLERGEVTVPNEFNIYTREAGAGGLSIAVEGPSKAEIDFQDKKDGSCQVSYRVTEPGEYYVSVKFNDEHIPDSPFRVNVTPSIGDARKVAVQSLQDRGL----QVGKPAAFVVNFNG-----AKGRLTALVVSPSGSEEEALVQDLDDGKYAVRFIPRENGVHYVHVL--FDNYHIPESPFKIVVGKIDADAGKVTAYGDGLKTGKTGQVAKFIVNTVNAGSGSLAVTVEGPSKVKLECKEVEEGYEFSYSPTAPGDYLICIRYAG-VNIAGSPFKAKIEGQGKPSAMQEHASVVVETVTKTSTTTRFSGIQRFSSDASKVTAKGAGLTKAFCGKTATFTVDASGAGNNIMYIGMMGPKGPCDELIVKHQGNLQYSVQYMVKEKGRYMLIIRWGEQEIPGSPFAVEV 2221          

HSP 2 Score: 164.851 bits (416), Expect = 1.511e-36
Identity = 226/941 (24.02%), Postives = 381/941 (40.49%), Query Frame = 3
Query:  558 MPEKHVKNLTTDWNDGTAIGALVDSC---APGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLS----------QFPNAKVNPGAPI---TSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMV--SPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPF--KINVLPTK--TSHIAAFGPGLTTGVVGKAAIFVTDTNGELG-SLGFSIEGPSEAKIECCDN---QDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSG-NEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQI-KPEIDISKV--FVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVP---------------------------------GCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIR 3173
            + E++ + L T   D       VDS    APG       ++PVD  +      +     + +P   +    I+ N D    + Y            Q+ N ++  G+P       ++   V  YGPG+     +  + A FT++  +AG G L + I   +   I  K  E          +Y P   G Y ITV++A+K+I  SPF   I  T G+P +         +N ++V +S+   +   +     ++  ++SPS  ++     + + +     + +T  ETG H +N+F +   I NSPF ++V  S   NA  V V G+G++       +  EF +DT+ AG G +++ +  P K++  ++  +         Y P++PG Y + I + +  V  SPF  KI   P+   T  I           VG          G     +  S++ PS    E CD     D   +I + P   G + V +      IP SP+   + P        K+   GPG+++  V +  PNEF I    Y  +           G ++  +      +   +  Y+    G + V V  +++ +P SPF+V V  PS  +  +V  + L         PA F ++  N   G L   +    G+     L  D D   + V + P  +G V+   + +D  +IP SPF I + K + D  KV  + + L+T    +   +F+VN   ++A G G++      PS  K        G   Y  SYSP   G Y++ + Y  + I  SPF  ++                                     D SKV   G GL   F  +   FT+D  GAG   + + + GP     +  +    NL    +V+Y     G Y + I++ + ++ GSPF + ++
Sbjct: 1332 LEEEYARYLETKVGDEMISADRVDSLLATAPG-----GLFQPVDFTLPVGPIFNFVSATVVMPSGKRAYPNIEDNKDGTVTVRYQPTEIGLHKLHMQYNNEEIE-GSPFLFHVEAIDSGYVTAYGPGLSHG--VVHELAVFTINTKNAGAGGLSLAIEGPSKTEIQCKDNE----DGTCTVSYLPTAPGEYLITVKFADKNIAGSPFTAKI--TPGEPKR---------KNQIMVGSSSEVSLKVTEQDIESLTATIVSPSKREEPCF--LKRLANGHLGITFTPRETGEHLVNVFRNGQHIANSPFKIVVGESEIGNASKVKVYGKGLEKG--MANEVNEFIVDTREAGYGGMSLSIEGPSKAD--IECHDNEDGTCRVTYKPTEPGTYIINIKFADQHVPGSPFSVKIGGEPSAKITERITRHKEAADITHVGSQCELSLKIPGTTPYDMTASVKSPS-GVTEVCDVVSLDDSHYSIKFVPKEMGVHTVSVKHKDMHIPGSPFEFTVGPI-AGGGAHKVHAAGPGLERGEVTV--PNEFNI----YTREAGAGGLSIAVEGPSKAEIDFQDKKDGSCQVSYRVTEPGEYYVSVKFNDEHIPDSPFRVNVT-PSIGDARKVAVQSLQDRGLQVGKPAAFVVNF-NGAKGRLTALVVSPSGS-EEEALVQDLDDGKYAVRFIPRENG-VHYVHVLFDNYHIPESPFKIVVGKIDADAGKVTAYGDGLKTGKTGQ-VAKFIVNT--VNA-GSGSLAVTVEGPSKVKLECKEVEEG---YEFSYSPTAPGDYLICIRYAGVNIAGSPFKAKIEGQGKPSAMQEHASVVVETVTKTSTTTRFSGIQRFSSDASKVTAKGAGLTKAFCGKTATFTVDASGAGNNIMYIGMMGPKGPCDELIVKHQGNLQ--YSVQYMVKEKGRYMLIIRWGEQEIPGSPFAVEVQ 2222          

HSP 3 Score: 105.916 bits (263), Expect = 1.204e-18
Identity = 119/465 (25.59%), Postives = 200/465 (43.01%), Query Frame = 3
Query: 5433 EMGLHTVVVQHRNMHI-PGSPFQFTVGPIVDGGAHKVVASGNGLK-LGHTSG-PNEFSIYTREAGAGGLSIAIEGPSKA----EIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEE---PAIIQNIEKN-QYAIRFIPKESGEHLINVTDEITNKHIPGSPFRV-VIGQQHADPGMVHAKGDGLMSGFVGKKNH--FIVNTLNSGTGPLNVTIDGP----SKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            ++ + T + Q  N  + PG+P +  + P       +V A G GL+  G+  G P  F++ T  AG G L + +  P  A    E+ F + ++ +    Y  T+ G Y   IKF+   I  SP+ + V     D   V + G          GK   F V     T +   G +   I+ P   ++   PAI   + K   Y + +   ++G H +NV    + + IPGSPF V V   + ++    +A G G+    +  K++  F V+T  +G G + V I GP     K Q+   + +EG YE +Y+PS  G Y I V +  + HI+ SPF   +  + N                                  K++ +G G++   +NQ   F V+ +     + F  I GP SQ + +  K  G     + Y   + G + + V   +++IP SP++ ++L
Sbjct:  242 DLSMMTYLSQFPNAKLKPGAPVRPRLNPT------RVRAYGPGLEPTGNQVGAPARFTVETFSAGKGSLEVIVLNPKGAKENCEVVFNNDRNMTYSCVYLPTQEGAYRVIIKFSGREIPKSPYTVQVEGAAGDPSKVTAAGPGIEKSGVVAGKKTYFEV----YTQLAGKGTVDVAILDPHGHKDKVRPAISPVVGKEGTYLVEYTAIDAGLHSVNVF--FSGQQIPGSPFGVNVSPAKTSNAKACYATGRGIQPRGIRVKDNAVFYVHTKGAGDGEVAVQIFGPGGVEEKCQIKPVKGDEGVYECVYVPSKVGNYIINVTFA-DQHISKSPFKVEVGPTWN---------------------------------TKIRAYGPGLEGGVVNQPAVFTVETNGEVGALGF-SIEGP-SQAK-IDCKDNGDGSADVTYWPTQAGEYAVHVLCNDQDIPNSPYMANIL 657          
BLAST of Filamin vs. TrEMBL
Match: A0A3S1BD84 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_010971 PE=4 SV=1)

HSP 1 Score: 2080.45 bits (5389), Expect = 0.000e+0
Identity = 1090/2230 (48.88%), Postives = 1473/2230 (66.05%), Query Frame = 3
Query:  111 ERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDK----INPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEIN--PNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATR-YTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII-GEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSS-EIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            ERELADDAQWK+IQKNTFTRW N HLK  N+++ +L+ DF+DG+RL++LIEVLS  KF H NKR NFRTQKLENVTMVL+FLEE EG++++NIDS+DIVD +LKLILGL+W LILHYSISMP+WEGE+    E   TPKQR+++WI G++P+  + N TTDWNDG AIGALVD+  PGLCPDW +W P     + KEAMD AE+WL+VPQLIKP+E+ +P VDE +MMTYLSQFPNAK+ PGAP+  +LNP++VR YGPG+E      G  A FTV+ FSAG+G++++ + +  G     ++    D+   + C Y P  +G Y I V+++ KDIP+SPF V ++  +GDP+KV   GPG+E+ GVIV   TYF + T  AG G +   +L P G KDK    I+P + +E   +Y VEYTA E G+HSIN+F S  QI  SPFGV V+P SNAK    +GRGIQ  GIRV D A F++ T+ AG G++ V++  P   EE   I  +      +EC+Y P KPG Y + + + +  +++SPFK+ V P   + + A+GPGL  GVV + A+F  +TNGE+G+LGFSIEGPS+AKI+C DN DGSA + Y+PTAPGEYAVH+LC+ EDIP SPYMA I+P  +     K+   GPG++K GV+ N   EFT+D     +      SC     N + V I   GN  Y C Y P  +  H + ++     +PK+PF+V V++PSNP  V+V G G+    + +T  +F +D   AG G++AV + DE G  +P   +++ D   F V Y+P + G  Y   + +    +P SP  +Q++P ID+SKV V  L+ +++ +    F V+A+++    +G V+AI T PS  K+ ++VK+NGDG+Y+  Y+P++ G   +DVTYEDLPI  SP  +   PGCD +KV  +G GLE G T++P  FT+D+ GAG+G LGL IEGP +  + C DN DGTC V Y  T  G YDI +KFND  + GSPF + ++DP+N + VKC+G  L    I  + QP TFT+DAS AGEAP++    D +G   P E+    +   G+++ T+VP E GP  +E+KHA+  VPG+PF  N  P  +  KVKV G G+    G    S P  F+ID  +AG+  +++ +  PDD  +   I D   G +   YTP D G + ++V +        P+ V+    GDA+KC I DG    + +  ET+IT++  +AG GK++CRI          +   + ++I + G+GT SI ++P     Y ++IKFGG  IP+G +  +                        RN    +   MY +   L IS       A V  PSG R    + DN +G+VT+RY+P E G+H++++  +  +I+GSP+ F  E+   G V AYGPGLSHG     A FTI TK+AGAGGLSLAIEGPSK EI CKDNE+G+C V+Y P  PG+Y I +KFAD +I GSPF + I  GEP+R++QI +GS+S+V LK+   DI +LTAS+ +PSG+EE C LK++ N +LGI+FTP E G H +NV+++G HI  SPFKI VG+ EIG+A KV+V+G+GL+ G++NE+N F VDTREAGYGG+SLSIEGPSKA+IEC DN DGTC+V+Y P+EPG Y+INIK+A++HV G PF+VKI GEPSAK+ E+I   +EAAD+T VGSQCEL+LK+PGT   DM A+V +  G TE+CE+  LDD HYSIKF+P EMG+HTV V+H++MHIPGSPF+FTVGPI  GG+HKV ASG GL+ G    PNEF+IYTREAGAGGLSIA+EGPSKAEI+F+D+KDGSC V Y V+EPGEY  S+KFND+HI +SPFR+ V     D   +SV S+ D  L     +GKPAAF VN+       + G+L A +V PS  EE A++Q IE  QYA+RFIP+E G HL+ V     N  IPGSPF+VV+G+  AD G V A GDGL +G  G+   FIVNT+N+G+G L VT++GPSKV+L  +E +EGYEF Y P+APG+Y I++KY G   IAGSPF A I G    S+ + +          T   +    +    S A KV   G G+ KA   +  TF VDAS+AGN+I++VG+ GPK  CEE+ VKH G  Q+ + Y+V+E GR+ L+V+WGE +IPGSPF V+V
Sbjct:   20 ERELADDAQWKLIQKNTFTRWANEHLKTVNKNLTNLEADFADGLRLISLIEVLSGKKFKHVNKRPNFRTQKLENVTMVLKFLEEDEGIRIVNIDSTDIVDSKLKLILGLIWTLILHYSISMPMWEGEEPTPSEKAPTPKQRLLNWIQGKVPDLPINNFTTDWNDGKAIGALVDAVGPGLCPDWEDWDPKKKKNNAKEAMDAAEKWLDVPQLIKPDEITNPKVDELSMMTYLSQFPNAKLKPGAPVRPRLNPSRVRAYGPGVEPTGNQVGAPARFTVETFSAGKGDVEVIVLNPKGTKEPCEVNPNNDRNMTFSCCYVPSMEGAYRIVVKFSGKDIPKSPFNVKVEGAAGDPTKVTAAGPGLEKTGVIVGKKTYFEVFTSLAGKGTVDVAILDPHGHKDKVRAAISPVVGKEG--TYLVEYTAIEPGLHSINVFFSGTQIPGSPFGVNVAPASNAKACYATGRGIQPRGIRVKDIAVFYVHTKGAGEGEVGVQIFGPGGVEEKCTITPVKGEEGVYECVYKPVKPGNYIINVTFADQHISKSPFKVEVGPFWNTKVIAYGPGLEGGVVNQPAVFTVETNGEVGALGFSIEGPSQAKIDCKDNGDGSADVTYFPTAPGEYAVHVLCNEEDIPKSPYMAQIVPPTQYW-AGKVIAKGPGLEKNGVSTNKWAEFTVDTRSAGTKAPLHISCMDVDYNPVEVQIKDNGNGTYACKYMPKKNVKHTITITYGGVMIPKAPFRVYVSEPSNPAKVKVYGPGVEKGVKTFTVTHFIVDCKQAGPGDVAVGLTDEKGMDVPVKTTDNQD-GTFTVEYEPKSPGK-YTVLVLFANKEVPQSPIKVQVEPNIDVSKVKVVGLEPSVYLDCPNEFTVDARSVSPNAQGKVRAIVTSPSGQKNDTLVKNNGDGTYNVLYTPFEQGPQKIDVTYEDLPIPQSPLTVNAKPGCDANKVKAYGPGLEKGVTDEPGVFTVDMKGAGKGGLGLGIEGPVETPMQCQDNHDGTCQVVYQPTKSGPYDISVKFNDQHIPGSPFNVSVKDPVNPSKVKCYGPGLDSSQIKAL-QPNTFTIDASEAGEAPIEVSHVDGKGVRRPAEVVPVAD---GVFEATYVPVEEGPCTVEVKHADQQVPGSPFKLNANPGVDASKVKVTGPGIQ---GTTPASFPAAFNIDTKQAGEAPLEVFVKRPDDTFIRPFIQDNQDGTYDVVYTPEDLGVYDVSVLYGQQHAPGSPYNVKATPTGDASKCKIIDGNDGMVPVGKETVITVDAAQAGVGKVTCRI-------RSPTGADIDIDIIDQGDGTFSIAFTPQFTGPYTIEIKFGGEMIPDGNYVTQ---------------------KPLRNIACVF---MYKIFDYLSIS-------ATVVMPSGKRAYPNIEDNKDGTVTVRYQPTETGLHQLHMQYNNEEIEGSPFLFHVESLDSGYVTAYGPGLSHGVVYENAVFTINTKNAGAGGLSLAIEGPSKTEIQCKDNEDGTCTVSYVPTAPGEYVITVKFADKHIAGSPFTSKITPGEPRRKNQIMVGSSSEVSLKVTEQDIESLTASIVSPSGREEPCFLKRLNNGHLGITFTPHETGEHLVNVFRNGKHIANSPFKINVGEAEIGNAGKVKVYGKGLEEGMANEVNEFIVDTREAGYGGMSLSIEGPSKADIECHDNEDGTCRVTYKPTEPGNYIINIKFADQHVPGIPFSVKIGGEPSAKITERITRHKEAADVTHVGSQCELSLKIPGTQPFDMTASVKSPSGVTEICEVKALDDSHYSIKFVPHEMGVHTVSVKHKDMHIPGSPFEFTVGPIAGGGSHKVHASGPGLERGEVDVPNEFNIYTREAGAGGLSIAVEGPSKAEIEFQDKKDGSCNVAYRVSEPGEYYVSVKFNDEHIPDSPFRVNVTPSIGDARKLSVQSMQDRNLE----VGKPAAFVVNFNG-----AKGRLNAKVVSPSGAEEEALVQEIEDGQYAVRFIPREYGVHLVYVY--FDNYQIPGSPFKVVVGKVDADAGKVTAYGDGLKTGRTGQVAKFIVNTVNAGSGSLAVTVEGPSKVKLECKEVDEGYEFSYRPTAPGDYLISIKYAG-VQIAGSPFKAKIEGQGQPSAMQEHASVVVETVTKTSTTTQFRGIQRFQSDASKVTAKGAGLTKAVKGKTATFTVDASRAGNNIMYVGMMGPKGPCEELIVKHQGNLQYTVQYMVREPGRYMLIVRWGEDDIPGSPFAVEV 2187          

HSP 2 Score: 155.221 bits (391), Expect = 1.305e-33
Identity = 206/854 (24.12%), Postives = 348/854 (40.75%), Query Frame = 3
Query:  780 EKAMMTYLSQFPNAKVNPGAPI---TSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRS--NAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPF--KINVLPTK--TSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQ---DGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSG-NEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQI-KPEIDISKV--FVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV----VPGC-----------------------------DPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIR 3173
            E  +     Q+ N ++  G+P       L+   V  YGPG+     +  + A FT++  +AG G L + I   +   I  K  E      C   +Y P   G Y ITV++A+K I  SPF   I  T G+P +         +N ++V +S+   +   +     ++  ++SPSG ++    K          + +T  ETG H +N+F +   I NSPF + V      NA  V V G+G++       +  EF +DT+ AG G +++ +  P K++  ++  +         Y P++PG Y + I + +  V   PF  KI   P+   T  I           VG          G +   +  S++ PS    E C+ +   D   +I + P   G + V +      IP SP+   + P        K+   GPG+++  V  + PNEF I    Y  +           G ++  +      +      Y+    G + V V  +++ +P SPF+V V  PS  +  ++  + +         PA F ++  N   G L  ++    G      L  + +   + V + P   G V+   + +D   IPGSPF + + K + D  KV  + + L+T    +   +F+VN   ++A G G++      PS  K   +     D  Y  SY P   G Y++ + Y  + I  SPF  ++     P                               D SKV   G GL      +   FT+D   AG   + + + GP     +  +    NL    TV+Y    PG Y + +++ + D+ GSPF + ++
Sbjct: 1380 ETGLHQLHMQYNNEEIE-GSPFLFHVESLDSGYVTAYGPGLSHG--VVYENAVFTINTKNAGAGGLSLAIEGPSKTEIQCKDNE---DGTC-TVSYVPTAPGEYVITVKFADKHIAGSPFTSKI--TPGEPRR---------KNQIMVGSSSEVSLKVTEQDIESLTASIVSPSGREEPCFLKRLNNG--HLGITFTPHETGEHLVNVFRNGKHIANSPFKINVGEAEIGNAGKVKVYGKGLEEG--MANEVNEFIVDTREAGYGGMSLSIEGPSKAD--IECHDNEDGTCRVTYKPTEPGNYIINIKFADQHVPGIPFSVKIGGEPSAKITERITRHKEAADVTHVGSQCELSLKIPGTQPFDMTASVKSPS-GVTEICEVKALDDSHYSIKFVPHEMGVHTVSVKHKDMHIPGSPFEFTVGPIAGGGS-HKVHASGPGLERGEV--DVPNEFNI----YTREAGAGGLSIAVEGPSKAEIEFQDKKDGSCNVAYRVSEPGEYYVSVKFNDEHIPDSPFRVNVT-PSIGDARKLSVQSMQDRNLEVGKPAAFVVNF-NGAKGRLNAKVVSPSG-AEEEALVQEIEDGQYAVRFIPREYG-VHLVYVYFDNYQIPGSPFKVVVGKVDADAGKVTAYGDGLKTGRTGQ-VAKFIVNT--VNA-GSGSLAVTVEGPSKVK---LECKEVDEGYEFSYRPTAPGDYLISIKYAGVQIAGSPFKAKIEGQGQPSAMQEHASVVVETVTKTSTTTQFRGIQRFQSDASKVTAKGAGLTKAVKGKTATFTVDASRAGNNIMYVGMMGPKGPCEELIVKHQGNLQ--YTVQYMVREPGRYMLIVRWGEDDIPGSPFAVEVQ 2188          

HSP 3 Score: 127.872 bits (320), Expect = 2.696e-25
Identity = 154/584 (26.37%), Postives = 236/584 (40.41%), Query Frame = 3
Query: 5280 QVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGH--YSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGL-KLGHTSGPNE-FSIYTREAGAGGLSIAIEGPS------KAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNI--EKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITV--------------------KYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSN----------LKVD--------------------------------TVGKSMVTSMPTQSSVAQ-----KVQCHGLGIKKATLN-QVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL*NMSTT 6788
            QVG+    T++       D+   V N  GT E CE+   +D +  +S  ++P   G + +VV+     IP SPF   V     G   KV A+G GL K G   G    F ++T  AG G + +AI  P       +A I     K+G+  V+Y   EPG +  ++ F+   I  SPF + V     +  +  + G     +   +   A F V+    T    +G++   I GP   EE   I  +  E+  Y   + P + G ++INVT    ++HI  SPF+V +G        V A G GL  G V +   F V T N   G L  +I+GPS+ ++  ++N +G  +  Y P+APGEY + V                    +Y     IA  P       S N  +E  V  +S           + VD                                T G  M+   P +  V++     KV+ +G G++K      V  F VD  QAG   + VG+   K     V         F + Y  +  G++ ++V +  K +P SP  V V  N+  +
Sbjct:  286 QVGAPARFTVETFSAGKGDVEVIVLNPKGTKEPCEVNPNNDRNMTFSCCYVPSMEGAYRIVVKFSGKDIPKSPFNVKVEGAA-GDPTKVTAAGPGLEKTGVIVGKKTYFEVFTSLAGKGTVDVAILDPHGHKDKVRAAISPVVGKEGTYLVEYTAIEPGLHSINVFFSGTQIPGSPFGVNVAPAS-NAKACYATGRGIQPRGIRVKDIAVFYVH----TKGAGEGEVGVQIFGPGGVEEKCTITPVKGEEGVYECVYKPVKPGNYIINVT--FADQHISKSPFKVEVGPFWNT--KVIAYGPGLEGGVVNQPAVFTVET-NGEVGALGFSIEGPSQAKIDCKDNGDGSADVTYFPTAPGEYAVHVLCNEEDIPKSPYMAQIVPPTQYWAGKVIAKGPGLEKNGVSTNKWAEFTVDTRSAGTKAPLHISCMDVDYNPVEVQIKDNGNGTYACKYMPKKNVKHTITITYGGVMIPKAPFRVYVSEPSNPAKVKVYGPGVEKGVKTFTVTHFIVDCKQAGPGDVAVGLTDEKGMDVPVKTTDNQDGTFTVEYEPKSPGKYTVLVLFANKEVPQSPIKVQVEPNIDVS 858          
BLAST of Filamin vs. TrEMBL
Match: A0A0B7BJW7 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF192756 PE=4 SV=1)

HSP 1 Score: 2066.97 bits (5354), Expect = 0.000e+0
Identity = 1082/2246 (48.17%), Postives = 1486/2246 (66.16%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHKFTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSK----LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKIT--QESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEI--NPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATR-YTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNE---TTDYTNGMYP----------VEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII-GEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSS-EIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            TERELADDAQWK IQKNTFTRW N HLK  N+ + DL++DFSDG+RL++LIEVLS  KF HANKR NFRTQKLENVTMVL+FLE+ EG++++NIDS+DI+D +LKLILGL+W LILHYSISMP+WEGE+    E   TPKQR+++WI  + P+  + N TTDWNDG AIGALVD+  PGLCPDW +W P     + KEAMD AE+WL+VPQLI+PEEM +P VD+ +MMTYLSQFPNAK+ PGAP        ++P++VR +GPGIE      G  A FTV+ F+ G+G +++ + +  G+ +  ++    D+   Y C Y P  +GTY + V++  K+IP+SPF V ++  +GDP+KV   GPG+E+ GVIV+  TYF + T+ AG G +   +L P+G KDK+ P IT       +YRVEYTA   G+HS+NIF +  QI  SP+GV     SNAKL   +GRGIQ  GIRV D A F++ T+ AG+G + VK++ P   +E  +I  +  +   +EC Y+PSKPG Y + + + +  + +SPFK+ V P   + I A+GPGL  GVV + A+F  +TNGE+G+LGFSIEGPS+AKI+C DN DGSA + YWPT  GEYAVHI+C+ +DIP SPYMANI P+ +  + +K+   GPG++K GV  N   EFT+D          + SC     N + V++    N  Y C Y P  +  H V ++     +PK+PF+V V++PSNP+ V+V G G+    + +TP YF +D   AG G++AV + DE G  +P    ++ D   F V Y+P T G  Y   + +    +P SP  ++++P ID+SKV V  L+ ++F +    F V+A+++    +G VKAI T PS  +S ++VK+NGDG+Y+  Y+P++ G   +DVTYEDLPI  SP  +  VPG D ++V  +G GLEGG T++P  FT+D+ GAG+G LGL IEGP +  + C DN DGTC V Y  T  G YDI +KFND  + GSPF++ +++P+N A VKC+G  L   ++ +   P  FTVDAS AGEAP++    D  G + P E+   ++   G+Y  T+VP   GP  +E+KHAN  VPG+PF  N  P  +  KV+V G GV+   G    S+P  F++D  +AG  D+++ +  PDD  +   I D   G +   YTP D G + ITV +        PF V+    GDA+KC I DG    I +  ETIIT++  +AG GK++CRI          S   + ++I + G+GT SI ++P     Y ++IKFGG  +PNG +  +           +  E+ ++  A+   E   T D+ + ++           V+F LP+      V A V  PSG R    + DN +G+VT+RY+P E G+H++++  +  +I+GSP+ F  E    G V AYGPGLSHG     A FTI TK+AGAGGLSLAIEGPSK EI CKDNE+G+C V+Y P  PG+Y I +KFAD +I GSPF + +  GEP+R++QI +GS+S+V LK+   DI +LTA++ +PS +EE C LK++ N +LGI+FTP E G H +NVY++G HI  SPFKI VG++EIG+A+KV+V+G+GL  G +NE+N F VDTREAGYGG+SLSIEGPSKA+IEC DN DGTC+V+Y P+EPG Y+INIK+A++HV GSPF VKI G PSAK+ E+I   +EAADIT VGSQCEL+LK+PGT   DM A+V +  G TEVC+++ LDD HYS+KF+PKEMG+HTV V+H++MHIPGSPF+FTVGP+  GG+HKV A+G GL+ G     NEF+IYTREAGAGGLSIA+EGPSKAEI+F+D+KDGSC V Y V+EPGEY  S+KFND+HI +SPFR+ +     D   +SV S+ D  L     +GKPAAF VN+       + G+L A ++ PS  EE A++Q I+  +YA+RFIP+E+G H+++V     N HIP SPF++ +G+  AD G V A GDGL +G  G+   FIVNT+N+G+G L VT++GPSKV+L  +E EEGYEF Y P+APG+Y I ++Y G  +IAGSPF A I G    S+ + +          T   + V+ +   +S A KV   G G+ KAT     TF +DAS AGN+I+ +G+AGPK  C+E+ VKH G  Q+ + Y V + GR+ L+++WG++ IPGSPF V+V
Sbjct:   17 TERELADDAQWKKIQKNTFTRWANEHLKTVNKQLTDLESDFSDGLRLISLIEVLSGKKFKHANKRPNFRTQKLENVTMVLKFLEQDEGIRIVNIDSTDIIDKKLKLILGLIWTLILHYSISMPMWEGEEPTPSEKAPTPKQRLLNWIQSKCPDLPIGNFTTDWNDGKAIGALVDAVGPGLCPDWEDWDPKKNQANAKEAMDAAEKWLDVPQLIRPEEMTNPKVDDLSMMTYLSQFPNAKLKPGAPAGQAPAPVISPSRVRAFGPGIEPTGNQVGVPARFTVETFTPGKGGVEVLVLNPKGQNVPCEVTFNNDRNVTYSCVYVPNLEGTYRVIVKFIGKEIPKSPFNVKVEGAAGDPAKVTAAGPGLEKTGVIVAKKTYFEVFTKPAGKGTVDVAILDPNGQKDKVKPTITPVPGKEGTYRVEYTALVPGLHSVNIFFNGIQIPGSPYGVNAGSASNAKLCYATGRGIQPRGIRVKDNAVFYVHTKGAGDGAVGVKIIGPGGIDEKCQIQPVPGDQGVYECTYVPSKPGNYVINVTFADQHIPKSPFKVEVGPFWNTKIKAYGPGLEGGVVNQPAVFTVETNGEVGALGFSIEGPSQAKIDCKDNGDGSADVTYWPTQAGEYAVHIMCNEKDIPKSPYMANITPA-QAFNAAKVIAKGPGLEKTGVLPNKWAEFTVDT-RAAGKAPLQISCMDVDYNPVEVLVQDNNNGTYNCRYTPTRNVKHTVTITFGGVIIPKAPFRVYVSEPSNPSKVKVHGPGVEKGVKTFTPTYFVVDCKEAGPGDVAVGLTDERGVDVPVKTIDNQD-GTFTVQYEPKTPG-QYTVLVYFANKEVPQSPIKVKVEPNIDVSKVRVVGLEPSVFLDCPNEFTVDARSVSPTAQGKVKAIVTSPSGKRSDTLVKNNGDGTYNVLYTPFEKGPQKIDVTYEDLPIPESPLTVTAVPGSDANRVRAYGPGLEGGQTDKPTVFTVDMKGAGKGGLGLGIEGPVETPMQCKDNHDGTCQVAYKPTKAGPYDISVKFNDKHIPGSPFRVDVKNPVNPAKVKCYGPGLESANV-KAGLPAVFTVDASEAGEAPIEVTYTDRTGTKRPAELVPVDD---GVYQATYVPVTEGPCQVEVKHANQNVPGSPFRVNAGPGVDASKVRVTGPGVS---GTTPASLPAPFNVDTRQAGNSDLEVFVKRPDDTYIRPFIQDNTDGTYDVVYTPEDQGVYDITVQYGGQNAPGSPFNVKATPTGDASKCRITDGRDRTIPVGKETIITVDAAQAGVGKVTCRI-------RSPSGSDIDIDIIDQGDGTFSISFTPQFPGPYTIEIKFGGELVPNGSYTVQA----------VVEEEYETFLATKVGEDLLTADHVDSVHAVPSQAGLFQSVDFTLPVGPIFNFVSAAVVMPSGKRAYPNIEDNKDGTVTVRYQPTETGLHQLHMQYNNEEIEGSPFLFHVEAIDSGYVTAYGPGLSHGVVYEQAVFTINTKNAGAGGLSLAIEGPSKTEIQCKDNEDGTCTVSYLPTAPGEYQITVKFADKHIAGSPFTSKVTPGEPKRKNQILVGSSSEVSLKVTEKDIDSLTATIVSPSRREEPCFLKRLANGHLGITFTPHETGEHLVNVYRNGHHIANSPFKITVGESEIGNANKVKVYGKGLTEGTANEVNEFIVDTREAGYGGMSLSIEGPSKADIECHDNEDGTCRVTYKPTEPGNYIINIKFADQHVPGSPFTVKIGGVPSAKITERITHHKEAADITHVGSQCELSLKIPGTTPFDMTASVKSPSGATEVCDVVSLDDSHYSVKFVPKEMGVHTVSVKHKDMHIPGSPFEFTVGPLAGGGSHKVHAAGQGLERGEVDVQNEFNIYTREAGAGGLSIAVEGPSKAEIEFKDKKDGSCQVLYRVSEPGEYYVSVKFNDEHIPDSPFRVSITPSIGDARKLSVQSLQDRGLQ----VGKPAAFVVNFNG-----AKGRLTARVISPSGAEEEALVQEIDNGRYAVRFIPRENGVHMVHVL--FDNYHIPESPFKICVGKIDADAGKVTAYGDGLKTGKTGQVAKFIVNTVNAGSGSLAVTVEGPSKVKLECREIEEGYEFSYSPTAPGDYLICIRYAG-VNIAGSPFKARIEGQGQPSAMQEHASVVVETVTKTSTTTRVSGIQRFTSDASKVVAKGPGLTKATRGVPATFTLDASNAGNNIMLIGMAGPKGPCDELLVKHQGNLQYGVQYGVTDVGRYTLIIRWGDQEIPGSPFAVEV 2222          

HSP 2 Score: 293.893 bits (751), Expect = 9.468e-76
Identity = 311/1178 (26.40%), Postives = 505/1178 (42.87%), Query Frame = 3
Query: 3327 EYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXX--XXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVI-QVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHD--NNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG------STSDVPLKINNLDISTLTASVRAPSGKEESC----------ILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNS-FTVDTREAGYGGLSLSIEGPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLK-VPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKK--NHFIVNTLNSGTGPLNVTIDGP--SKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            + P  I+  E T P + D++ +      +  +  +A  L PGAP      P   P +V+  G G+ PTG  +   VP +F ++    G+G +++ + NP    +       ++    + C Y P   G + + V F    +   PF V+V    GD  K        E   +               GK +  +  L  NG+ K  +   +       GT  + Y+      + V+I F G+ IP   +       +N           + +    ++    Y +             G   V   +  P GI E   +     + G     Y P + G + +NVT     I  SP+K         K+ AYGPGL  G    PA FT+ T +   G L  +IEGPS+A+I CKDN +GS DVTY+P   G+Y++ I   + +IP SP++ANI       +   I        T  +P K     + T  A  +AP   + SC          +++   N      +TP     H + +   G  I  +PF++ V  +E  + SKV+V G G++ G+     + F VD +EAG G +++ +      ++  +  DN DGT  V Y P  PG Y + + +AN+ V  SP  VK+  EP+  + +  +   E +      ++  +  + V  T    ++A VT+  G      + +  DG Y++ + P E G   + V + ++ IP SP   T  P  D  A++V A G GL+ G T  P  F++  + AG GGL + IEGP +  +  +D  DG+C V Y  T+ G Y  S+KFND HI  SPFR+ V +  ++   V   G    +     G PA FTV+  +      +  +  T    + T+ PA +  ++   Y   ++P   G   + V     N+++PGSPFRV  G    D   V   G G+ SG         F V+T  +G   L V +  P  + ++ + Q+N +G Y+ +Y P   G Y ITV+YGG  +  GSPF    +    D+S+  +    +  +  VGK  + +                              VDA+QAG   +   I  P     ++ +   G   F I++  Q  G + + +K+G + +P   + V  +
Sbjct:  224 DVPQLIRPEEMTNPKVDDLSMMT-----YLSQFPNAK-LKPGAPAGQAPAPVISPSRVRAFGPGIEPTGNQV--GVPARFTVETFTPGKGGVEVLVLNPKGQNVPCEVTFNNDRNVTYSCVYVPNLEGTYRVIVKFIGKEIPKSPFNVKVEGAAGDPAKVTAAGPGLEKTGVIVAKKTYFEVFTKPAGKGTVDVAILDPNGQ-KDKVKPTITPVPGKEGTYRVEYTALVPGLHSVNIFFNGIQIPGSPYGVNAGSASNAKLCYATGRGIQPRGIRVKDNAVFYVHTK---------GAGDGAVGVKIIGPGGIDEKCQIQPVPGDQGVYECTYVPSKPGNYVINVTFADQHIPKSPFKVEVGPFWNTKIKAYGPGLEGGVVNQPAVFTVET-NGEVGALGFSIEGPSQAKIDCKDNGDGSADVTYWPTQAGEYAVHIMCNEKDIPKSPYMANITPAQAFNAAKVIAKGPGLEKTGVLPNKWAEFTVDTRAAG-KAPL--QISCMDVDYNPVEVLVQDNNNGTYNCRYTPTRNVKHTVTITFGGVIIPKAPFRVYV--SEPSNPSKVKVHGPGVEKGVKTFTPTYFVVDCKEAGPGDVAVGLTDERGVDVPVKTIDNQDGTFTVQYEPKTPGQYTVLVYFANKEVPQSPIKVKV--EPNIDVSKVRVVGLEPSVFLDCPNEFTVDARSVSPTAQGKVKAIVTSPSGKRSDTLVKNNGDGTYNVLYTPFEKGPQKIDVTYEDLPIPESPLTVTAVPGSD--ANRVRAYGPGLEGGQTDKPTVFTVDMKGAGKGGLGLGIEGPVETPMQCKDNHDGTCQVAYKPTKAGPYDISVKFNDKHIPGSPFRVDV-KNPVNPAKVKCYGPGLESANVKAGLPAVFTVDASEA----GEAPIEVTYTDRTGTKRPAELVPVDDGVYQATYVPVTEGPCQVEVKH--ANQNVPGSPFRVNAG-PGVDASKVRVTGPGV-SGTTPASLPAPFNVDTRQAGNSDLEVFVKRPDDTYIRPFIQDNTDGTYDVVYTPEDQGVYDITVQYGGQ-NAPGSPFNVKAT-PTGDASKCRITDGRDRTI-PVGKETIIT------------------------------VDAAQAGVGKVTCRIRSPSGSDIDIDIIDQGDGTFSISFTPQFPGPYTIEIKFGGELVPNGSYTVQAV 1331          

HSP 3 Score: 154.836 bits (390), Expect = 1.751e-33
Identity = 161/629 (25.60%), Postives = 275/629 (43.72%), Query Frame = 3
Query:  858 NPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPS-KVKVKGPGIEQNGVIVSTSTYFIISTEDAGTG--EISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSN--AKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-----KTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPS----EAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKV---AQPS------------------------------NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIK 2603
            N NKV+VYG G+   +  A +  EF VD   AG G + ++I   +       IE   ++    + TY P   G Y I +++A++ +P SPF V   K  G PS K+  +    ++   I    +   +S +  GT   +++  V SPSG  +  +  +     + Y V++  +E GVH++++      I  SPF   V P +   +  V  +G+G++   + V  + EF I T+ AG G L++ +  P K+E  ++  +      + LY  S+PG Y + + +++  +  SPF++++ P+     K S  +    GL    VGK A FV + NG  G L   +  PS    EA ++  DN  G   + + P   G + VH+L D   IP SP+   I       D  K+  YG G++       +  +F ++ +   S     +   T  G     +      + Y   Y P   G++ + +     ++  SPFK ++    QPS                              + + V   G GL  ATR  PA F++D +NAG+  + + +    G      + +  +   + V Y     G  Y   IR+    IPGSPF ++++
Sbjct: 1625 NANKVKVYGKGL--TEGTANEVNEFIVDTREAGYGGMSLSIEGPS----KADIECHDNEDGTCRVTYKPTEPGNYIINIKFADQHVPGSPFTV---KIGGVPSAKITERITHHKEAADITHVGSQCELSLKIPGTTPFDMTASVKSPSGATEVCD--VVSLDDSHYSVKFVPKEMGVHTVSVKHKDMHIPGSPFEFTVGPLAGGGSHKVHAAGQGLERGEVDV--QNEFNIYTREAGAGGLSIAVEGPSKAE--IEFKDKKDGSCQVLYRVSEPGEYYVSVKFNDEHIPDSPFRVSITPSIGDARKLSVQSLQDRGLQ---VGKPAAFVVNFNGAKGRLTARVISPSGAEEEALVQEIDN--GRYAVRFIPRENGVHMVHVLFDNYHIPESPF--KICVGKIDADAGKVTAYGDGLKTGKTGQVA--KFIVNTVNAGSG----SLAVTVEGPSKVKLECREIEEGYEFSYSPTAPGDYLICIRYAGVNIAGSPFKARIEGQGQPSAMQEHASVVVETVTKTSTTTRVSGIQRFTSDASKVVAKGPGLTKATRGVPATFTLDASNAGNNIMLIGMAGPKGPCDELLVKHQGNLQ-YGVQYGVTDVG-RYTLIIRWGDQEIPGSPFAVEVQ 2223          

HSP 4 Score: 152.14 bits (383), Expect = 1.106e-32
Identity = 199/821 (24.24%), Postives = 337/821 (41.05%), Query Frame = 3
Query:  870 VRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMV--SPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPF--KINVLPTK--TSHIAAFGPGLTTGVVGKAAIFVTDTNGELG-SLGFSIEGPSEAKIECCDN---QDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSG-NEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQI-KPEIDISKV--FVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV----VPGC-----------------------------DPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPS----DAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIR 3173
            V  YGPG+     +  + A FT++  +AG G L + I   +   I  K  E          +Y P   G Y ITV++A+K I  SPF   +  T G+P +         +N ++V +S+   +   +     ++  ++SPS  ++     + + +     + +T  ETG H +N++ +   I NSPF + V  S   NA  V V G+G+        +  EF +DT+ AG G +++ +  P K++  ++  +         Y P++PG Y + I + +  V  SPF  KI  +P+   T  I           VG          G     +  S++ PS A  E CD     D   ++ + P   G + V +      IP SP+   + P        K+   G G+++  V +   NEF I    Y  +           G ++  +      +   + +Y+    G + V V  +++ +P SPF+V +  PS  +  ++  + L         PA F ++  N   G L   +    G      L  + D+  + V + P  +G V+   + +D  +IP SPF I + K + D  KV  + + L+T    +   +F+VN   ++A G G++      PS  K        G   Y  SYSP   G Y++ + Y  + I  SPF   +     P                               D SKV+  G GL       P  FT+D   AG   + + + GP     +  +    NL     V+Y  T  G Y + I++ D ++ GSPF + ++
Sbjct: 1447 VTAYGPGLSHG--VVYEQAVFTINTKNAGAGGLSLAIEGPSKTEIQCKDNE----DGTCTVSYLPTAPGEYQITVKFADKHIAGSPFTSKV--TPGEPKR---------KNQILVGSSSEVSLKVTEKDIDSLTATIVSPSRREEPCF--LKRLANGHLGITFTPHETGEHLVNVYRNGHHIANSPFKITVGESEIGNANKVKVYGKGLTEG--TANEVNEFIVDTREAGYGGMSLSIEGPSKAD--IECHDNEDGTCRVTYKPTEPGNYIINIKFADQHVPGSPFTVKIGGVPSAKITERITHHKEAADITHVGSQCELSLKIPGTTPFDMTASVKSPSGA-TEVCDVVSLDDSHYSVKFVPKEMGVHTVSVKHKDMHIPGSPFEFTVGPLAGGGS-HKVHAAGQGLERGEVDVQ--NEFNI----YTREAGAGGLSIAVEGPSKAEIEFKDKKDGSCQVLYRVSEPGEYYVSVKFNDEHIPDSPFRVSIT-PSIGDARKLSVQSLQDRGLQVGKPAAFVVNF-NGAKGRLTARVISPSG-AEEEALVQEIDNGRYAVRFIPRENG-VHMVHVLFDNYHIPESPFKICVGKIDADAGKVTAYGDGLKTGKTGQ-VAKFIVNT--VNA-GSGSLAVTVEGPSKVKLECREIEEG---YEFSYSPTAPGDYLICIRYAGVNIAGSPFKARIEGQGQPSAMQEHASVVVETVTKTSTTTRVSGIQRFTSDASKVVAKGPGLTKATRGVPATFTLDASNAGNNIMLIGMAGPKGPCDELLVKHQGNLQ--YGVQYGVTDVGRYTLIIRWGDQEIPGSPFAVEVQ 2223          

HSP 5 Score: 133.265 bits (334), Expect = 6.581e-27
Identity = 162/647 (25.04%), Postives = 277/647 (42.81%), Query Frame = 3
Query: 4953 SKVRVFGEGLKCGISNEMN---SFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYT----PSEPGTYMINIKYANEHVSGSPFAVKITGEPS--AKL------MEK---IICQQEAADI-TQVGSQCELTLKV--PGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLK-LGHTSGPNE-FSIYTREAGAGGLSIAIEGP----SKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHA-DPGMVHAKGDGLMSGFV--GKKNHFIVNTLNSGTGPLNVT---IDGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNT-FNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL*NMSTT 6788
            S+VR FG G++    N++     FTV+T   G GG+ + +  P    + C   ++    V+Y+    P+  GTY + +K+  + +  SPF VK+ G     AK+      +EK   I+ ++   ++ T+   +  + + +  P      ++ T+T + G           +G Y +++     GLH+V +    + IPGSP+    G   +  A    A+G G++  G     N  F ++T+ AG G + + I GP     K +I       G     Y  ++PG Y+ ++ F D HI  SPF++ V       I     G     +   + +PA FTV      T    G L  +I GPS+ +     ++       + + P ++GE+ +++      K IP SP+   I    A +   V AKG GL    V   K   F V+T  +G  PL ++   +D  + V++  Q+N  G Y   Y P+   ++ +T+ +GG   I  +PF             +YV + SN                      KV+ HG G++K       T F VD  +AG   + VG+   +     V         F + Y  +  G++ ++V +  K +P SP  V V  N+  +
Sbjct:  273 SRVRAFGPGIEP-TGNQVGVPARFTVETFTPGKGGVEVLVLNPKGQNVPCEVTFNNDRNVTYSCVYVPNLEGTYRVIVKFIGKEIPKSPFNVKVEGAAGDPAKVTAAGPGLEKTGVIVAKKTYFEVFTKPAGKGTVDVAILDPNGQKDKVKPTITPVPG----------KEGTYRVEYTALVPGLHSVNIFFNGIQIPGSPYGVNAGSASN--AKLCYATGRGIQPRGIRVKDNAVFYVHTKGAGDGAVGVKIIGPGGIDEKCQIQPVPGDQGVYECTYVPSKPGNYVINVTFADQHIPKSPFKVEVGPFWNTKIKAYGPG----LEGGVVNQPAVFTVE-----TNGEVGALGFSIEGPSQAK--IDCKDNGDGSADVTYWPTQAGEYAVHIM--CNEKDIPKSPYMANITPAQAFNAAKVIAKGPGLEKTGVLPNKWAEFTVDTRAAGKAPLQISCMDVDY-NPVEVLVQDNNNGTYNCRYTPTRNVKHTVTITFGG-VIIPKAPF------------RVYVSEPSN--------------------PSKVKVHGPGVEKGVKTFTPTYFVVDCKEAGPGDVAVGLTDERGVDVPVKTIDNQDGTFTVQYEPKTPGQYTVLVYFANKEVPQSPIKVKVEPNIDVS 859          
BLAST of Filamin vs. Ensembl Cavefish
Match: flncb (filamin C, gamma b (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-041008-175])

HSP 1 Score: 1345.49 bits (3481), Expect = 0.000e+0
Identity = 813/2008 (40.49%), Postives = 1155/2008 (57.52%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSG----DKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECCDNQDGSA----TICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIE-DGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-PQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPG-THHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGK---LRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKS-----MVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P  + + P KV+ YGPG+E    I  + AEFT+DA  AGRG L I   D+ G  ID++I +  D  + + C Y P     +TI + + E ++P SPF+VTI + S  P  VKV GPG+E++G+  +  TYF +   +AG G++S  +    G     +  I+  I +    ++ V+YT    G ++I +  +  +I  SPF + V P  +A  V   G G+   G+ VG    F + T+ AG     V      K E +V   EI  N+   +   Y   + G   + + +    + +SPF INV P    S I     GL T V VGK   F+ +T G    G +   I  PS   I C   + G+A    T+ Y P   G Y V I  DG  +P SP+ +  +MP     D SK++ YGPG++  G  +  P  F ID     +          C   E  +     G+      Y P   G + + +   +  +P SPFK  V    +P+ V   G GL        A F++D + AG   L +EI  + G      + N++D   + + Y P   G +Y  +I Y G  +P  P  +Q+ P +D S  KVF   ++   + +E    F+V+ +A +  G   +K    +PS   + + +   GDG+Y   Y+ Y+ G ++++V Y+++ +  SPF + V  GCDPS+V  +G GLE G  N+PN FT++  GAG G LGLAIEGPS+AK++C DN DG+C+VEY    PG YD+ I F  + + GSPF++P+R+ ++ + V+C G  L  G+  R   P TFTVD S+AG APL+       G   P+ I    +   G + + + P + GP+ + +K+A+  VP +PF    LP  +  KV+  G G+  +G  +  S+PV+F ID  +AG+G + + + +P+      +I D   G +   Y P   G++ IT+ +    +   P+ +  +  GDA+KC +   G+   I +  ET+IT++   AG+GK++C++              L V++  N +GT  IYY+  E  +Y++ I+FGG  IPN  F                       F SF             +++R    +G       V  PSG      + DN +G+VT++Y P E+G+HEM++  DG  I GSP +F+ +    G V AYGPGLSHG    P+ FTIVTKDAG GGLSLA+EGPSKAEI CKDN++G+C V+Y P  PGDY+II+KF D +IPGSPF A I G+   R SQ+ +G+ +DV LKI   D+S+LTAS+RAPSG EE C+LK++PN ++GISFTP+EVG H ++V ++G H+  SPFKI+VGQ+EIGDASKV+VFG+GL  G + E+  F VDTR AGYGGL LSIEGPSK +I C D  DGTC+V+Y P+EPGTY+INIK+A++HV GSPF VK+ GE   K  E I  +++A  I  VGS C+L LK+PG T   +M A VT+  G T+  EII+ +D  YS++F+P+EMG HTV V++R  H+PGSPFQFTVGP+ +GGAHKV A G GL  G    P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGSCGV Y V EPG+Y  SIKFND+HI +SPF           + +A++ D+A     T  +     VN+  +  ++ +G    + A +  PS   E   I  ++ +++AIRFIP+E+G H I+V       HIPGSPF++ +G+  Q  DPGMV A G GL  G  G  + FIVNT N+G+G L+VTIDGPSKV++  QE  EGY+  Y P APG Y I++KYGG  HI GSPF A +SG+   S    +H+ S++ V+TV K+        S+P  SS A KV   G G+ KA + Q NTF VD S+AG ++L VG+ GPK+ CEEV VKHMG   + + Y V+EKG + L+VKWG++ +PGSPF V V
Sbjct:  625 PAANDVFPEKVKCYGPGLEPTGCIVNKPAEFTIDARGAGRGQLKIYAQDSEGYPIDIQITDNGD--STFFCVYIPTKPIKHTIIITWGEVNVPNSPFRVTIGEGS-HPENVKVYGPGVEKSGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFADQEIPISPFRIKVDPSHDANKVKAEGPGLCKTGVEVGKPTHFTVYTKGAGKATPEVHFTGALKGE-AVSDFEIIDNHDYSYTVRYTAIQQGNTSISVCHGGDAIPKSPFVINVAPPLDLSKIKV--QGLNTKVDVGKDEEFIINTRGAGGQGKVDVKITSPSRRPIPC-KVESGTANEVHTVKYIPPEEGPYKVDINYDGNPVPGSPFTVEGVMPP----DPSKVRAYGPGLK--GGIVGKPAPFAIDTKGAGTGGLGLTVEGPC---EAKIECQDNGDGSCSVSYLPTEPGEYAINILFADAHIPGSPFKAMVQSVFDPSKVTASGPGLERGKVNEAASFTVDCSKAGEAELTIEIISDSGAQAEVHVQNNSD-GTYSITYIPPFHG-MYTITINYGGHAVPKFPARVQVDPAVDTSGVKVFGPGVEPRGVLREVTTHFIVDTRAHNKTGGNHIKTRIVNPSGSNTDAYITDKGDGTYRVEYTAYEDGVHLIEVLYDEVSVPKSPFRVSVTEGCDPSRVRAYGPGLEEGLVNKPNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGLPIPGSPFRVPVRELVDPSKVRCSGPGL--GNGVRAHVPQTFTVDCSKAGLAPLEVLLYGPTGTTEPVSITDNGD---GTHTVIYTPAKDGPYTVCVKYADQEVPRSPFKIKALPAHDASKVRASGPGLNASG--VPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNRDGTYTVSYVPDMTGRYTITIKYGGDEIPYSPYRIHALPSGDASKCLVTGSGLGPTIQIGEETVITVDAKAAGKGKVTCKV-------STPDGAELDVDVVENSDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFH-----------------VVVRTFLSFD------------LQYRKLCIMGE------VRMPSGKTARPHITDNKDGTVTVKYAPTEKGLHEMDIKYDGNHIPGSPLQFYVDAINSGHVTAYGPGLSHGMVNKPSIFTIVTKDAGEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDDKHIPGSPFTAKITGDDSMRTSQLNVGTATDVSLKITETDLSSLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGQSEIGDASKVKVFGKGLVEGHTFEVAEFIVDTRSAGYGGLGLSIEGPSKVDINCEDVEDGTCKVTYCPTEPGTYIINIKFADQHVPGSPFTVKVLGEGRKK--ESITRRRQAPSIASVGSTCDLNLKIPGETSTREMTAQVTSPGGKTDDAEIIEGEDSTYSVRFVPQEMGPHTVNVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLDRGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSIKFNDEHIPDSPF----------IVPIATLSDDARRLTVTSLQEMGLKVNHEASFAVQLNGARGVIDAKVHTPSGAVEECYITELDNDKHAIRFIPRENGVHSIDV--RFNGSHIPGSPFKIRVGEPGQVGDPGMVSAFGPGLEGGTTGVPSDFIVNTCNAGSGALSVTIDGPSKVKMDCQECPEGYKVTYTPMAPGSYLISIKYGGPQHIVGSPFKAKVSGA-RLSGGHSLHETSSVLVETVTKTSSVAGSFASLPKFSSDASKVVSRGTGLSKAFIGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRMYNVTYTVKEKGDYILIVKWGDEMVPGSPFHVTV 2550          

HSP 2 Score: 1083.55 bits (2801), Expect = 0.000e+0
Identity = 750/2267 (33.08%), Postives = 1113/2267 (49.10%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSK-LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCI-EYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSND-----TDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGS--MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINC---TDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDAN--KCF---IEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIV-PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSKAE--IVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGS-----TSDVP------LKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGIS-NEMNSFTVDTREAGYGGLSLSIEGPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNAL-AKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I DLQ D SDG++L+ L+EVLS+ K +   + R NFR  KLENV++ L FLE +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+WE ED +    K TPKQR++ WI  ++P+  + N   DW DG A+GALVD+CAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+ SK L+P + + YGPGIE +  +  + AEF V+   AG G + + I D  G   + ++    DK   Y   Y P  +G + + V +A +DI  SPF V + K  GDP+KV+                TYF I T  AG G++  +++   G +D +   +  +  + +R  Y     G H I +  +  QI  SPF V +S  SN       GRG+Q  G+RV + A+F + T+ AG+G L V +  P+  +E VK+ ++    +EC Y P   G Y + I +    + RSPF++ V        + A+GPGL TG+VGK+A FV +  G E+G+LGFSIEGPS+AKIEC D  DGS  + YWPT PG+YAVH++CD EDI +SP+MA+I+P+       K+K YGPG++  G  +N P EFTID     +  +K  A      G  I + I+  G+  + CVY P     H + ++    +VP SPF+V + + S+P NV+V G G+  +      P YF++D + AG G++++ I    G + P     D      D+D F V Y P  +G  Y   + +    IP SPF I++ P  D +KV  E     +T +       F V  K     GK T +  FT     ++ S   +  N D SY+  Y+    G   + V +    I  SPF I V P  D SK+ V G   +        F        GQG + + I  PS   I C   +   +   TV+Y     G Y + I ++   V GSPF +    P + + V+ +G  L  G + +   P  F +D   AG   L          E P E K   ++   G   ++++PTE G +AI I  A+  +PG+PF   +    +P KV   G G+    G +  +    F +D S+AG+ ++ + + +         + +   G +   Y P   G + IT+ +    V   P  V+V    D +  K F   +E       +     + T    + G   I  RIV P   N +          I + G+GT  + Y+  E   +L+++ +  VS+P   F+    +                  +  R        G+     R  +         +     G  E+ +   DN +GS ++ Y P   G +++N+T  G+ I GSP++    E     KV   GPGL +G R  +P  FT+    AG   L + + GP+     +   DN +G+  V Y P   G Y++ +K+AD  +P SPF   I   P   +     S      S VP        I+  D     LT  +  P GK +   ++   +    +S+ P   G + I +   G  I  SP++I    +  GDASK  V G GL   I   E    TVD + AG G ++  +  P  AE++    +N DGT  + YT  EPG Y+I I++  EH+  SPF V +    S  L  + +C                           +   V    G T    I D  DG  ++K+ P E GLH + +++   HIPGSP QF V  I  G    V A G GL  G  + P+ F+I T++AG GGLS+A+EGPSKAEI  +D KDG+C V Y  T PG+Y   +KF+D HI  SPF   +             GD+++   +  +G     ++   +T        L A+I  PS  EEP +++ +      I F PKE GEH+++V      KH+  SPF++++GQ    D   V   G GL+ G   +   FIV+T ++G G L ++I+GPSKV +  ++ E+G  +  Y P+ PG Y I +K+  + H+ GSPFT  + G       I   +Q+               P+ +SV      + L I   T  +  T  V +              P  + ++  +     + + + ++ QE G H + VK+  +++PGSPF
Sbjct:    4 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCMNKKIGDLQRDLSDGLKLIGLLEVLSQKKMYRKYHARPNFRQMKLENVSVALEFLE-REHIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDE-DAKKLTPKQRLLGWIQNKVPQLPINNFHRDWRDGKALGALVDNCAPGLCPDWEMWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRSKTLHPKRAKAYGPGIEPRGNMVMRPAEFVVETVEAGLGEVLVYIEDPEGHTEEARVIPNNDKNRSYSVVYLPKVEGLHKVKVLFAGQDINHSPFLVNVSKALGDPNKVQ---------------PTYFDIYTAGAGAGDVGVIIVDSQGRRDTVEIILENKGDSVFRCTYGPVLEGPHVIYVTFAGQQIPRSPFTVHISEASNPNACRAIGRGLQPKGVRVKEVADFKVYTRGAGSGDLRVLIKGPKGGDEPVKVHDLGDGVYECDYYPIFTGKYTVIITWGGHAIPRSPFEVVVSEDAGPQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVLYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKCYGPGLEPTGCIVNKPAEFTIDARGAGRGQLKIYAQ--DSEGYPIDIQITDNGDSTFFCVYIPTKPIKHTIIITWGEVNVPNSPFRVTIGEGSHPENVKVYGPGVEKSGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAG-RYTIMVLFADQEIPISPFRIKVDPSHDANKVKAEGPGLCKTGVEVGKPTHFTVYTK---GAGKATPEVHFTGALKGEAVSDFEIIDNHDYSYTVRYTAIQQGNTSISVCHGGDAIPKSPFVINVAPPLDLSKIKVQGLNTKVDVGKDEEFIINTRGAGGQGKVDVKITSPSRRPIPCKVESGTANEVHTVKYIPPEEGPYKVDINYDGNPVPGSPFTVEGVMPPDPSKVRAYGPGLKGGIVGK---PAPFAIDTKGAGTGGLGLTV------EGPCEAKIECQDNGDGSCSVSYLPTEPGEYAINILFADAHIPGSPFKAMVQSVFDPSKVTASGPGLE--RGKVNEA--ASFTVDCSKAGEAELTIEIISDSGAQAEVHVQNNSDGTYSITYIPPFHGMYTITINYGGHAVPKFPARVQVDPAVDTSGVKVFGPGVEPRGVLREVTTHFIVDTRAHNKTGGNHIKTRIVNPSGSNTDAY--------ITDKGDGTYRVEYTAYEDGVHLIEVLYDEVSVPKSPFRVSVTEG--------------CDPSRVRAYGPGLEEGLVNKPNRFTVETRGAGTGGLGLAIEGPSEAKMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGLPIPGSPFRVPVRELVDPSKVRCSGPGLGNGVRAHVPQTFTVDCSKAGLAPLEVLLYGPTGTTEPVSITDNGDGTHTVIYTPAKDGPYTVCVKYADQEVPRSPF--KIKALPAHDASKVRASGPGLNASGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKANIRDNRDGTYTVSYVPDMTGRYTITIKYGGDEIPYSPYRIHALPS--GDASKCLVTGSGLGPTIQIGEETVITVDAKAAGKGKVTCKVSTPDGAELDVDVVENSDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVVVRTFLSFDLQYRKLC---------------------------IMGEVRMPSGKTARPHITDNKDGTVTVKYAPTEKGLHEMDIKYDGNHIPGSPLQFYVDAINSG---HVTAYGPGLSHGMVNKPSIFTIVTKDAGEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDDKHIPGSPFTAKIT------------GDDSMRTSQLNVGTATDVSLKITETDL----SSLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVKK--NGKHVTNSPFKIMVGQSEIGDASKVKVFGKGLVEGHTFEVAEFIVDTRSAGYGGLGLSIEGPSKVDINCEDVEDGTCKVTYCPTEPGTYIINIKF-ADQHVPGSPFTVKVLGEGRKKESITRRRQA---------------PSIASVGSTCDLN-LKIPGETSTREMTAQVTS--------------PGGKTDDAEIIEGEDSTYSVRFVPQEMGPHTVNVKYRGQHVPGSPF 2129          

HSP 3 Score: 235.728 bits (600), Expect = 2.151e-61
Identity = 324/1251 (25.90%), Postives = 503/1251 (40.21%), Query Frame = 3
Query: 3165 PIRDP-INTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPK-SEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKG--VFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFF----AENAGLGKVAAYGPGLSHGRTGL----PAEFTIVTKDAGAGGLSLAIEGPS--KAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICI--GSTSDVPLKINNLDISTLTAS----------------VRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGIS-NEMNSFTVDTREAGYGGLSLSIEGPSKAE----IECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHS---DMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKK--NHFIVNTL---NSGTGPLNVTIDGPS--KVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P+R   ++    K +G  + P   N V +P  F V+   AG   +    +D +GH     +    N     Y + ++P   G H +++  A   +  +PFL N+     +P+KV+                 P  F I  + AG GD+ + + +        +II E KG  VF C Y P   G H I V F    +   PF V + +  + N C       +   +  + +        G G    R++     G  +     PV++ + G+G     Y P    +Y V I +GG +IP   F+               +    +     R        GM        +      V  +  +  G  ++ +   D  +GS  + Y P E G + ++V CD   I+ SP+       A +    KV  YGPGL    TG     PAEFTI  + AG G L +  +       +I   DN + +    Y P  P  ++III + + N+P SPF   I GE      + +         LK N     T+  S                V  P+  +    + K  ND   + +TP   G + I V  +   I  SPF+I V  +   DA+KV+  G GL K G+   +   FTV T+ AG     +   G  K E     E  DN+D +  V YT  + G   I++ +  + +  SPF + +   P   L  KI  Q     +  VG   E  +   G       D++ T  +        E    ++ H ++K+IP E G + V + +    +PGSPF  TV  ++     KV A G GLK G    P  F+I T+ AG GGL + +EGP +A+I+ +D  DGSC V Y  TEPGEY  +I F D HI  SPF+ MV +   D   V + G     +   + + A+FTV+  +      + +L   I+  S  +    +QN     Y+I +IP   G + I +        +P  P RV +     D   V   G G+    V ++   HFIV+T     +G   +   I  PS      Y  +  +G Y   Y     G + I V Y     +  SPF  ++                                T+     +V+ +G G+++  +N+ N F V+   AG   L + I GP     ++S K        + Y+    G + + + +G   IPGSPF V V
Sbjct:  247 PLRSKTLHPKRAKAYGPGIEPRG-NMVMRPAEFVVETVEAGLGEVLVYIEDPEGHTEEARVIPN-NDKNRSYSVVYLPKVEGLHKVKVLFAGQDINHSPFLVNVSKALGDPNKVQ-----------------PTYFDIYTAGAGAGDVGVIIVDSQGRRDTVEIILENKGDSVFRCTYGPVLEGPHVIYVTFAGQQIPRSPFTVHISEASNPNACRAIGRGLQPKGVRVKEVADFKVYTRGAGSGDLRVLIKGPKGGDE-----PVKVHDLGDGVYECDYYPIFTGKYTVIITWGGHAIPRSPFE--------------VVVSEDAGPQKVRAWGPGLETGMVGKSADFVVEAIGTEVGTLGFSIEGPSQAKIECDDKGDGSCDVLYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVKCYGPGLE--PTGCIVNKPAEFTIDARGAGRGQLKIYAQDSEGYPIDIQITDNGDSTFFCVYIPTKPIKHTIIITWGEVNVPNSPFRVTI-GEGSHPENVKVYGPGVEKSGLKANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGAGRYTIMVLFADQEIPISPFRIKVDPSH--DANKVKAEGPGLCKTGVEVGKPTHFTVYTKGAGKATPEVHFTGALKGEAVSDFEIIDNHDYSYTVRYTAIQQGNTSISVCHGGDAIPKSPFVINVA--PPLDL-SKIKVQGLNTKV-DVGKDEEFIINTRGAGGQGKVDVKITSPSRRPIPCKVESGTANEVH-TVKYIPPEEGPYKVDINYDGNPVPGSPF--TVEGVMPPDPSKVRAYGPGLKGGIVGKPAPFAIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCSVSYLPTEPGEYAINILFADAHIPGSPFKAMV-QSVFDPSKVTASGPGL--ERGKVNEAASFTVDCSKA----GEAELTIEIISDSGAQAEVHVQNNSDGTYSITYIPPFHGMYTITIN--YGGHAVPKFPARVQV-DPAVDTSGVKVFGPGVEPRGVLREVTTHFIVDTRAHNKTGGNHIKTRIVNPSGSNTDAYITDKGDGTYRVEYTAYEDGVHLIEVLYD-EVSVPKSPFRVSV--------------------------------TEGCDPSRVRAYGPGLEEGLVNKPNRFTVETRGAGTGGLGLAIEGPSEA--KMSCKDNKDGSCSVEYIPFTPGDYDVNITFGGLPIPGSPFRVPV 1402          

HSP 4 Score: 187.963 bits (476), Expect = 6.657e-47
Identity = 196/762 (25.72%), Postives = 331/762 (43.44%), Query Frame = 3
Query:  771 NVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGK-LNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPS---NPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDG-VNIPGSPFTIQIKPEI--------DISKVFVENL-QTTIFQESFI---RFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            N D    ++YL   P         + K  PG+P T+K+  +        + +  L  G   + ++        +L  +I   +G      ++ +P++      ++TP   G + ++V+   K +  SPFK+ + ++  GD SKVKV G G+ +          FI+ T  AG G +   +  PS  K  IN +  ++   + +V Y   E G + INI  +   +  SPF V V      K  +++ R    +   VG   +  +      + + +  ++ SP    +  +I E   + +   ++P + G + + + Y    V  SPF+  V P        + A G GL  GV G  A F +       G L  ++EGPS+A+I   D +DGS  + Y    PG+Y V I  + E IP+SP++  I   ++  D  ++ V    +Q+ G+ +N    F +     +  I  +A   T SG      I+   N K+   + P  +G H + V  +   +P SPFK++V +P    +P  V   G GL   T   P+ F ++T NAG G L+V I+       P  +  D     + + V Y P   G  Y  SI+Y G  +I GSPF  ++            + S V VE + +T+    SF    +F  +A  + ++G G  KA     ++F     K+G+                  VK  G+  Y+ +Y+  + G YIL V + D  +  SPF++ V
Sbjct: 1817 NKDGTCTVSYLPTAPGDYNIIVKFDDKHIPGSPFTAKITGDD------SMRTSQLNVGTATDVSLKITETDLSSLTASIRAPSGNEEPCLLKRLPNRH--IGISFTPKEVGEHVVSVKKNGKHVTNSPFKIMVGQSEIGDASKVKVFGKGLVEGHTFEVAE--FIVDTRSAGYGGLGLSIEGPS--KVDINCEDVEDG--TCKVTYCPTEPGTYIINIKFADQHVPGSPFTVKVLGEGRKKE-SITRRRQAPSIASVGSTCDLNLKIPGETSTREMTAQVTSPGGKTDDAEIIEGEDSTYSVRFVPQEMGPHTVNVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLDRGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSIKFNDEHIPDSPFIVPIATLSD--DARRLTVTS--LQEMGLKVNHEASFAVQLNGARGVI--DAKVHTPSGAVEECYITELDNDKHAIRFIPRENGVHSIDVRFNGSHIPGSPFKIRVGEPGQVGDPGMVSAFGPGLEGGTTGVPSDFIVNTCNAGSGALSVTIDG------PSKVKMDCQECPEGYKVTYTPMAPG-SYLISIKYGGPQHIVGSPFKAKVSGARLSGGHSLHETSSVLVETVTKTSSVAGSFASLPKFSSDASKVVSRGTGLSKAFIGQKNTFTVDCSKAGTNMLMVGVHGPKTPCEEVYVKHMGNRMYNVTYTVKEKGDYILIVKWGDEMVPGSPFHVTV 2550          
BLAST of Filamin vs. Ensembl Cavefish
Match: flnca (filamin-C [Source:NCBI gene;Acc:103033794])

HSP 1 Score: 1309.28 bits (3387), Expect = 0.000e+0
Identity = 792/2006 (39.48%), Postives = 1146/2006 (57.13%), Query Frame = 3
Query:  840 PITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSG----DKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP-TKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIEC---CDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMAN-IMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQ-RRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQ-HA-DPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKS-------MVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            P  + + P KVR +GPG++   +I    AEFT+DA  AG+G L I   D  G +ID+KI +  D    + C Y P     +TI + +   ++P SP++V + +    P KVKV GPG+E+ G+  S  TYF +   +AG G+IS  +   +G     +  I+  I +    ++ V+YT    G +++ +  +  +I +SP+ V V P  +A  V   G G+   G  +     F I T+ AG  K  V   + +K    VK  EI  N+   +   Y   + G   + + +   PV +SPF I+V P    S +     GL   V VGK   F  +T G    G++G  +  PS   I C    D   G   + Y P   G+Y V +  DG  +P SP+    +MP+    D SK++ YGPG++  G  +  P  F+ID     +          C   E  +     G+      Y P   G++ + +    + +P SPFK  V    + + V V G GL  A     A F++D + AG   L VEI  + G      + N+ D   F V Y P + GP Y  SIRY G  +P  P  IQ++P +D S  KV+   ++   + ++    F+V+A+A +  G   ++    +PS   + + +   GDG+Y   Y+ ++ G ++++V Y+++ +  SPF + VV GCDPS+V  +G GLEGG  N+PN FT++  GAG G LGL IEG S+AK++C DN DG+C+VEY   IPG YDI I +    + GSPF + +RD ++ + VKC G  L  GS  R   P TFTVD S+AG A L        G   P+ +    N   G + + + P+E GP+ + +K+A+  VP +PF  +  P  +  KV+  G G+   G  +  S+PV+F ID  +AG+G + + + +P+       I D   G +   Y P   G++ IT+ +    +   P+ ++    GDA+KC +   +   I +  ET+I+++   AG GK++C++  LT +G       L V++  N +GT  IYY+  E  +Y++ I+FGG  IPN  F  +                TK        +   +     P+   +P ++    +   V  PSG     L+ DN +G+VT++Y P ERG+HEM++  DG  I GSP +FF + A  G V AYGPGL HG    PA FT+VTK+A  GGLSLA+EGPSKAEI CKDN++G+C V+Y P  PGDY+II+KF   +IPGSPF A I G+   R SQ+ +GS +DV LKI   D+S+LTAS+RAPSG E+ C+LK +PN ++G+SFTP+EVG H ++V +SG H+  SPFKI+VG +EIG+AS+VR FG+GL    + E+  F VDTR AGYGGL LSIEGPSK +I+C D  DGTC+V+Y P+EPG Y+INIK+A +H+ GSPF VK+TGE   ++ E I+ +++A  I  VG+ C+L LK+P      M A VT+  G     E+++  D  YS++F+P EMG HTV V++   H+PGSPFQFTVGP+ +GG HKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGSCGV Y V EPG+Y  SIKFN++HI +SPF + +     D   ++V S+ +    K+  + + A+F V   Q    R  G + A +  PS   E   I +++ ++ AIRFIP+E+G H I+V  +    HIPGSPF V +G+  HA DPG+V A G GL +G  G    F+VNT N+G+G L+VTIDGPSK ++   E  EGY+  Y P APG Y I++KYGG  HI GSPF A I+G V  S    +H+ S++ V+T+ KS          S  + SS   +V C G G+ +A + Q N F VD S+AG ++L VG+ GP++ CE+V VKH+G   + + Y V+EKG + ++VKWG++ +PGSPF V V
Sbjct:  640 PAANDVFPEKVRAFGPGLQPTGVIVNMPAEFTIDARQAGKGELKIYAQDAEGCIIDIKITDKGD--GTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLVGEGC-HPDKVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDFDIIKNDNDTFTVKYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSHDAGKVRAEGPGLNKTGECMDTPTHFTIFTKGAGKAKPEVHFSTGQKGN-PVKDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKV--QGLNEKVEVGKDQEFTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPA----DPSKVRAYGPGLK--GGIVGKPAPFSIDTKGAGAGGLGLTVEGPC---EAKIECQDNGDGTCSVSYLPTEAGDYNINILYGEKHIPGSPFKAAVKPALDASRVTVSGPGLERAKAGEVATFTVDCSRAGEAELTVEIVSDSGATAEVRIYNNND-GTFSVTYTPQSDGP-YTISIRYGGQMVPKCPIRIQVEPAVDTSGVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFRVSVVEGCDPSRVRAYGPGLEGGIVNKPNCFTVETRGAGAGGLGLTIEGASEAKMSCKDNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPFHVLVRDVVDASKVKCSGPGL--GSGVRAHVPQTFTVDCSKAGLASLDVKLYGPGGATEPVAVL---NNGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASKVRASGPGLDKAG--VPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITIKYGGDQIPFSPYSIQARPTGDASKCLLSGSLGPNIQMCEETVISVDAKAAGTGKVTCKV--LTPDGA-----ELDVDVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHVQA---------------TKEPVVPRDEKQPQFR----PINLLIPFTVQQGALTGEVRMPSGKTARPLIRDNKDGTVTVKYAPTERGLHEMDIKYDGNHIPGSPLQFFVDAAESGMVTAYGPGLCHGTVNKPATFTVVTKNAAEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDGKHIPGSPFTAKITGDDSLRTSQLNVGSAADVSLKITETDLSSLTASIRAPSGAEQPCLLKTLPNRHIGLSFTPKEVGEHEVSVKKSGKHVNNSPFKIMVGPSEIGEASRVRAFGKGLMEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDIKCEDVEDGTCRVTYCPTEPGNYIINIKFAEKHIPGSPFTVKVTGE--GRMKESIMRKRQAPSIASVGTICDLNLKIPDVQ--GMTAQVTSPGGKVVNAELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPFQFTVGPLGEGGPHKVRAGGTGLQRGIAGVPTEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYIVQEPGDYEVSIKFNNEHIPDSPFIVPIATLSDDARRLTVTSLQE----KDLRVYQEASFAV---QRNGAR--GVIDAKVHSPSGVVEECYITDVDADKSAIRFIPRENGVHSIDV--KFNGSHIPGSPFNVRVGETGHAGDPGLVSAYGPGLQAGCTGVPAEFVVNTCNAGSGALSVTIDGPSKAKMDCVECAEGYKINYTPMAPGNYLISIKYGGPQHIVGSPFKAKITG-VRLSGGHSLHETSSVLVETMTKSSKVAGAYSSASSSSLSSDGSRVVCQGAGLTRAFIGQKNIFTVDCSKAGTNMLMVGVHGPRTPCEDVYVKHLGNRLYNVTYTVKEKGNYVVIVKWGDETVPGSPFHVTV 2579          

HSP 2 Score: 1118.22 bits (2891), Expect = 0.000e+0
Identity = 757/2281 (33.19%), Postives = 1141/2281 (50.02%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSK-LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDI-------FDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFG--EGLEGGFTNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINCT---DNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEY-----------XXXXXXXXXXXXXXXAGEGKISCRIV-PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSKAE--IVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF---------IANIIGEPQRRSQICIGSTSDVPLKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGT-HHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNAL-AKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIG-QQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE+ELA+DA WK IQ+NTFTRW N HLK  N+++ DLQ D  DG++L+ L+EVLS+ K +   + R NFR  KLENV++ L FL+ +E +KL++IDS  IVD  LKLILG++W LILHYSISMP+W+ +D    + K TPKQR++ WI  ++P+  + N   DW DG A+GALVD+CAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE++DP+VDE ++MTYLSQFP AK+ PGAP+  + L+P K + YGPGIE +  +  + A FTV+   AG G + + + D  G   + K+    DKK  Y  +Y P   G + + V +A +DI +SPF V + KT GDP+KV+ +GPG+E  G +    TYF I T  AG G++S V++ P G KD +   +  +  + +R  Y     G H+I++  +   I  SPF V +S  SNA     +GRG+Q  G+RV + A+F + T+ AG G+L V +  P  +E  VK+ ++    +EC Y P+ PG Y + I +    + RSPF++ V +      + A+GPGL TG+VGK+A FV +  G E+GSLGFSIEGPS+AKIEC D  DGS  + YWPT PG+YAVH++CD EDI +SP+MA+I+P+       K++ +GPG+Q  GV +N P EFTID  +  K ++K  A      G  I + I+  G+  + CVY P     H + +S    +VP SP++V V +  +P+ V+V G G+      +  P YF++D   AG G++++ I    G +   T   D D DI       F V Y P   G  Y   + +    IP SP+ ++++P  D  KV  E     +T    ++   F +  K     GK   +  F   S+ + G+ VK      N D SY+  Y+    G   + VT+   P+  SPFNI V P  D SKV V G  E +E G   +   FT++  GA GQGN+G+ +  PS   I C    D   G   V+Y     G Y + + ++   V GSPF +    P + + V+ +G  L  G + +   P  F++D   AG   L          E P E K   ++   G   ++++PTE G + I I +    +PG+PF   + P  +  +V V G G+  A  G   T      F +D S AG+ ++ + + +         I +   G F   YTP   G + I++ +    V  CP  ++V    D +      GVK Y            +     +      + G   I  RI+ P   N +          I + G+GT  + Y+  E   +L+++ +  V++P   F+           E  +  + ++          +  N  + VE R            +  T  G  E+ +   DN +GS ++ Y P   G +++N+T  G  I GSP+     +     KV   GPGL  G R  +P  FT+    AG   L + + GP  A   +   +N +G+  V Y P   G Y++ +K+AD ++P SPF          + +        +  + ++  V   I+  D     LT  +  P GK +   ++   +    +S+ P   G + I +   G  I  SP+ I       GDASK  + G         E    +VD + AG G ++  +  P  AE++    +N DGT  + YT  EPG Y+I I++  +H+  SPF V+ T EP     EK   Q +   I          L +P T     +   V    G T    I D  DG  ++K+ P E GLH + +++   HIPGSP QF V     G    V A G GL  G  + P  F++ T+ A  GGLS+A+EGPSKAEI  +D KDG+C V Y  T PG+Y   +KF+  HI  SPF   +             GD++L   +  +G  A  ++   +T        L A+I  PS  E+P +++ +      + F PKE GEH ++V    + KH+  SPF++++G  +  +   V A G GLM     +   F V+T N+G G L ++I+GPSKV +  ++ E+G     Y P+ PG Y I +K+    HI GSPFT  ++G       I   +Q+               P+ +SV              T+  +N    D        +   +  P  +     +   G + + + ++  E G H + VK+  +++PGSPF
Sbjct:    4 TEKELAEDAPWKKIQQNTFTRWCNEHLKCINKNVTDLQRDLGDGLKLIALLEVLSQKKMYRKHHVRPNFRQMKLENVSVALEFLD-RERIKLVSIDSKAIVDGNLKLILGMIWTLILHYSISMPMWD-DDDDEEKKKLTPKQRLLGWIQNKVPQLPINNFNRDWRDGKALGALVDNCAPGLCPDWETWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPVKPRQLHPKKAKAYGPGIEPEGNMVMKPAVFTVETLDAGLGEVIVYVEDPEGYREEAKVVPNNDKKRTYSVSYVPKVAGPHKVKVLFAGQDIDKSPFSVNVAKTVGDPNKVQARGPGLEPTGNVTQRPTYFDIYTAGAGAGDVSVVIVDPQGKKDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFKVHISEASNASSCRATGRGLQPKGVRVKEVADFRVFTKGAGTGELKVSVKGPGGAEVPVKVRDVGDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQAGLQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGSLGFSIEGPSQAKIECEDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVRAFGPGLQPTGVIVNMPAEFTIDARQAGKGELKIYAQ--DAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLVGEGCHPDKVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVV--GTAEADIDFDIIKNDNDTFTVKYTPPAPG-RYTVMVLFAEKEIPSSPYKVKVEPSHDAGKVRAEGPGLNKTGECMDTPTHFTIFTK---GAGKAKPEVHF---STGQKGNPVKDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKVQGLNEKVEVGKDQE---FTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGLKGGIVGK---PAPFSIDTKGAGAGGLGLTV------EGPCEAKIECQDNGDGTCSVSYLPTEAGDYNINILYGEKHIPGSPFKAAVKPALDASRVTVSGPGLERAKAGEVAT------FTVDCSRAGEAELTVEIVSDSGATAEVRIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQVEPAVDTS------GVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTD--------THITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFR-------VSVVEGCDPSRVRAYGPGLEGGIVNKPN-CFTVETR------GAGAGGLGLTIEGASEAKMSCKDNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPFHVLVRDVVDASKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLASLDVKLYGPGGATEPVAVLNNGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASKVRASGPGLDKAGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITIKYGGDQIPFSPYSIQA--RPTGDASKCLLSGSLGPNIQMCEETVISVDAKAAGTGKVTCKVLTPDGAELDVDVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHVQATKEPVVPRDEK---QPQFRPI---------NLLIPFTVQQGALTGEVRMPSGKTARPLIRDNKDGTVTVKYAPTERGLHEMDIKYDGNHIPGSPLQFFVDAAESG---MVTAYGPGLCHGTVNKPATFTVVTKNAAEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDGKHIPGSPFTAKIT------------GDDSLRTSQLNVGSAADVSLKITETDL----SSLTASIRAPSGAEQPCLLKTLPNRHIGLSFTPKEVGEHEVSVKK--SGKHVNNSPFKIMVGPSEIGEASRVRAFGKGLMEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDIKCEDVEDGTCRVTYCPTEPGNYIINIKF-AEKHIPGSPFTVKVTGEGRMKESIMRKRQA---------------PSIASV-------------GTICDLNLKIPDVQG-----MTAQVTSPGGKVVNAELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPF 2156          

HSP 3 Score: 284.263 bits (726), Expect = 3.647e-76
Identity = 310/1158 (26.77%), Postives = 489/1158 (42.23%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDI--QXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQ-VGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVST--PSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-----PQRRSQIC-----IGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFT----PREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIE------GPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPS---AKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEIDFE---DRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQM--DFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI----DGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIK-KATLNQVNT-FNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            L PGAP     L    P K K  G G+ P G  +    P  F ++  +AG G++   +               ++ K  +   Y P  AG H + V F    +   PF V V + VGD NK        E     T+     +   AG G     +V +   G+     ++ V +EN G+      Y P     + + + F G  IP   FK            + E     S  A+ R             +FR+  + GA   E  VS   P G      V D  +G     Y P   G + + +T  G  I  SP++      AGL KV A+GPGL  G  G  A+F +       G L  +IEGPS+A+I C+D  +GSCDV Y+P  PGDY++ +   D +I  SPF+A+I+       P++           G   ++P +            ++  +   E CI+     D    +F     P++   H I +   G ++  SP++++VG+    D  KV+V+G G+ K G+ S+E   FTVD  EAG G +S+ I+      G ++A+I+     N + T  V YTP  PG Y + + +A + +  SP+ VK+  EPS    K+  +     +  +     +   +  K  G    ++  +        +  EIID  D  Y++K+   + G  ++ V H    +P SPF  +V P +D    KV      +++G      EF++ T+ AG  G + + +  PS   I  +   DR  G   VKY   E G+Y   + ++ + +  SPF +   E  M  D   V + G     K   +GKPA F+++    T     G L  T+ GP   E     Q+      ++ ++P E+G++ IN+      KHIPGSPF+  + +   D   V   G GL     G+   F V+   +G   L V I       ++V++Y+  N+  +   Y P + G Y I+++YGG   +   P                +  Q    VDT G                V+ +G G++ K  L  V T F VDA   ++ G + + V I  P     +  +   G   + + Y   E G H + V + E  +P SPF V V+
Sbjct:  242 LKPGAPVKPRQL---HPKKAKAYGPGIEPEGNMVMK--PAVFTVETLDAGLGEVIVYVEDPEGYREEAKVVPNNDKKRTYSVSYVPKVAGPHKVKVLFAGQDIDKSPFSVNVAKTVGDPNKVQARGPGLEPTGNVTQRPTYFDIYTAGAGAGDVSVVIVDPQGK---KDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFK----------VHISEASNASSCRATGRGLQPKGVRVKEVADFRV-FTKGAGTGELKVSVKGPGGAEVPVKVRDVGDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQAGLQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGSLGFSIEGPSQAKIECEDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVRAFGPGLQPTGVIVNMPAEFTIDARQAGKGELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLVGEGCHPD--KVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDFDIIKNDNDTFTVKYTPPAPGRYTVMVLFAEKEIPSSPYKVKV--EPSHDAGKVRAEGPGLNKTGECMDTPTHFTIFTKGAGKAKPEVHFSTGQKGNPVKDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKVQGLNEKVEVGKD---QEFTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAV---EALMPADPSKVRAYGPGL--KGGIVGKPAPFSID----TKGAGAGGLGLTVEGPC--EAKIECQDNGDGTCSVSYLPTEAGDYNINIL--YGEKHIPGSPFKAAV-KPALDASRVTVSGPGLERAKAGEVATFTVDCSRAGEAELTVEIVSDSGATAEVRIYNN-NDGTFSVTYTPQSDGPYTISIRYGGQM-VPKCP----------------IRIQVEPAVDTSG----------------VKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFRVSVV 1325          

HSP 4 Score: 154.836 bits (390), Expect = 7.678e-37
Identity = 147/550 (26.73%), Postives = 244/550 (44.36%), Query Frame = 3
Query:  831 PGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDI--------TITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSN-AKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSH------IAAFGPGLTTGVVGKAAIFVTDT-NGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDG-EDIPNSPYMANI----------------MPSNEKTDVSKI-----------------KVYGPGVQKEGVALNSPNEFTIDCIEYKSDI------KPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKV 2309
            PG+P T       V+V G G   + ++  + A       +    NL I         +T   GK+++ ++ E  D  + Y   + P   G++T++V+Y+ + +P SPF+ T+     G P KV+  G G+++   I    T F I T +AG G +S  V  PS    K           S  V Y  +E G + ++I  ++  I +SPF V ++  S+ A+ +TV+   +Q   +RV  +A F +  +N   G ++ K+ SP    E   I +++ +     +IP + G++ + + ++   +  SPF + V   +T H      ++A+GPGL  G  G  A FV +T N   G+L  +I+GPS+AK++C +  +G   I Y P APG Y + I   G + I  SP+ A I                +     T  SK+                 +V   G       +   N FT+DC +  +++       P   C         V +   GN+ Y   Y     GN+ V V   +++VP SPF V V
Sbjct: 2058 PGSPFT-------VKVTGEGRMKESIMRKRQAPSIASVGTICDLNLKIPDVQGMTAQVTSPGGKVVNAELVESGD--STYSVRFVPTEMGSHTVSVKYSGQHVPGSPFQFTVGPLGEGGPHKVRAGGTGLQRG--IAGVPTEFSIWTREAGAGGLSIAVEGPS----KAEISFEDRKDGSCGVSYIVQEPGDYEVSIKFNNEHIPDSPFIVPIATLSDDARRLTVTS--LQEKDLRVYQEASFAVQ-RNGARGVIDAKVHSPSGVVEECYITDVDADKSAIRFIPRENGVHSIDVKFNGSHIPGSPFNVRV--GETGHAGDPGLVSAYGPGLQAGCTGVPAEFVVNTCNAGSGALSVTIDGPSKAKMDCVECAEGY-KINYTPMAPGNYLISIKYGGPQHIVGSPFKAKITGVRLSGGHSLHETSSVLVETMTKSSKVAGAYSSASSSSLSSDGSRVVCQGAGLTRAFIGQKNIFTVDCSKAGTNMLMVGVHGPRTPCED-------VYVKHLGNRLYNVTYTVKEKGNYVVIVKWGDETVPGSPFHVTV 2579          
BLAST of Filamin vs. Ensembl Cavefish
Match: FLNB (filamin B [Source:NCBI gene;Acc:103028460])

HSP 1 Score: 1297.34 bits (3356), Expect = 0.000e+0
Identity = 774/2032 (38.09%), Postives = 1145/2032 (56.35%), Query Frame = 3
Query:  765 DPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEIS----CVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGV-VGKAAIFVTDTNGE--LGSLGFSIEGPSEAKIECC---DNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTT---IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENG-EVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIR---SDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISG----SVNDSSEIYVHQQSNLKVDTV---GKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            D ++++   M Y+            P     +P++V+ YGPG+E    I  + AEFTV+A +AG+G L I   +  G+ I+VK+    D  N Y CTYTP     +T+ V +    +P SPF+V + K S  P KVKV GPG+E+ G+     T+F +   +AG G++S    C     S  ++ ++  I   +  +  V+Y     G  +I +  +  +I  SPF V V P  +A  V   G G+   G+  G    F + T+ AG   L+V+   P K E  V+  EI  NY   +   Y P + G   + + +   P+++SPF + V  P   S I   G  L + V VG+   F   T G    G L   I  PS   + C        G++ + Y P   G Y V IL +G  +P SP+  + M      D SK+K +GPG++  G  + +P EFTID    K               E  +  S  G+      Y P   G + V +  ++  VP SPF   +  P +P  V   G GL        +  ++D   AG G L +E   + G+     + ++ D   + V Y P T+G +Y   ++Y G  +P  P  + + P +D SKV V         +F+E+   F V+A+A+   G   +KA   +PS   +  ++   GDG+Y   Y+P++ G + ++V Y+D P+  SPF + V  GCDP++V+  G GLE G T++ N F+I   GAG G LG+ +EGPS++K++C DN DG+C VEY+   PG YD+ I +    + GSPFK+P++D ++ + VK  G  +  GS  R   P +FTVD S+AG APL       +G   P+++    +   G + + + P+  GP+++ +K+A+  VP +PF   +LP  +  KV+  G G+  TG  L  S+PV+F ID  +AG+G + + +++ D  L   +I D   G +   Y P   G++ I + +    +   P+ V     GDA+KC +   G+   I +  E    +NT  AG+GK+SC +V  T +G EV++++     +EN  +GT  I+Y+  +   Y++ ++FGG +IP   FK    D                   ++    +    G  P +  +P +     +   V  PSG      + DN +G+V ++Y P E G+HEM++  +G  I  SP +F+  NA    V AYGPGL +G    PA FTI T+DA  GGL LAIEGPSKAEI C DN++G+C VTY P +PGDY+I++++ + +I GSPF A I  + +RRSQ+ +GS +D  L I   D+S LTAS++APSG++E C+LK+ PN+ +GISF PREVG H +++ ++G H+  SP  I+V Q+EIGDA +V+VFG+GL  G + EM+ F VDTR+AGYGGL+LSIEGPSK +I+  D  DGTC VSY P+EPGTY+++I++A +HV GSPF+VK+TGE   ++ E I  +Q+AA +  VGS C+L LK+P     DM A VT+  G+ E  EI+++ +  Y ++F+P EMG+HTV V++R  H+PGSPFQFTVGP+ +GGA+KV A G GL+      P EFSI+TREAGAGGLSIA+EGPS+AEI FEDRKDGSCGV Y   EPG+Y  S+KFN++HI  SP+           + V +  D+A     T  + +   VN P +  +R   + G + A +  PS   E  ++  +E+++YAIRFIP+E+G H I+V  +    HIPGSPF V +G+  Q  D G+V A G GL  G  G +  FI+NT  +G G L VTI+GPSKV++  QE  EG++  Y P APG Y I++KYGG  HI GSPF A + G    +V ++SE      S L VD V     +   S    +S A KV   G G+ KA + Q  +F+VD S+AG ++L VG+ GP++ CEE+ VKHMG  Q+ ++Y+++E+G + L VKWGE +IPGSPF V V
Sbjct:  624 DEDIEDSPFMAYI-----------VPDDKSSDPSQVKAYGPGLEKSGCIINKPAEFTVEAKNAGKGPLKIIAQNADGEPIEVKMRNKGD--NVYSCTYTPTSALKHTVAVTWGGVSVPNSPFRVNVGKGS-HPHKVKVFGPGVERTGLKAHEPTHFTVDCTEAGEGDVSVGIKCDANIISDKEEDVDFDIIPNANDTITVKYIPPGAGRLTIKVLFTDQEIPVSPFRVKVEPSHDASKVKADGPGLARAGVESGKPTHFTVHTKGAGKAPLDVQFSGPIKGE-PVQDFEIIDNYDYSYTVKYTPVQQGEMVINVTFGGDPISKSPFAVGVAAPLDLSKIQVNG--LESRVEVGQDQEFAVSTKGAGGQGKLEARITSPSGKSVPCAVEPQPGKGASLVKYIPKEEGVYTVEILYEGNPVPGSPFPVDAM---LPPDPSKVKAFGPGLK--GGLVGNPAEFTIDT---KGAGTGGLGLTVEGPTEAKIECSDNGDGTCSVSYLPTEPGEYLVNILFEDVHVPGSPFHADIQYPFDPTKVVASGSGLKRGKVGEISVVNVDCAKAGPGQLTLEAMSDAGSKAKTEVLDNKD-GTYTVTYVPLTAG-MYTLLLKYGGQAVPNFPAKVVVDPAVDTSKVKVFGPGVAGEGLFREATTDFTVDARALTKVGGKHIKAQVKNPSGAATDCVIADQGDGTYKVEYTPFENGVHAVEVLYDDTPVPKSPFQVGVGEGCDPARVVAKGPGLEEGLTDKANKFSIITRGAGIGGLGITVEGPSESKMSCKDNKDGSCNVEYTPYAPGLYDVNITYGGQHIQGSPFKVPVKDVVDASKVKLSGPGV--GSGVRAKIPQSFTVDCSKAGVAPLAVAVTGPKGVAEPVDVIDNGD---GTHTVAYTPSVEGPYSVVVKYADEEVPRSPFKLRVLPTHDASKVRASGPGLT-TG--LPASLPVEFTIDAKDAGEGQLSVQITDQDGKLKTANISDNQDGTYKVSYVPDKVGRYTIVIKYGGDEIPTSPYRVRATTSGDASKCTVTGPGIGPTIGIGEEVGFVVNTKGAGKGKVSCVVV--TPDGTEVEADV-----VENE-DGTFDIFYTAPKPGTYVIYVRFGGENIPKSPFKVMVTD------------------GAYIPVNSMNGTGFRPFDMVIPFAFRKGEITGEVHMPSGKTTQPEIIDNKDGTVMVKYAPTEAGLHEMHIKYNGSHIPESPLQFYVNNANSPNVTAYGPGLVYGVANKPATFTIYTEDAAEGGLDLAIEGPSKAEITCIDNKDGTCTVTYLPTLPGDYNILVRYNEKHIAGSPFTARITEDNKRRSQVKLGSAADFALDITETDLSLLTASIKAPSGRDEPCLLKRQPNNRIGISFIPREVGEHLVSIKKNGRHVANSPITIMVVQSEIGDAGRVQVFGQGLVEGRTFEMSDFVVDTRDAGYGGLALSIEGPSKVDIQTEDMDDGTCGVSYCPTEPGTYIVSIRFAEDHVPGSPFSVKVTGE--GRIRESISRRQKAASVASVGSVCDLNLKIPEIDALDMSAQVTSPSGSVEPAEIVEVGNHTYCVRFVPHEMGVHTVNVKYRGQHVPGSPFQFTVGPLGEGGANKVKAGGPGLERAEIGVPAEFSIWTREAGAGGLSIAVEGPSRAEISFEDRKDGSCGVSYVANEPGDYEVSVKFNEEHIPESPY----------LVPVMAPSDDARRLTVTSLQESGLKVNQPTSFAVRLNGAQGAIDAKVHSPSGALEECVVSELEQDKYAIRFIPRENGIHTIDV--KFNGTHIPGSPFEVRVGEPGQGGDAGLVTAYGSGLERGTTGNQADFIINTTKAGPGSLAVTIEGPSKVKMECQECSEGFKVQYTPMAPGNYLISIKYGGPNHINGSPFRAKVMGPRLVNVTNASE-----SSTLTVDPVIRPSSANSYSSLRAASDASKVSSRGSGLSKAYVGQRASFSVDCSKAGKNMLLVGVHGPQTPCEEIMVKHMGSLQYNVSYVLKERGSYLLAVKWGEDHIPGSPFHVTV 2575          

HSP 2 Score: 1137.48 bits (2941), Expect = 0.000e+0
Identity = 769/2278 (33.76%), Postives = 1163/2278 (51.05%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDK-KNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSH-IAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDI-------FDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFK--SGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGF-TNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINCT---DNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEG---------KISCRIVPLTENGEVKSNLSLP------VEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSK-AEIV-CKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII----GEPQRRS--QICIGSTSDVPLK--INNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL--KCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I DLQ D SDG+RL+ L+E+LS+ K +   ++R  FR  KLENV++ L FL+ +E ++L++IDS  IVD  LKLILG+VW LILHYSISMP+WEGE+      K TPKQR++ WI  ++P+  + N + DW DG A+GALVDSCAPGLCPDW  W     + +  EAM  A+ WL +PQ+I PEE+IDP+VDE+++MTYLSQFP AK+ PGAP+  KLNP K R YGPGIE       + A FTVD FSAG+G + + I D  G+  +VK   +P++ K  +   Y P   G + +TV +A + IP+SPF+V +DK  GD SKV  KGPG+E  G I +  TYF I T  AG GE++ V+  P G+K+ +   +  +  + +R  Y   + G HS+NI      I  SP+ V V P S+      +GRG+Q  G+RV   A+F +DT++AG+G+L V +  P+  EE VK+ E     +   Y P+  G Y + I +    + +SPF++ V P   +  I A+GPGL  G+VG++A FV ++ G ++G LGF+IEGPS+A+IEC D  DGS  + YWPT PGEYAVH++CD EDI +SP+MA I+P ++ +D S++K YGPG++K G  +N P EFT++     K  +K  A      G  I V + + G+  Y C Y P +   H V V+    SVP SPF+V V + S+P+ V+V G G+       + P +F++D T AG G+++V I  +  NI+      D D DI         V Y P  +G +    + +    IP SPF ++++P  D SKV  +     +  +       F V+ K     GK  +   F+ P   +      +  N D SY+  Y+P   G  +++VT+   PI  SPF + V    D SK+ V   GLE      Q   F +   GA GQG L   I  PS   + C        G   V+Y     G Y + I +    V GSPF +    P + + VK FG  L  G    V  P  FT+D   AG   L          E P E K    +   G   ++++PTE G + + I   ++ VPG+PF  +I    +P KV   G G+   G     SV    ++D ++AG G + L   +        +++D   G +   Y P  AG + + + +    V N P  V V    D +K  +                      AGEG          +  R +       +K+ +  P        I + G+GT  + Y+P E   + V++ +    +P   F+           E  +  +  ++        TD  N     +F + I+ GA  +  +  T  G  ES +   DN +GS  + Y P   G++++N+T  G  IQGSP+K   ++     KV   GPG+  G R  +P  FT+    AG   L++A+ GP   AE V   DN +G+  V Y P + G YS+++K+AD  +P SPF   ++        R S   +  G  + +P++  I+  D     L+  +    GK ++  +    +    +S+ P +VG + I +   G  I  SP+++    +  GDASK  V G G+    GI  E+  F V+T+ AG G +S  +  P   E+E    +N DGT  + YT  +PGTY+I +++  E++  SPF V +T      +            +   G +    + +P      ++   V    G T   EIID  DG   +K+ P E GLH + +++   HIP SP QF V    +  +  V A G GL  G  + P  F+IYT +A  GGL +AIEGPSKAEI   D KDG+C V Y  T PG+Y   +++N+ HI  SPF   + E            DN    +  +G  A F ++  +T        L A+I  PS  +EP +++    N+  I FIP+E GEHL+++      +H+  SP  +++ Q    D G V   G GL+ G   + + F+V+T ++G G L ++I+GPSKV + +++ ++G   + Y P+ PG Y +++++  + H+ GSPF+  ++G       I   Q++                  +SVA       L +K   + +++  ++ A           +  P    E   +  +G + + + ++  E G H + VK+  +++PGSPF
Sbjct:    4 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIADLQLDLSDGLRLIALLEILSQKKMYRKFHQRPTFRQMKLENVSVALEFLD-RENIRLVSIDSKAIVDGNLKLILGMVWTLILHYSISMPVWEGEEDD-EAKKATPKQRLLGWIQHKVPDLPITNFSQDWKDGKALGALVDSCAPGLCPDWETWDTEKPVENATEAMQLADDWLGIPQVIAPEEIIDPSVDEQSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGPGIEPVGNRVMRPAVFTVDTFSAGQGQVTVYIEDPEGRREEVK--AVPNEGKKTFSVAYIPQVMGPHKVTVLFAGQQIPKSPFEVNVDKAQGDASKVTAKGPGLEPLGNIANKPTYFDIYTAGAGVGEVTAVIKDPQGNKNTVEALMEDKGDSVFRCTYRPVQAGPHSVNITFGGIAIPKSPYTVTVGPASSPGACRATGRGLQPRGVRVRQVADFRVDTRSAGSGELKVTVKGPKGLEEPVKLTEAMDGTYAYEYYPNTQGKYTVTITWGGQHIPKSPFEVVVGPEAGAQKIRAWGPGLEGGIVGRSADFVAESIGSDVGVLGFAIEGPSQARIECEDQNDGSCDVKYWPTEPGEYAVHVMCDDEDIEDSPFMAYIVPDDKSSDPSQVKAYGPGLEKSGCIINKPAEFTVEAKNAGKGPLKIIAQ--NADGEPIEVKMRNKGDNVYSCTYTPTSALKHTVAVTWGGVSVPNSPFRVNVGKGSHPHKVKVFGPGVERTGLKAHEPTHFTVDCTEAGEGDVSVGIKCD-ANIIS-DKEEDVDFDIIPNANDTITVKYIPPGAGRL-TIKVLFTDQEIPVSPFRVKVEPSHDASKVKADGPGLARAGVESGKPTHFTVHTK---GAGKAPLDVQFSGPIKGEPVQDFEIIDNYDYSYTVKYTPVQQGEMVINVTFGGDPISKSPFAVGVAAPLDLSKIQV--NGLESRVEVGQDQEFAVSTKGAGGQGKLEARITSPSGKSVPCAVEPQPGKGASLVKYIPKEEGVYTVEILYEGNPVPGSPFPVDAMLPPDPSKVKAFGPGLKGG---LVGNPAEFTIDTKGAGTGGLGLTV------EGPTEAKIECSDNGDGTCSVSYLPTEPGEYLVNILFEDVHVPGSPFHADIQYPFDPTKVVASGSGLK-RGKVGEISV---VNVDCAKAGPGQLTLEAMSDAGSKAKTEVLDNKDGTYTVTYVPLTAGMYTLLLKYGGQAVPNFPAKVVVDPAVDTSKVKV-----------------FGPGVAGEGLFREATTDFTVDARALTKVGGKHIKAQVKNPSGAATDCVIADQGDGTYKVEYTPFENGVHAVEVLYDDTPVPKSPFQ-------VGVGEGCDPARVVAKGPGLEEGLTDKAN-----KFSI-ITRGA-GIGGLGITVEGPSESKMSCKDNKDGSCNVEYTPYAPGLYDVNITYGGQHIQGSPFKVPVKDVVDASKVKLSGPGVGSGVRAKIPQSFTVDCSKAGVAPLAVAVTGPKGVAEPVDVIDNGDGTHTVAYTPSVEGPYSVVVKYADEEVPRSPFKLRVLPTHDASKVRASGPGLTTGLPASLPVEFTIDAKDAGEGQLSVQITDQDGKLKTANISDNQDGTYKVSYVPDKVGRYTIVIKYGGDEIPTSPYRVRATTS--GDASKCTVTGPGIGPTIGIGEEVG-FVVNTKGAGKGKVSCVVVTPDGTEVEADVVENEDGTFDIFYTAPKPGTYVIYVRFGGENIPKSPFKVMVTDGAYIPV----------NSMNGTGFR-PFDMVIPFAFRKGEITGEVHMPSGKTTQPEIIDNKDGTVMVKYAPTEAGLHEMHIKYNGSHIPESPLQFYVN---NANSPNVTAYGPGLVYGVANKPATFTIYTEDAAEGGLDLAIEGPSKAEITCIDNKDGTCTVTYLPTLPGDYNILVRYNEKHIAGSPFTARITE------------DNKRRSQVKLGSAADFALDITETDL----SLLTASIKAPSGRDEPCLLKRQPNNRIGISFIPREVGEHLVSIKK--NGRHVANSPITIMVVQSEIGDAGRVQVFGQGLVEGRTFEMSDFVVDTRDAGYGGLALSIEGPSKVDIQTEDMDDGTCGVSYCPTEPGTYIVSIRFAED-HVPGSPFSVKVTGEGRIRESISRRQKA------------------ASVASVGSVCDLNLK---IPEIDALDMSAQ----------VTSPSGSVEPAEIVEVGNHTYCVRFVPHEMGVHTVNVKYRGQHVPGSPF 2156          

HSP 3 Score: 199.519 bits (506), Expect = 1.807e-50
Identity = 196/699 (28.04%), Postives = 307/699 (43.92%), Query Frame = 3
Query: 4758 LTASVRAPSGKEESCILKKMPND---NLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLK--CGISNEMNSFTVDTREAGYGGLSLSIEGP----SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI--TGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFR--IMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEP--AIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGL-MSGFVGKK-NHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSA----------PGEYQITVK-YGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVG-IAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            +T  +  P G+ E   +K +PN+      +++ P+ +G H + V  +G  I  SPF++ V + + GDASKV   G GL+    I+N+   F + T  AG G ++  I+ P    +  E    D  D   + +Y P + G + +NI +    +  SP+ V +     P A        Q     + QV    +  +        +++ TV    G  E  ++ +  DG Y+ ++ P   G +TV +     HIP SPF+  VGP  + GA K+ A G GL+ G      +F   +  +  G L  AIEGPS+A I+ ED+ DGSC VKY+ TEPGEY   +  +D+ I +SPF   I+ ++K  D   V + G         I KPA FTV        ++ GK    I+  +   EP    ++N   N Y+  + P  + +H + VT       +P SPFRV +G + + P  V   G G+  +G    +  HF V+   +G G ++V I   + +     + EE  +F  IP+A          PG  ++T+K    +  I  SPF   +  S         H  S +K D  G   +     +S        H  G  KA L               D+ F G I G   Q  E+   +     + + Y   ++G   + V +G   I  SPF V V
Sbjct:  289 VTVYIEDPEGRREE--VKAVPNEGKKTFSVAYIPQVMGPHKVTVLFAGQQIPKSPFEVNVDKAQ-GDASKVTAKGPGLEPLGNIANKPTYFDIYTAGAGVGEVTAVIKDPQGNKNTVEALMEDKGDSVFRCTYRPVQAGPHSVNITFGGIAIPKSPYTVTVGPASSPGACRATGRGLQPRGVRVRQV---ADFRVDTRSAGSGELKVTVKGPKGLEEPVKLTEAMDGTYAYEYYPNTQGKYTVTITWGGQHIPKSPFEVVVGP--EAGAQKIRAWGPGLEGGIVGRSADFVAESIGSDVGVLGFAIEGPSQARIECEDQNDGSCDVKYWPTEPGEYAVHVMCDDEDIEDSPFMAYIVPDDKSSDPSQVKAYGPGLEKSGCIINKPAEFTVE------AKNAGKGPLKIIAQNADGEPIEVKMRNKGDNVYSCTYTPTSALKHTVAVT--WGGVSVPNSPFRVNVG-KGSHPHKVKVFGPGVERTGLKAHEPTHFTVDCTEAGEGDVSVGIKCDANI---ISDKEEDVDFDIIPNANDTITVKYIPPGAGRLTIKVLFTDQEIPVSPFRVKVEPS---------HDASKVKADGPG---LARAGVESGKPTHFTVHTKGAGKAPL---------------DVQFSGPIKGEPVQDFEIIDNY--DYSYTVKYTPVQQGEMVINVTFGGDPISKSPFAVGV 938          

HSP 4 Score: 193.356 bits (490), Expect = 1.416e-48
Identity = 225/831 (27.08%), Postives = 349/831 (42.00%), Query Frame = 3
Query: 4413 KVAAYGPGLS--HGRTGLPAEFTIVTKDAGAGGLSLAIEGPS--KAEIVCKDNE-NGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPL-----KINNLDIST-------LTASVRAPSGKEES--CILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLK-CGIS-NEMNSFTVDTREAGYGGLSLSIEGPSKAE--IECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEV-CEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPI-VDGGAHKVVASGNGLKLGH--TSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDG----SCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTT--IRSDGKLRATIVGPSRTEEPA---IIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFV--GKKNHFIVNTLNSGTGPLNVTIDGPSK---VQLYSQENEEGYEFI--YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGND-ILFVGIAGPKSQCEEVSVK-HMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            K  AYGPG+     R   PA FT+ T  AG G +++ IE P   + E+    NE   +  V Y P + G + + + FA   IP SPF  N+       S++        PL     K    DI T       +TA ++ P G + +   +++   +     ++ P + G H +N+   G  I  SP+ + VG      A   R  G GL+  G+   ++  F VDTR AG G L ++++GP   E  ++  +  DGT    Y P+  G Y + I +  +H+  SPF V +  E  A   +KI       +   VG   +   +  G   SD+      + G ++   E  D +DG   +K+ P E G + V V   +  I  SPF   + P        +V A G GL+      + P EF++  + AG G L I  +      I+ + R  G    SC   Y  T   ++  ++ +    + NSPFR+ V +       V   G           +P  FTV+  +     +    K  A I+  S  EE     II N   +   +++IP  +G   I V    T++ IP SPFRV +   H D   V A G GL    V  GK  HF V+T  +G  PL+V   GP K   VQ +   +   Y +   Y P   GE  I V +GG+  I+ SPF   ++  ++ S                                K+Q +GL   +  + Q   F V    AG    L   I  P  +    +V+   G+   ++ Y+ +E+G + + + +    +PGSPF VD +
Sbjct:  256 KARAYGPGIEPVGNRVMRPAVFTVDTFSAGQGQVTVYIEDPEGRREEVKAVPNEGKKTFSVAYIPQVMGPHKVTVLFAGQQIPKSPFEVNVDKAQGDASKVTAKGPGLEPLGNIANKPTYFDIYTAGAGVGEVTAVIKDPQGNKNTVEALMEDKGDSVFRCTYRPVQAGPHSVNITFGGIAIPKSPYTVTVGPASSPGA--CRATGRGLQPRGVRVRQVADFRVDTRSAGSGELKVTVKGPKGLEEPVKLTEAMDGTYAYEYYPNTQGKYTVTITWGGQHIPKSPFEVVVGPEAGA---QKIRAWGPGLEGGIVGRSADFVAESIG---SDVGVLGFAIEGPSQARIECEDQNDGSCDVKYWPTEPGEYAVHVMCDDEDIEDSPFMAYIVPDDKSSDPSQVKAYGPGLEKSGCIINKPAEFTVEAKNAGKGPLKIIAQNADGEPIEVKMRNKGDNVYSC--TYTPTSALKHTVAVTWGGVSVPNSPFRVNVGKGSHPH-KVKVFGPGVERTGLKAHEPTHFTVDCTEAGEGDVSVGIKCDANII--SDKEEDVDFDIIPN-ANDTITVKYIPPGAGRLTIKVL--FTDQEIPVSPFRVKVEPSH-DASKVKADGPGLARAGVESGKPTHFTVHTKGAGKAPLDVQFSGPIKGEPVQDFEIIDNYDYSYTVKYTPVQQGEMVINVTFGGD-PISKSPFAVGVAAPLDLS--------------------------------KIQVNGLE-SRVEVGQDQEFAVSTKGAGGQGKLEARITSPSGKSVPCAVEPQPGKGASLVKYIPKEEGVYTVEILYEGNPVPGSPFPVDAM 1035          

HSP 5 Score: 193.356 bits (490), Expect = 1.704e-48
Identity = 203/808 (25.12%), Postives = 347/808 (42.95%), Query Frame = 3
Query:  624 VDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFP---------NAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTS-GDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIF-VTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVI---GEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDH--DIFDVHYQPNTSGPVYNCSIRYDGVN-IPGSPFTIQIK-PEI-------DISKVFVENLQTTIFQESF--IRFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            V +  PGL    A  KP    I+T++A +     L +    K E     N D    +TYL   P         N K   G+P T+++  +  R          +  G  A+F +D        L  +I   +G+     ++  P+  N    ++ P   G + ++++   + +  SP  + + ++  GD  +V+V G G+ +      +   F++ T DAG G ++  +  PS    K++ +       +  V Y   E G + ++I  +   +  SPF V V+     +  ++S R   ++   VG   +  +         ++ ++ SP  S E  +I E+  + +   ++P + G++ + + Y    V  SPF+  V P      + + A GPGL    +G  A F +       G L  ++EGPS A+I   D +DGS  + Y    PG+Y V +  + E IP SPY+  +M  ++  D  ++ V    +Q+ G+ +N P  F +     +  I  +A   + SG     V+S     KY   + P  +G H + V  +   +P SPF+V+V +P    +  ++   G GL   T    A F I+TT AG G+LAV I        P  +  +     + F V Y P   G  Y  SI+Y G N I GSPF  ++  P +       + S + V+ +       S+  +R   +A  + ++G G  KA     +SF     K+G                  MVK  G   Y+ SY   + G+Y+L V + +  I  SPF++ V
Sbjct: 1799 VTAYGPGLVYGVAN-KPATFTIYTEDAAEGGLD-LAIEGPSKAEITCIDNKDGTCTVTYLPTLPGDYNILVRYNEKHIAGSPFTARITEDNKR-------RSQVKLGSAADFALDITETDLSLLTASIKAPSGRDEPCLLKRQPN--NRIGISFIPREVGEHLVSIKKNGRHVANSPITIMVVQSEIGDAGRVQVFGQGLVEGRTFEMSD--FVVDTRDAGYGGLALSIEGPS----KVDIQTEDMDDGTCGVSYCPTEPGTYIVSIRFAEDHVPGSPFSVKVTGEGRIRE-SISRRQKAASVASVGSVCDLNLKIPEIDALDMSAQVTSPSGSVEPAEIVEVGNHTYCVRFVPHEMGVHTVNVKYRGQHVPGSPFQFTVGPLGEGGANKVKAGGPGLERAEIGVPAEFSIWTREAGAGGLSIAVEGPSRAEISFEDRKDGSCGVSYVANEPGDYEVSVKFNEEHIPESPYLVPVMAPSD--DARRLTVTS--LQESGLKVNQPTSFAVRLNGAQGAI--DAKVHSPSGALEECVVSELEQDKYAIRFIPRENGIHTIDVKFNGTHIPGSPFEVRVGEPGQGGDAGLVTAYGSGLERGTTGNQADFIINTTKAGPGSLAVTIEG------PSKVKMECQECSEGFKVQYTPMAPG-NYLISIKYGGPNHINGSPFRAKVMGPRLVNVTNASESSTLTVDPVIRPSSANSYSSLRAASDASKVSSRGSGLSKAYVGQRASFSVDCSKAGKNMLLVGVHGPQTPCEEIMVKHMGSLQYNVSYVLKERGSYLLAVKWGEDHIPGSPFHVTV 2575          
BLAST of Filamin vs. Ensembl Cavefish
Match: flna (filamin A, alpha (actin binding protein 280) [Source:ZFIN;Acc:ZDB-GENE-030131-2145])

HSP 1 Score: 1260.36 bits (3260), Expect = 0.000e+0
Identity = 754/2013 (37.46%), Postives = 1154/2013 (57.33%), Query Frame = 3
Query:  843 ITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKC--TYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGD----PSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK-TSHIAAFGPGLT-TGV-VGKAAIFVTDTNGE-LGSLGFSIEGPSEAK----IECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCV-YQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDIS--KVFVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNE--TTDYTNGM--------YPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIG-EPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPT----QSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            + ++    +VR +GPG+ES   + G++A+F V+A     G L  ++   +   I+       D K    C   Y P   G Y + V    +DI  SPF   I K + D    P KVK  GPG++ +G+ V     F +  +  G   +   + +   D + ++ ++      +Y   YT  +   H++ +         SPF + +    +   V VSG G+   G++  +   F +D   AG G +++ +                           K G Y + + + +  +  +P +I V P+   S + A GPGL+ TGV + K   F  +T G     L     GP++ +     +  +N D + T+ Y P   G   V++   G+ IP +P+   + PS    D+SK+KV G G   + + +    + T+         K  A     +G  +P  +    + +   V + P   G ++V ++ D   +P SPF V+   P++P+ VR  G GL  A       F +D TNAG   L +EI  + G      + ++ D   + + Y P   G  Y  +IRY G ++P  P  + ++P ++ S  KVF   ++   +F+E+   F V+A+A+   G   +K    +PS   + ++++  GDG+Y   Y+PY+ G + ++V Y+D P+ NSPF + V  GCDP++V V G GL+ G TN+PN FT++  GAG G LGLA+EGPS+AK++CTDN DG+C+VEY    PGTY++ I +    + GSPF +P++D ++   VKC G+ +  G+  R + P  FTVDAS+AG APL+   +  +G   P E+    +     + +++VPT  GP++I + +A+  +P +P+   +LP  +  KV+  G G+  TG  +  S+PV+F ID  +AG+G + + +++P+      +I D   G +   Y P   G++ I + +    +   P+ +  +  GDA+KC +   GV   I +  +T+IT++   AG+GK++C +   T +G       + V++  N +GT  I+Y+  +  +Y++ ++FGG  IPN  F+   ++  +  + + + +  +  +A    +   TD   GM         P +  +P ++    V   V  PSG      + DN +G+VT++Y P E G+HEM++  DGI I GSP +F+ +    G V AYGPGL HG    PA FT+ TKDAG GGLSLAIEGPSKA+I C DN++G+C V+Y P++PGDY+I++K+ D +IPGSP++A I G +  R S + +GS +D+PL I  LD+S LTAS+  PSG+EE C+LK + N ++G+SF P+E+G H +N+ ++G HI  SP  +++ Q+EI DAS+VRV G+GL    + E   F +DTR+AGYGGLSLSIEGPSK +I   D  DGTC+V+Y P+EPG Y+INIK+A++HV GS F VK+TGE   ++ E I  ++ AA +  VGSQC+L+LK+P    +DM A VT+  G     EI++ ++  Y I+F+P EMG+HTV V+++  H+PGSPFQFTVGP+ +GGAHKV A G GL+      P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGS GV Y V EPG+Y  SIKFND++I +SPF + V     D   ++VAS+ ++ L     + +PA+F V+        + G + A +  PS   E   +  I++++YA+RFIP+E+G +LI+V  +    HIPGSPF++ +G+  Q  DPGMV A G GL  G  G    FIVNT ++G G L VTIDGPSKV++  QE  EGY+  Y P APG Y I++KYGG YHI GSPF A I+GS   SS   +H+ S++ VD V +S+ +S        SS A +V   GLG+ K  + Q N+F+VD S+AG ++L VG+ GPK  CEE+ VKH+G   + ++Y ++EKG + L+VKWG+ +IPGSPF + V
Sbjct:  573 VGTEAGAQQVRAWGPGLESG--VVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIEC------DDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQHSPFMAEI-KPAPDRDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLK--IQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPLKHTVMVSWGGVNTPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAFEPTYFTVDCAEAGQGDISIGI---------------------------KSGSYTIMVLFADQAIPMTPIRIKVDPSHDASKVKAEGPGLSRTGVELNKPTHFTVNTKGAGKAKLDAQFTGPTKGEAVRDFDIVNNHDNTYTVKYTPVQQGNMGVNVTYGGDPIPKTPFAVAVAPS---LDLSKVKVAGLG---DKMTVGKDQDITVKSKGAGGQGKVGAKVTGPAGKPVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGVPIPGSPFPVEAVAPTDPSKVRCSGPGLERAKVGETGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGD-GTYTITYIPLYPG-AYTLTIRYGGQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFREATTEFTVDARALTKTGGKHIKTCVNNPSGNCTEALIRDQGDGTYKVEYTPYEEGPHSVEVAYDDSPVPNSPFRVPVTEGCDPARVRVHGPGLKAGLTNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCSVEYIPYEPGTYNLNITYGGQPITGSPFSVPVQDTVDPTKVKCQGQGI--GTNVRANIPQVFTVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQT---HTVSYVPTREGPYSINVLYADEEIPRSPYKVKVLPTHDASKVRASGPGLNTTG--VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTGAGVGPTIQIGEQTVITVDAKAAGKGKVTCTV--CTPDG-----AEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVMALEGASPEQLMQQTQVPQYAYAPNMGQPWATDRPMGMNGLDVAGLRPFDLVIPFTIQKGEVTGEVRMPSGKVARPEIADNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYVDYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCVDNQDGTCTVSYLPVLPGDYNILVKYNDKHIPGSPYVAKITGDDSMRMSHLKVGSAADIPLDIGELDLSQLTASLTTPSGREEPCLLKMLRNGHVGVSFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIADASRVRVSGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGE--GRMKESITRKRRAASVANVGSQCDLSLKIPEISIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSVKYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKFNDENIPDSPFVVPVASPSDDARRLTVASLQESGL----KVNQPASFAVSLNG-----AKGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDV--KFNGSHIPGSPFKIRVGEAGQAGDPGMVSAYGAGLEGGNTGSPCEFIVNTSSAGPGALAVTIDGPSKVKMDCQECPEGYKVTYTPMAPGNYLISIKYGGPYHIVGSPFKARITGSRLVSSH-SMHETSSVLVDPVTRSVTSSQQAAPGWASSDASRVVAKGLGLTKGFIGQKNSFSVDCSKAGRNMLLVGVDGPKVPCEEILVKHLGNRLYNVSYQLKEKGEYILVVKWGDDHIPGSPFHITV 2511          

HSP 2 Score: 1212.21 bits (3135), Expect = 0.000e+0
Identity = 793/2350 (33.74%), Postives = 1192/2350 (50.72%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEW---KPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDV-SKIKVYGPGVQKEGVALNSPNEFTIDC-IEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEIN-----------DEIGNILPFTLSNDTDHDIFDV------------------HYQPNT------------SGPVYNCSIR-----------------------------YDGVNIPGSPFTIQIKPEIDISKVFVENL--QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYS-CSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAI--EGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDA---SRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIE-DGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAI-VSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAG-LGKVAAYGPGLSHGRTGLPAEFTIVTKD---AGAGGLSLAIEGPSKAEIVCK--DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF-IANIIGE-----------PQRRSQICIGS--TSDVPLKINNLDISTL----------------TASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ-QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVH--QQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            TE++LA+DA WK IQ+NTFTRW N HLK  N+ I +LQ D SDG+RL+ L+EVLS+ K F   N+R  FR  +LENV++ L FL+ +E +KL++IDS  IVD  LKLILGL+W LILHYSISMP+W+ E+      ++TPKQR++ WI  ++PE  + N + DW  G A+GALVDSCAPGLCPDW  W   KPVD   + +EAM  A++WL VPQ+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP K R YGPGIE    +  + A FTV+  SAG+G + + + D AG   + K+    DK   Y   Y P   G + +TV +A   I +SPF+V +    GD SKV  +GPG+E  G I + +TYF + T  AG GE+  V++ PSG KD +  +I  +  +SYR  Y   + G H I I  +  QI  SP+ V V    N  L    GRG+Q  G+R+ + AEF + T+ AG G+L V +  P+  EE  K  ++    +   Y P+ PG Y + I +    + RSPF++ V        + A+GPGL +GVVGK+A FV +  G ++G+LGFS+EGPS AKIEC D  DGS  + YWPT PGEYAVH+LC  EDI +SP+MA I P+ ++     K+K YGPG+Q  G+++  P EFT+D  +  K+ +K +A      GN + V +   GN  Y C Y P     H V VS    + P+SPF++ +    +PN V+V G G+       + P YF++D   AG G++++ I            D+   + P  +  D  HD   V                  H+  NT            +GP    ++R                             Y G  IP +PF + + P +D+SKV V  L  + T+ ++  I      K+  A G+G V A  T P+       V+       S   + P D G Y +++TY+ +PI  SPF +E V   DPSKV   G GLE     +   F +D   AG   L + I  +  ++A+++  DN DGT T+ Y    PG Y + I++   DV   P +L +   + T+ VK FG  +    + R +    FTVDA   ++ G   +K C  +  G+     I+ + +   G Y + + P E GPH++E+ + +  VP +PF   +    +P +V+V G G+      LT + P +F ++   AG G + L++  P +  +      +G      +Y P + G + + + +   P+   PF V V    D  K   +  G+   +  N   + T++ ++AG   +  R+       +    +  P E+ +NG+ T ++ Y P     Y +++ +    IP   +K K +  ++  +            AS     T       PVEF +      + + A+ ++ P G  + A + DN +G+  + Y P   G + + +   G +I  SPY+  A   G   K    G G+  G T    E T++T D   AG G ++  +  P  AE+     +NE+G+ D+ Y    PG Y I ++F   +IP SPF +  + G            PQ      +G    +D P+ +N LD++ L                T  VR PSGK     +    +  + + + P E G H +++   G HI GSP +  V   +  ++  V  +G GL  G+ N+   FTV+T++AG GGLSL+IEGPSKA+I C DN DGTC VSY P  PG Y I +KY ++H+ GSP+  KITG+ S ++              +VGS  ++ L +     S + A++T   G  E C +  L +GH  + F+PKE+G H V ++    HIP SP    +       A +V  SG GL    T  P EF I TR+AG GGLS++IEGPSK +I+ ED++DG+C V Y  TEPG YI +IKF D H+  S F + V  +     S+        A    +G     ++  P+     S   + A +  PS     A I   E N Y IRF+P E G H ++V  +   +H+PGSPF+  +G         V A G GL     G    F + T  +G G L++ ++GPSK ++  ++ ++G   + YI   PG+Y++++K+  + +I  SPF   ++   +D+  + V   Q+S LKV                                 NQ  +F V  + A   ++   +  P    EE  V  +  +++ + ++ +E G + + VK+   +IPGSPF + V
Sbjct:   32 TEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIANLQTDLSDGLRLIGLLEVLSQKKMFRKYNQRPTFRQMQLENVSVALEFLD-RENIKLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDTDDAKQKTPKQRLLGWIQNKLPELPITNFSRDWQSGKALGALVDSCAPGLCPDWDSWDQTKPVD---NAREAMQQADEWLGVPQVITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTANNDKNRTYSVFYIPKVTGMHKVTVLFAGLHISKSPFEVDVGMAQGDSSKVTAQGPGLEAVGNIANKTTYFDVYTAGAGVGEVEVVIMDPSGKKDTVECQIEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVSVGEACNPSLCVAKGRGLQPKGLRIKETAEFKVYTKGAGTGELKVTIKGPKGLEEPCKKKDLGDGVYSFEYYPTTPGNYIITITWGGQHIPRSPFEVKVGTEAGAQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQHSPFMAEIKPAPDRDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQ--DRDGNPVDVQVKDNGNGTYSCSYTPRKPLKHTVMVSWGGVNTPESPFRMNIGAGCHPNKVKVSGPGVAKTGLKAFEPTYFTVDCAEAGQGDISIGIKSGSYTIMVLFADQAIPMTPIRIKVDPSHDASKVKAEGPGLSRTGVELNKPTHFTVNTKGAGKAKLDAQFTGPTKGEAVRDFDIVNNHDNTYTVKYTPVQQGNMGVNVTYGGDPIPKTPFAVAVAPSLDLSKVKVAGLGDKMTVGKDQDI----TVKSKGAGGQGKVGAKVTGPAGKPVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGVPIPGSPFPVEAVAPTDPSKVRCSGPGLERAKVGETGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYIPLYPGAYTLTIRYGGQDVPNFPARLHVEPAVETSGVKVFGPGVEGKGVFR-EATTEFTVDARALTKTGGKHIKTCVNNPSGNCTEALIRDQGD---GTYKVEYTPYEEGPHSVEVAYDDSPVPNSPFRVPVTEGCDPARVRVHGPGLK---AGLT-NKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGS--CSVEYIPYEPGTYNLNITYGGQPITGSPFSVPVQDTVDPTKVKCQGQGIGTNVRANIPQVFTVDASKAGMAPLQVRV-------QGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPRSPYKVKVLPTHDASKVR----------ASGPGLNTTGVPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKANIRDNQDGTYLVSYVPDMTGRYTILIKYGGDEIPYSPYRIRALPTGDASKCTVTGAGV--GPTIQIGEQTVITVDAKAAGKGKVTCTVCTPDGAEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHIPNSPFQVMALEGASPEQLMQQTQVPQYAYAPNMGQPWATDRPMGMNGLDVAGLRPFDLVIPFTIQKGEVTGEVRMPSGKVARPEIADNKDGTVTVKYAPTEAGLHEMDIKYDGIHIPGSPLQFYV---DYVNSGHVTAYGPGLIHGMVNKPAVFTVNTKDAGEGGLSLAIEGPSKADISCVDNQDGTCTVSYLPVLPGDYNILVKYNDKHIPGSPYVAKITGDDSMRMSH-----------LKVGSAADIPLDIGELDLSQLTASLTTPSGREEPCLLKMLRNGHVGVSFVPKEIGEHLVNIKKNGRHIPSSPISVMINQSEIADASRVRVSGQGLSEARTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDQEDGTCKVTYCPTEPGNYIINIKFADQHVPGSAFTVKVTGEGRMKESITR--KRRAASVANVGSQCDLSLKIPEI----SIADMTAQVTSPSGKVHKAEIMEGENNTYCIRFVPTEMGVHTVSV--KYQGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIKF-NDENIPDSPFVVPVASPSDDARRLTVASLQESGLKV---------------------------------NQPASFAVSLNGA-KGVIDAKVHSPSGALEECCVTEIDEDKYAVRFIPRENGLYLIDVKFNGSHIPGSPFKIRV 2285          

HSP 3 Score: 306.99 bits (785), Expect = 3.526e-83
Identity = 321/1235 (25.99%), Postives = 527/1235 (42.67%), Query Frame = 3
Query: 3165 PIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNI-LPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKG--VFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAE-------NAGLGKVAAYGPGLSHG--RTGLPAEFTIVTKDAGAGGLSLAIEGP--SKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIG--EPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGIS-NEMNSFTVDTREAGYGGLSLSIEGPSKAE----IECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTH-HSDMRATVTNLYGTTEVCEI-IDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAI--EGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGK-LRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSV-AQKVQCHGLGIK---KATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            P+R  +N    + +G  + P + N V +   FTV+   AG+  +    +D  GH    ++ +  N     Y + ++P   G H + +  A + +  +PF  ++ + + +  KV   G G+   G     +    F +  + AG G++++ + +P       +   E KG   + C Y PT  G+H I + F    +   P+ V V +  + + C  +    +   L  +          G G    ++      G     L  P + ++ G+G  S  Y P     Y++ I +GG  IP   F+ K                T++     R       +G+        +     +V  +  +  G   + +   D  +GS  +RY P E G + ++V C    IQ SP  F AE       +    KV AYGPGL       G PAEFT+  K  G   L +  +    +  ++  KDN NG+   +Y P  P  +++++ +   N P SPF  NI     P +             +K++   ++        P+     C      + ++GI     + G++ I V  +   I  +P +I V  +   DASKV+  G GL + G+  N+   FTV+T+ AG   L     GP+K E     +  +N+D T  V YTP + G   +N+ Y  + +  +PFAV +   PS  L +  +      D   VG   ++T+K  G      + A VT   G    C++   L      ++FIP++ G + V + +  + IPGSPF   V  +      KV  SG GL+        +F +    AG   L+I I  +  ++AE+  +D  DG+  + Y    PG Y  +I++    + N P R+ V E  ++   V   G     K         FTV+    T  ++ GK ++  +  PS     A+I++     Y + + P E G H + V  +  +  +P SPFRV +  +  DP  V   G GL +G   K N F V T  +GTG L + ++GPS+ ++   +N++G   + YIP  PG Y + + YGG   I GSPF                                 S+P Q +V   KV+C G GI    +A + QV  F VDAS+AG   L V + GPK   E   V   G     ++Y+   +G + + V + ++ IP SP+ V VL
Sbjct:  276 PLRPKLNPKKARAYGPGIEP-TGNVVMKKAVFTVETISAGQGEVLVYVEDPAGHREEAKVTAN-NDKNRTYSVFYIPKVTGMHKVTVLFAGLHISKSPFEVDVGMAQGDSSKVTAQGPGLEAVGNIANKTT--YFDVYTAGAGVGEVEVVIMDPSGKKDTVECQIEDKGNSSYRCTYKPTQEGQHIIYITFAGGQISKSPYTVSVGEACNPSLCVAKGRGLQPKGLRIKETAEFKVYTKGAGTGELKVTIKGPKG-----LEEPCKKKDLGDGVYSFEYYPTTPGNYIITITWGGQHIPRSPFEVKVG--------------TEAGAQQVRAWGPGLESGVVGKSADFVVEAVGDDVGTLGFSVEGPSPAKIECDDKGDGSCDVRYWPTEPGEYAVHVLCKNEDIQHSP--FMAEIKPAPDRDFYPDKVKAYGPGLQSSGLSVGKPAEFTVDAKLGGKAPLKIQAQDRDGNPVDVQVKDNGNGTYSCSYTPRKPLKHTVMVSWGGVNTPESPFRMNIGAGCHPNK-------------VKVSGPGVAKTGLKAFEPTYFTVDCAEAGQGDISIGI-----KSGSYTIMVLFADQAIPMTPIRIKVDPSH--DASKVKAEGPGLSRTGVELNKPTHFTVNTKGAGKAKLDAQFTGPTKGEAVRDFDIVNNHDNTYTVKYTPVQQGNMGVNVTYGGDPIPKTPFAVAVA--PSLDLSKVKVAG--LGDKMTVGKDQDITVKSKGAGGQGKVGAKVTGPAGKPVPCKVEPGLSPETSQVRFIPRDKGPYEVELTYDGVPIPGSPF--PVEAVAPTDPSKVRCSGPGLERAKVGETGQFVVDCTNAGPAELTIEIISDNGTEAEVHIQDNGDGTYTITYIPLYPGAYTLTIRYGGQDVPNFPARLHV-EPAVETSGVKVFGPGVEGKGVFREATTEFTVDARALT--KTGGKHIKTCVNNPSGNCTEALIRDQGDGTYKVEYTPYEEGPHSVEVAYD--DSPVPNSPFRVPV-TEGCDPARVRVHGPGLKAGLTNKPNKFTVETRGAGTGGLGLAMEGPSEAKMSCTDNKDGSCSVEYIPYEPGTYNLNITYGGQ-PITGSPF---------------------------------SVPVQDTVDPTKVKCQGQGIGTNVRANIPQV--FTVDASKAGMAPLQVRVQGPKGVVEPAEVVDNGDQTHTVSYVPTREGPYSINVLYADEEIPRSPYKVKVL 1417          
BLAST of Filamin vs. Ensembl Cavefish
Match: flnca (filamin-C [Source:NCBI gene;Acc:103033794])

HSP 1 Score: 1112.83 bits (2877), Expect = 0.000e+0
Identity = 765/2337 (32.73%), Postives = 1158/2337 (49.55%), Query Frame = 3
Query:  108 TERELADDAQWKIIQKNTFTRWVNVHLKKANQSINDLQNDFSDGIRLMTLIEVLSEHK-FTHANKRTNFRTQKLENVTMVLRFLEEKEGLKLINIDSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSK-LNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDI-------FDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENL---QTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVK-----SNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFG--EGLEGGFTNQPNFFTIDLDGA-GQGNLGLAIEGPSDAKINCT---DNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGV--APTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEY-----------XXXXXXXXXXXXXXXAGEGKISCRIV-PLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESAL-VHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAEN-AGLGKVAAYGPGLSHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSKAE--IVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF---------IANIIGEPQRRSQICIGSTSDVPLKINNLDI--STLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASK----VRVFGEGLKCGISN----EMNSFTVDTREAGYGGLSLSIEGPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGT-HHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNAL-AKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIG-QQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQS------------NLKVDTVGKSMVTSMP-------------TQSSVAQKVQCHGLGIKKATLNQVNT-----------------------FNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPF 6755
            TE+ELA+DA WK IQ+NTFTRW N HLK  N+++ DLQ D  DG++L+ L+EVLS+ K +   + R NFR  KLENV++ L FL+ +E +KL++IDS  IVD  LKLILG++W LILHYSISMP+W+ +D    + K TPKQR++ WI  ++P+  + N   DW DG A+GALVD+CAPGLCPDW  W P   + + +EAM  A+ WL VPQ+I PEE++DP+VDE ++MTYLSQFP AK+ PGAP+  + L+P K + YGPGIE +  +  + A FTV+   AG G + + + D  G   + K+    DKK  Y  +Y P   G + + V +A +DI +SPF V + KT GDP+KV+ +GPG+E  G +    TYF I T  AG G++S V++ P G KD +   +  +  + +R  Y     G H+I++  +   I  SPF V +S  SNA     +GRG+Q  G+RV + A+F + T+ AG G+L V +  P  +E  VK+ ++    +EC Y P+ PG Y + I +    + RSPF++ V +      + A+GPGL TG+VGK+A FV +  G E+GSLGFSIEGPS+AKIEC D  DGS  + YWPT PG+YAVH++CD EDI +SP+MA+I+P+       K++ +GPG+Q  GV +N P EFTID  +  K ++K  A      G  I + I+  G+  + CVY P     H + +S    +VP SP++V V +  +P+ V+V G G+      +  P YF++D   AG G++++ I    G +   T   D D DI       F V Y P   G  Y   + +    IP SP+ ++++P  D  KV  E     +T +  ++   F +  K     GK   +  F   S+ + G+ VK      N D SY+  Y+    G   + VT+   P+  SPFNI V P  D SKV V G  E +E G   +   FT++  GA GQGN+G+ +  PS   I C    D   G   V+Y     G Y + + ++   V GSPF +    P + + V+ +G  L  G + +   P  F++D   AG   L          E P E K   ++   G   ++++PTE G + I I +    +PG+PF   + P  +  +V V G G+  A  G   T      F +D S AG+ ++ + + +         I +   G F   YTP   G + I++ +    V  CP  ++V    D +      GVK Y            +     +      + G   I  RI+ P   N +          I + G+GT  + Y+  E   +L+++ +  V++P   F+           E  +  + ++          +  N  + VE R            +  T  G  E+ +   DN +GS ++ Y P   G +++N+T  G  I GSP+     +     KV   GPGL  G R  +P  FT+    AG   L + + GP  A   +   +N +G+  V Y P   G Y++ +K+AD ++P SPF          + +        +  + ++  V   I+  D     LT  +  P GK +   ++   +    +S+ P   G + I +   G  I  SP+ I       GDASK    V + G G+     N    E    +VD + AG G ++  +  P  AE++    +N DGT  + YT  EPG Y+I I++  +H+  SPF V+ T EP     EK   Q +   I          L +P T     +   V    G T    I D  DG  ++K+ P E GLH + +++   HIPGSP QF V     G    V A G GL  G  + P  F++ T+ A  GGLS+A+EGPSKAEI  +D KDG+C V Y  T PG+Y   +KF+  HI  SPF   +             GD++L   +  +G  A  ++   +T        L A+I  PS  E+P +++ +      + F PKE GEH ++V    + KH+  SPF++++G  +  +   V A G GLM     +   F V+T N+G G L ++I+GPSKV +  ++ E+G     Y P+ PG Y I +K+    HI GSPFT  ++G       I   +Q+            NLK+      MV++               T++   +  +  G   K+    + +T                       F    S+     +   +  P  +     +   G + + + ++  E G H + VK+  +++PGSPF
Sbjct:   32 TEKELAEDAPWKKIQQNTFTRWCNEHLKCINKNVTDLQRDLGDGLKLIALLEVLSQKKMYRKHHVRPNFRQMKLENVSVALEFLD-RERIKLVSIDSKAIVDGNLKLILGMIWTLILHYSISMPMWD-DDDDEEKKKLTPKQRLLGWIQNKVPQLPINNFNRDWRDGKALGALVDNCAPGLCPDWETWDPNQPVENAREAMQQADDWLGVPQVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPVKPRQLHPKKAKAYGPGIEPEGNMVMKPAVFTVETLDAGLGEVIVYVEDPEGYREEAKVVPNNDKKRTYSVSYVPKVAGPHKVKVLFAGQDIDKSPFSVNVAKTVGDPNKVQARGPGLEPTGNVTQRPTYFDIYTAGAGAGDVSVVIVDPQGKKDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFKVHISEASNASSCRATGRGLQPKGVRVKEVADFRVFTKGAGTGELKVSVKGPGGAEVPVKVRDVGDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQAGLQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGSLGFSIEGPSQAKIECEDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVRAFGPGLQPTGVIVNMPAEFTIDARQAGKGELKIYAQ--DAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLVGEGCHPDKVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVV--GTAEADIDFDIIKNDNDTFTVKYTPPAPG-RYTVMVLFAEKEIPSSPYKVKVEPSHDAGKVRAEGPGLNKTGVQVDTPTHFTIFTK---GAGKAKPEVHF---STGQKGNPVKDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKVQGLNEKVEVGKDQE---FTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGLKGGIVGK---PAPFSIDTKGAGAGGLGLTV------EGPCEAKIECQDNGDGTCSVSYLPTEAGDYNINILYGEKHIPGSPFKAAVKPALDASRVTVSGPGLERAKAGEVAT------FTVDCSRAGEAELTVEIVSDSGATAEVRIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQVEPAVDTS------GVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTD--------THITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFR-------VSVVEGCDPSRVRAYGPGLEGGIVNKPN-CFTVETR------GAGAGGLGLTIEGASEAKMSCKDNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPFHVLVRDVVDASKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLASLDVKLYGPGGATEPVAVLNNGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASKVRASGPGLDKAGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTITIKYGGDQIPFSPYSIQA--RPTGDASKCLLSVSIGGRGVGSLGPNIQMCEETVISVDAKAAGTGKVTCKVLTPDGAELDVDVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHVQATKEPVVPRDEK---QPQFRPI---------NLLIPFTVQQGALTGEVRMPSGKTARPLIRDNKDGTVTVKYAPTERGLHEMDIKYDGNHIPGSPLQFFVDAAESG---MVTAYGPGLCHGTVNKPATFTVVTKNAAEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDGKHIPGSPFTAKIT------------GDDSLRTSQLNVGSAADVSLKITETDL----SSLTASIRAPSGAEQPCLLKTLPNRHIGLSFTPKEVGEHEVSVKK--SGKHVNNSPFKIMVGPSEIGEASRVRAFGKGLMEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDIKCEDVEDGTCRVTYCPTEPGNYIINIKF-AEKHIPGSPFTVKVTGEGRMKESIMRKRQAPSIASVGTICDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVHVEESTKVGGRDPFRDIFGSILGRESLGCFGSLTSKEDVQGMTAQVTSPGGKVVNAELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPF 2273          

HSP 2 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 654/2045 (31.98%), Postives = 988/2045 (48.31%), Query Frame = 3
Query:  858 NPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKL----IDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINP----KITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAG-NGKLNVKLLSPEKSEESVKIA-EINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVL-PTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGF-SIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLH--SATRYTPAYFSIDT---TNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKV--FVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGF-TNQPNFFTIDLDGAGQGNLGLAIEGPSDAK--INCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDK----VKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCR----IVPLT-ENGEVKSNLSLPVE------IENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQ---FKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVC--KDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI----IGEPQRRSQICIGSTSDVPLKINNLDISTLTA-------SVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEG-LKCGISNEMNSFTVDTREAGYG---GLSLSIEGPSKAEIECRDNYDGT-CQVSYTPSEPGTYMINIKYANE-----HVSGSPFAVKITG-EPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDF--ISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQ-HA-DPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKS-------MVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            +P+KV+VYGPG+E   L + +   FTVD   AG+G++ I I   AG +     D+  + I +  + +   YTPP  G YT+ V +AEK+IP SP+KV ++  S D  KV+ +GPG+ + GV V T T+F I T+  G G+    V   +G K   NP    +I      SY V+YTA + G  SI++      +  SPF + V+P  +   V V G    +  + VG   EF ++TQ AG  G + VK++SP       K+  +         YIP + G Y++ ++YD  PV  SPF +  L P   S + A+GPGL  G+VGK A F  DT G        ++EGP EAKIEC DN DG+ ++ Y PT  G+Y ++IL   + IP SP+ A + P+    D S++ V GPG+++          FT+DC     + +      + SG    V I +  +  +   Y P +DG + + +    Q VPK P +++V    + + V+V G G+      R    +F +D       G  ++ V I +  G+     +++  D   + V Y     G ++   + YD V +P SPF + +    D S+V  +   L+  I  +       N   ++ +G G      T   + ++    K N DGS S  Y P+  G Y +++TY   PI  SPF++ V    D SKV   G GL  G   + P  FT+D   AG  +L + + GP  A   +   +N DGT TV Y+ +  G Y + +K+ D DV  SPFK+      + + V+  G  L    +     P+ FT+DA  AGE  L     D +G      I+  ++   G Y +++VP   G + I IK+    +P +P+     P  +  K    V + G GV   G  +         +D   AG G +   +  PD   L  D+++   G F   YT  + GK+ IT+ F    + N PF V+  +                                 E +   R    ++P T + G +   + +P        I +N +GT ++ Y+P E   + +DIK+ G  IP      F +                 T ++ A+F   T +   G                +   V  PS    S    DN +G+ T+ Y P   G + + V  DG  I GSP  F A+  G   +       S    G  A+ ++   +     L+ +I  PS AE  C  K   N    +++ P   G++ + +K +  ++  SPF   +    IGE  R      G       ++    + T  A       S+  PS  +  C  + + +    +++ P E GN+ IN+  +  HI GSPF              V+V GEG +K  I  +  + ++    A  G    L+L I G     +  ++    T  + S+T +      I+     E     HV  S    K+ G +P   +   I+ ++       + S+ ++           M A VT+  G     E+++  D  YS++F+P EMG HTV V++   H+PGSPFQFTVGP+ +GG HKV A G GL+ G    P EFSI+TREAGAGGLSIA+EGPSKAEI FEDRKDGSCGV Y V EPG+Y  SIKFN++HI +SPF + +     D   ++V S+ +    K+  + + A+F V   Q    R  G + A +  PS   E   I +++ ++ AIRFIP+E+G H I+V  +    HIPGSPF V +G+  HA DPG+V A G GL +G  G    F+VNT N+G+G L+VTIDGPSK ++   E  EGY+  Y P APG Y I++KYGG  HI GSPF A I+G V  S    +H+ S++ V+T+ KS          S  + SS   +V C G G+ +A + Q N F VD S+AG ++L VG+ GP++ CE+V VKH+G   + + Y V+EKG + ++VKWG++ +PGSPF V V
Sbjct:  771 HPDKVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDFDIIKNDNDTFTVKYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEP-SHDAGKVRAEGPGLNKTGVQVDTPTHFTIFTK--GAGKAKPEVHFSTGQKG--NPVKDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKVQGL---NEKVEVGKDQEFTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGLKGGIVGKPAPFSIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGTCSVSYLPTEAGDYNINILYGEKHIPGSPFKAAVKPA---LDASRVTVSGPGLER--AKAGEVATFTVDC-SRAGEAELTVEIVSDSGATAEVRIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQVEPAVDTSGVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGD-GTYRVEYTAFEDG-LHLIEVFYDEVAVPKSPFRVSVVEGCDPSRVRAYGPGLEGGIVNKP------NCFTVETRGAGAGGLGLTIEGASEAKMSCKDNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPFHVLVRDVVDASKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLASLDVKLYGPGGATEPVAVLNNGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASKVRASGPGLDKAGVP-ASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQDNKD---GTYTVSYVPDVTGRYTITIKYGGDQIPFSPYSIQARPTGDASKCLLSVSIGGRGVGSLGPNIQMCEETVISVDAKAAGTGKVTCKVLTPDGAELDVDVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHVQATK--------------------------EPVVPRDEKQPQFRPINLLIPFTVQQGALTGEVRMPSGKTARPLIRDNKDGTVTVKYAPTERGLHEMDIKYDGNHIPGSPLQFFVDAAESGMVTAYGPGLCHGTVNKPATFTVVTKNAAEG---------------GLSLAVEGPSKAEISC--KDNKDGTCTVSYLPTAPGDYNIIVKFDGKHIPGSP--FTAKITGDDSLRT-----SQLNVGSAADVSLKITETDLSSLTASIRAPSGAEQPCLLKTLPNRHIGLSFTPKEVGEHEVSVKKSGKHVNNSPFKIMVGPSEIGEASRVRAFGKGLMEAHTFEVAEFFVDTRNAGYGGLGLSIEGPSKVDIKC--EDVEDGTCRVTYCPTEPGNYIINIKFAEKHIPGSPFT-------------VKVTGEGRMKESIMRKRQAPSI----ASVGTICDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVHVEES---TKVGGRDPFRDIFGSILGRESLGCFGSLTSKEDV---------QGMTAQVTSPGGKVVNAELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPFQFTVGPLGEGGPHKVRAGGTGLQRGIAGVPTEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYIVQEPGDYEVSIKFNNEHIPDSPFIVPIATLSDDARRLTVTSLQE----KDLRVYQEASFAV---QRNGAR--GVIDAKVHSPSGVVEECYITDVDADKSAIRFIPRENGVHSIDV--KFNGSHIPGSPFNVRVGETGHAGDPGLVSAYGPGLQAGCTGVPAEFVVNTCNAGSGALSVTIDGPSKAKMDCVECAEGYKINYTPMAPGNYLISIKYGGPQHIVGSPFKAKITG-VRLSGGHSLHETSSVLVETMTKSSKVAGAYSSASSSSLSSDGSRVVCQGAGLTRAFIGQKNIFTVDCSKAGTNMLMVGVHGPRTPCEDVYVKHLGNRLYNVTYTVKEKGNYVVIVKWGDETVPGSPFHVTV 2696          

HSP 3 Score: 382.874 bits (982), Expect = 2.869e-106
Identity = 420/1546 (27.17%), Postives = 680/1546 (43.98%), Query Frame = 3
Query: 2322 NPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEIND-----EIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEI-DISKVFVEN--LQTT--IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGS--MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKI--NCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE---PDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIED-GV-KEYXXXXXXXXXXXXXXXAGEGKISCRI-VPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFK---EKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGA-GGLSLAIEGPSKAEIVCK---DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII--GEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEES-CILKKMPNDN----LGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHH------------SDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDG-GAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSD----GKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKK--NHFIVNTLNSGTGPLNVTI----DGPSKVQLYSQENEEG-YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIV 6761
            +P   +  G G+         PA F+++T +AG G + V + D     E   ++P    N+     + V Y P  +GP +   + + G +I  SPF++ +   + D +KV      L+ T  + Q      +  A A    G G V  +  DP   K     ++++ GD  + C+Y P   G + + V++   PI  SPF + +    + S     G GL+  G    +   F +   GAG G L ++++GP  A++     D  DG    +Y  T+PG Y + I +    +  SPF++ +        V+ +G  L  G + +      F V+A       L          E P + K   E+   G  D+ + PTE G +A+ +   +  +  +PF+ +ILP +    P+KV+  G G+ PTG  +  ++P +F ID  +AG+G++++   + +  ++   I D+G G F C Y P    KH I +++    V N P+ V V +    +K  +   GV K  +  +  T  T++  EAG+G IS  I       G  ++++    +I  N N T ++ Y+P     Y V + F    IP+  +K   E + D   +  E   + KT  Q  +  + T  +T G    +  +  S G +         + +++  ++ DN++ S T++Y   ++G   ++VT  G  +  SP+    A    L KV   G        G   EFT+ T+ AG  G + + +  PS   I CK   D   G  +V Y P   G Y + + +  + +PGSPF    +   +P +      G    +  K     I T  A         E  C  K    DN      +S+ P E G++ IN+     HI GSPFK  V      DAS+V V G GL+   + E+ +FTVD   AG   L++ I   S A  E R  +N DGT  V+YTP   G Y I+I+Y  + V   P  +++  EP+               +   G + +  L+   TH             + +R  + N  G+     I D  DG Y +++   E GLH + V +  + +P SPF+ +V   V+G    +V A G GL+ G  + PN F++ TR AGAGGL + IEG S+A++  +D KDGSC V+Y    PG Y  +I +    I  SPF ++V +          V D +  K    G  +    + PQT T+         L   + GP    EP  + N     + + + P E G + + V  +  +K +P SPF+V     H D   V A G GL    V       F ++  ++G G L V I      P K  +  Q+N++G Y   Y+P   G Y IT+KYGG+  I  SP++   +    D+S+        L V   G+ +        S+   +Q          + +    +VDA  AG   +   +  P     +V V       F I Y   E G++ + +++G ++IP SPF V
Sbjct:  282 HPKKAKAYGPGIEPEGNMVMKPAVFTVETLDAGLGEVIVYVEDPEGYREEAKVVP----NNDKKRTYSVSYVPKVAGP-HKVKVLFAGQDIDKSPFSVNVAKTVGDPNKVQARGPGLEPTGNVTQRPTYFDIYTAGA----GAGDVSVVIVDPQGKKDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFKVHISEASNASSCRATGRGLQPKGVRVKEVADFRVFTKGAGTGELKVSVKGPGGAEVPVKVRDVGDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQAGLQKVRAWGPGLKTGMVGKSAD---FVVEAIGTEVGSLGFSI------EGPSQAKIECEDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVRAFGPGLQPTGVIV--NMPAEFTIDARQAGKGELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLVGEGCHPDKVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDF--DIIKNDNDTFTVKYTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSHDAGKVRAEGPGLNKTGVQVDTPTHFTI-FTKGAGKAKPEVHFSTGQKG--------NPVKDFEII-DNHDYSYTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKVQGLN-EKVEVGKDQEFTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGLKGGIVGKPAPFSIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGTCSVSYLPTEAGDYNINILYGEKHIPGSPFKAAV--KPALDASRVTVSGPGLERAKAGEVATFTVDCSRAGEAELTVEIVSDSGATAEVRIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQV--EPAV--------DTSGVKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFRVSV---VEGCDPSRVRAYGPGLEGGIVNKPNCFTVETRGAGAGGLGLTIEGASEAKMSCKDNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSPFHVLVRD----------VVDASKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLASLDVKLYGPGGATEPVAVLNNGDGTHTVNYTPSEEGPYTVAV--KYADKDVPRSPFKVHSSPAH-DASKVRASGPGLDKAGVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASI--QDNKDGTYTVSYVPDVTGRYTITIKYGGD-QIPFSPYSIQ-ARPTGDASKCL------LSVSIGGRGV-------GSLGPNIQ----------MCEETVISVDAKAAGTGKVTCKVLTPDGAELDVDVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHV 1739          

HSP 4 Score: 284.648 bits (727), Expect = 2.438e-76
Identity = 312/1162 (26.85%), Postives = 493/1162 (42.43%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKS-EPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDI--QXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQ-VGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVST--PSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE-----PQRRSQIC-----IGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFT----PREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGL-KCGI-SNEMNSFTVDTREAGYGGLSLSIE------GPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCE------LTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGA-GGLSIAIEGPSKAEIDFE---DRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQM--DFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTI----DGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIK-KATLNQVNT-FNVDA---SQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            L PGAP    + P+   P K K  G G+ P G  +    P  F ++  +AG G++   +               ++ K  +   Y P  AG H + V F    +   PF V V + VGD NK        E     T+     +   AG G     +V +   G+     ++ V +EN G+      Y P     + + + F G  IP   FK            + E     S  A+ R             +FR+  + GA   E  VS   P G      V D  +G     Y P   G + + +T  G  I  SP++      AGL KV A+GPGL  G  G  A+F +       G L  +IEGPS+A+I C+D  +GSCDV Y+P  PGDY++ +   D +I  SPF+A+I+       P++           G   ++P +            ++  +   E CI+     D    +F     P++   H I +   G ++  SP++++VG+    D  KV+V+G G+ K G+ S+E   FTVD  EAG G +S+ I+      G ++A+I+     N + T  V YTP  PG Y + + +A + +  SP+ VK+  EPS    +    + E   + + G Q +      +  K  G    ++  +        +  EIID  D  Y++K+   + G  ++ V H    +P SPF  +V P +D    KV      +++G      EF++ T+ AG  G + + +  PS   I  +   DR  G   VKY   E G+Y   + ++ + +  SPF +   E  M  D   V + G     K   +GKPA F+++    T     G L  T+ GP   E     Q+      ++ ++P E+G++ IN+      KHIPGSPF+  + +   D   V   G GL     G+   F V+   +G   L V I       ++V++Y+  N+  +   Y P + G Y I+++YGG   +   P                +  Q    VDT G                V+ +G G++ K  L  V T F VDA   ++ G + + V I  P     +  +   G   + + Y   E G H + V + E  +P SPF V V+
Sbjct:  270 LKPGAP----VKPRQLHPKKAKAYGPGIEPEGNMVMK--PAVFTVETLDAGLGEVIVYVEDPEGYREEAKVVPNNDKKRTYSVSYVPKVAGPHKVKVLFAGQDIDKSPFSVNVAKTVGDPNKVQARGPGLEPTGNVTQRPTYFDIYTAGAGAGDVSVVIVDPQGK---KDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFK----------VHISEASNASSCRATGRGLQPKGVRVKEVADFRV-FTKGAGTGELKVSVKGPGGAEVPVKVRDVGDGVYECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQAGLQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGSLGFSIEGPSQAKIECEDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAANDVFPEKVRAFGPGLQPTGVIVNMPAEFTIDARQAGKGELKIYAQDAEGCIIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLVGEGCHPD--KVKVYGPGVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDFDIIKNDNDTFTVKYTPPAPGRYTVMVLFAEKEIPSSPYKVKV--EPSHDAGK---VRAEGPGLNKTGVQVDTPTHFTIFTKGAGKAKPEVHFSTGQKGNPVKDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPVPKSPFNISVAPPLDLSKVKVQGLNEKVEVGKD---QEFTVNTQGAGGQGNVGVKMVSPSGRPIPCKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAV---EALMPADPSKVRAYGPGL--KGGIVGKPAPFSID----TKGAGAGGLGLTVEGPC--EAKIECQDNGDGTCSVSYLPTEAGDYNINIL--YGEKHIPGSPFKAAV-KPALDASRVTVSGPGLERAKAGEVATFTVDCSRAGEAELTVEIVSDSGATAEVRIYNN-NDGTFSVTYTPQSDGPYTISIRYGGQM-VPKCP----------------IRIQVEPAVDTSG----------------VKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTYRVEYTAFEDGLHLIEVFYDEVAVPKSPFRVSVV 1353          
BLAST of Filamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004223.1 (pep scaffold:Pmarinus_7.0:GL476636:147693:235187:1 gene:ENSPMAG00000003806.1 transcript:ENSPMAT00000004223.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 899.812 bits (2324), Expect = 0.000e+0
Identity = 661/2110 (31.33%), Postives = 1014/2110 (48.06%), Query Frame = 3
Query:  843 ITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKC--TYTPPCKGTYTITVRYAEKDI----------------------------------PRSP--FKVTIDKTSGDPSKVKVKGPGIEQNGVI------------------------VSTSTYFIIS---TEDAGTGEISCV-----------VLSPSGD---------------KDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKI--AEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP---TKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAP---GEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSD---IKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEI-NDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRY-DGVNI-PGSPFTIQIKPEIDISKVFVENLQTT-----IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVN-GSPFKLPIRDPINTANVKCFGEPL-------TPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDG-VKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEI-ENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQG-SPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKI-NNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTH--HSDMRATVTNLYGTTEVCEIID-------------LDDGHYSIKFIPKEMGLHTVVVQHRNMHIP--GSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTS------MPTQ-SSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLM 6716
            ++++  P KVR +GPG+E+   +AG++A+F V+A     G L  +I   +   I        D +    C   Y P   G Y + V   E+D+                                  PR+P   K    K     + V ++G  +    VI                        +S ST  ++S        TGE  C            V+ P GD                  ++  I +    +  V+YT    G  +I +F S  ++++SPFG+ V P  +A  V V G GI + G+     A F + T+ AG  +L+V+   P +   +V I  +EI  N+   +   Y P + G   L + Y    V  SPF + V P        +   G  L  G   +  + VT   G  G L   +  P+  K+ C       A       A    G + + +  DG  +P SP+ M  ++P+N     SK++V+G G++   V +  P EF +D          +  E  C      E  +     G+      Y P+  G + V +   +  VP SPF   V      + V+V G G+   T + P       + +   +L      +E+ +I   T     D  I  +     TS   + C  +Y   V + P  P  ++ +P +  S  F ++ + T       +++   F V+A+ I   G   V+     PS   +   V  N DG+Y+  Y P  AG + ++VTY    +  SPF + V  GCDPS+V V G GLEGG T++ N F+ID   AG G LGL +EGP +A +   ++ +G  TVEY +  PG Y  +I +    +  GSPF +P+RD +N A V+C G  L         G++ R   P  F+VD SRAG+A L    +   G   P+E+      + GI+ +T+ P+ +GP+++ +++A   VP +PF  ++L   +  +V+V G GV+ +G  +  S+P  F ID  EAG   + +++ +PD       ++D G G+F   Y P  AG++ + V +    V   PF V     GDA+KCF+ DG     I +   T++ +N  EAG GK++CR++           L L V++ EN  +GT SI ++  +   Y++ ++FGG  IPN                        S F          T  + P    +P SL   ++   V  PSG + S  + DN +G++++ + P E+G+HEM++  +G  I   SP +F+ +      V AYGPGLSHG  G  A FTI TKDAG GGLSLA+EGPSKAEI C+DN++G+C V+Y P  PGDYSI +KFA  +IPGSP++A I  +  R S +  GST DV L+I ++ D + LTA + APSG+++ C+LK++ +  +GISF+P+EVG H ++V + G H+  SPF++ VG +E+GDA +VR  G GL+   + E   F VDTR AG+G + +S+EGPS+ E+ C D  DG C+V Y P EPGTY + IK+A E + GSPF V ++G P  +  E  +CQ  AA +  VGS C L L +P T   H  ++   +    + E   + D                GHYS+      +G          +  P  G  F   V     GG +++    NG ++GH       SI+ R  G        EGP       +   +  C V+     P +Y  S++F D+HI  SPF + V+    +   VA  G   L   W +  PA+F V+        + G++ A +  PS + E   +  I+K   A RF+P+E+G H ++VT +     +PGSPFRV +G+    AD  +V A G GL  G  G    F+V+T  +G G L V IDGPSKV++   E  EGY F Y+P+APG Y +++ YGG +HIAGSP+ A ++G    S    +H+ S+  V+        +      +P + +S + KV+ HG G+  A + + N F VD  +AG+++L VG+ GP   CEEV VKH G  +F + Y V+E+G + L+
Sbjct:  447 VSAEAGPQKVRAWGPGLETG--MAGRSADFVVEAIGTDVGTLGFSIEGPSQARIAC------DDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVRHRPSAKPPLPGLPRAPQPLKTKTKKQPWPFAAVTMRGNSVSDRAVIRFMYLCTDLHIRPSVALRLFVPVPMSVSTSLLVSLTRRRSRHTGESKCFSTKVSANAISPVVVPPGDVSVGIKCAAGAMVPVDSDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHDASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDP-RVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMGCEQEVRV-VTRGAGGRGQLEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLPANP----SKVRVWGEGLRGGEVGI--PAEFCVDTTAAGVGGLGLTVEGPC------EARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKGTTFLPPPLHSSCSLSDSHSLLEPTQREEVKHIDVPTPKEKPDSTIVTILL---TSRMTFTCLFKYIKAVRLTPVLPTKLRARPSLLSS--FHQSFKPTPPSHPALRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAV-RAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVV---QAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASG--VPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLADGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVL-------TPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPN------------------------SPFHVLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPSRSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIREDSLRASLLSRGSTHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLVSG-PGRQKEEVSLCQA-AAPVAVVGSTCSLPLAIPVTDCTHRTLKRVASGKDFSLEGAHVRDDNCTAQRQLPPRVTRSGHYSVSRWLWRVGRGAAGGSDARLASPKIGETFSHRVNEGATGGVNRM----NG-RMGHG------SIFLRGGGG---GGHTEGPFFNTGTCDAHFNSGCAVENVTPPPRDYEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSG--LLESGWKVNHPASFAVHLNG-----AKGRIEAKVHTPSGSVENCFVSEIDK--VAARFVPRENGVHPVSVTCD--GASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGP-RLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLI 2464          

HSP 2 Score: 448.358 bits (1152), Expect = 2.446e-127
Identity = 235/558 (42.11%), Postives = 329/558 (58.96%), Query Frame = 3
Query:  390 DSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIIST----EDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIK 2045
            DS  IVD  LKLILGLVW LILHYSISMP+WE E+      KQTPKQR++ WI  ++P+  + N + DW DG A+GALVDSCAPGLCPDW  W     + + +EAM  AE WL V Q+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP     +GPG+E+      + AEF V+  +AG G + + + D  G   + ++    DK+  +   Y P   G + +TV +A + I RSPF V +    GD  KV  +GPG+E +G +   +TYF I T      AG G+++  VL P G +D +   + Q      R  Y     G H +++  + A + +SPF V +    N      SGRG+QS G+RVGD A F + T+ AG+     K       EE ++  E+     E  Y P   G + + I +    + RSPF++ V        + A+GPGL TG+ G++A FV +  G ++G+LGFSIEGPS+A+I C D  DGS  + Y PT PG+YAVH+LCD ED+  SP+MA+I+P++      +++
Sbjct:    1 DSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEEDD-EAKKQTPKQRLLGWIQHKLPDLPISNFSQDWKDGRALGALVDSCAPGLCPDWEIWDVHQPIDNAREAMQQAEDWLGVAQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSDFGMCK----ASGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVR 553          

HSP 3 Score: 216.853 bits (551), Expect = 2.437e-56
Identity = 215/834 (25.78%), Postives = 362/834 (43.41%), Query Frame = 3
Query: 4554 DNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIG--EPQRRSQICIGSTSDVPLKINNLDISTLTAS-------VRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHI-LGSPFKIVVGQNEIGDASKVRVFGEGLKC----GISNEMNS-----FTVDTREAGYGGLSLSIEGP--SKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPF---QFTVGP-----IVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDF---EDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPS-RTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPG-SPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANIS-----------GSVNDSSEIYVHQQSNLKVDT-------------------------------VGKSMVT---------SMPTQSSV-------AQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKS---QCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            DN +G+  V Y P   G +++ + +A   +P SPF   +    +P R      G    +  + N   I T  A        V  P   E     ++ P     + +     G +  ++   G  I  GSPF + V ++E+  A KVR  G GL      G+   + +     F+VD   AG   L ++ +GP  ++  +E     DG   ++YTPS  G Y ++++YA + V  SPF V +     A  + ++     +A         + T+       + +  T+ +  G      ++D  DG +S+ ++P   G ++V V +    +PGSPF    F  G      + DGG       G  +++G    P    +  +EAG G ++  +  P + E+D    E+  DG+  + +  T+PG Y+ +++F    I NSPF ++   +    IS  S+    L   +++ K                 G +   +  PS R   P II N      ++ F P E G H +++  +    HIP  SP +  + +   D   V A G GL  G VGK   F ++T ++G G L++ ++GPSK ++  Q+N++G   + Y+P+APG+Y I VK+ G  HI GSP+ A I            GS +D S + +   ++  + T                               VG+ +V+         S P + +V       A++V+  GLG+++A   +   F VD   AG   + V + GP      CE++     GR +  + Y   E G ++L +K+ E+ IPGSPF V V
Sbjct: 1178 DNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPG--EAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPV-RDEVNPA-KVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRV-RVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLADGG------PGPAIQIGE---PTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLAMSED---ISTESLRPFHLVVPFSLRK-----------------GHITGEVHMPSGRKASPRIIDN-RDGTMSVSFAPIEKGLHEMDI--KYNGHHIPSRSPLQFYVDEM--DGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQ-HIPGSPYMARIREDSLRASLLSRGSTHDVS-LRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLE---DGRCR--VWYCPPEPGTYHLAIKFAEEQIPGSPFTVLV 1965          

HSP 4 Score: 183.341 bits (464), Expect = 3.657e-46
Identity = 169/686 (24.64%), Postives = 288/686 (41.98%), Query Frame = 3
Query: 4758 LTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHV-SGSPFAVKITGEPSAKLMEKIICQQEAADIT---------QVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAI---EG-PSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTE-EPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            +  +V APSG      +    +    + + P   G H + V  +GA +  SPF++ V      D S+VRV G GL+ G+++  N F++DTR AG GGL L +EGP +A +   ++ +G   V Y    PG Y+ +I Y    + +GSPF V +  E +     K+ C      ++         + G+    ++       + +  T    +GT E  E++   DG +++ + P  +G +++ VQ+    +P SPF   V    D G  +V  +G        S P +F+I TREAG   LSI I   +G P +A +   D  DG   V Y     G Y  ++ +  D +  SPF   V+       S   + D        IG+P    VN  +       GK+   ++ P + E +  +++N     ++I F   + G ++I V      + IP SPF V+   +  D      +   L+  F  +K H         TG   V +    K      +N +G   + + P   G +++ +KY G++  + SP             + YV +                          V  +G G+    + +   F +D   AG   L + + GP     E+S +        ++YL    G + + VK+  ++IPGSP++  +
Sbjct: 1160 VRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADG--CDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPA---KVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARV--LDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPF--PVHAFATGDASKCFLADGGPGPAIQIGEPTLVLVNAKEA----GRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAV--RFGGQLIPNSPFHVLAMSE--DISTESLRPFHLVVPFSLRKGHI--------TG--EVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPSRSPL------------QFYVDEMDG---------------------PSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKA--EISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARI 1783          

HSP 5 Score: 162.925 bits (411), Expect = 5.981e-40
Identity = 172/706 (24.36%), Postives = 295/706 (41.78%), Query Frame = 3
Query:  834 GAPITSKLNPNKVRVYGPGIESKD-------LIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAE-INPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPS--EAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPN-SPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRC--VYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKP-------EIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            G P+  ++NP KVR  GPG+           + AG    F+VD   AG   LD+T     G    V++ +  D    +  TYTP   G Y++ V+YA +D+P SPF V +   + D  +V+V G G+  +GV  S  T F I T +AG   +S  ++ P G   +   ++       + V Y  +  G +S+ +   + ++  SPF V      +A    ++  G     I++G+     ++ + AG GK+  ++L+PE+ E  V + E      F  ++  ++PG Y + + +    +  SPF          H+ A    ++T  + +    V   +   G +   +  PS  +A     DN+DG+ ++ + P   G + + I  +G  IP+ SP    +    ++ D   +  YGPG+    V  ++   FTID  +       E              IS   NK   C   Y P   G++ + V    Q +P SP+  ++ + S   ++   G   H  +   P     D T+     L  +I    G      L    D  I  + + P   G  +  S+R  G ++P SPF + +          +  S + +E  +T    E    F+V+ +     G G++      PS  +     +   DG     Y P + GTY L + + +  I  SPF + V
Sbjct: 1307 GVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVD--GIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDV-LAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRA--RVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLADGG-PGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPF----------HVLAMSEDISTESL-RPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPSRSPLQFYV----DEMDGPSVTAYGPGLSHGMVGKHA--AFTIDTKDAG-----EGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIREDSLRASLLSRGS-THDVSLRIP-----DDTDP--ALLTADIAAPSGRQDVCLLKRLDDGQI-GISFSPKEVGE-HLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAE----FIVDTR---YAGFGSMCVSMEGPSRVE--LHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLV 1965          

HSP 6 Score: 157.532 bits (397), Expect = 2.119e-38
Identity = 223/915 (24.37%), Postives = 348/915 (38.03%), Query Frame = 3
Query: 4212 GAQNVEAIVSTPSGIRESALVHDNNNG--SVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAE--NAGLGKVAAYGPGL--SHGRTGLPAEFTIVTKDAGAGGLS-------LAIEGPSKA-EIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI-------------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAV------------KITGEPSAKLMEKIICQQEAADITQVGSQ----CELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVV----QHRNMHIPGSPFQFTVGPIVDGGAHKVVASGN---GLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRI-MVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQL----YSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCE-EVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL*NMSTT 6788
            G   V   V  P G +E A V   N+   S    Y PR  G H++ V   G  I  SP+       +   GKV A GPG+  S    G    F I T   GAG          L   G   A E+  +   +     TY PL+PG + + + +A   +P SPF  NI              G   R  ++   +   V  K    D     AS       EE    +++        + P  +G H I +   G HI  SPF+++V   E G   KVR +G GL+ G++     F V+      G L  SIEGPS+A I C D  DG+C V Y P+EPG Y +++    E V+ SPF              ++   PSAK     + +      T+   Q      +T++  G   SD RA +  +Y    +C  + +        F+P  M + T ++    + R+ H  G    F+     +  +  VV  G+   G+K                  A G  + ++  S    D     + +  VKY     G +   + F++  + +SPF I +V       + V   G NA   E    KPA FTV          D +     VG +     + I +     Y +++ P + G   + VT      H+PGSPF V +     D G +  +G G       ++   +V     G G L   +  P++ ++                      G +++ V Y G + + GSPF                              M   +P   S   KV+  G G++   +     F VD + AG   L + + GP   CE  +     G     ++YL  + G + + + + + ++PGSPF   V  ++ T+
Sbjct:  188 GLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSDFGMCKAS------GEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLV-SAEAG-PQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVRHRPSAKPPLPGLPRAPQPLKTKTKKQPWPFAAVTMR--GNSVSD-RAVIRFMY----LCTDLHIRPSVALRLFVPVPMSVSTSLLVSLTRRRSRHT-GESKCFSTKVSANAISPVVVPPGDVSVGIKC-----------------AAGAMVPVD--SDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHDASKVRVEGPGINATGVE--AAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVT--YGGDHVPGSPFPVTVAPP-LDLGKIRVEGLGTKLEMGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDG-HPVPGSPFL-----------------------------MEAVLPANPS---KVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGP---CEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETS 1026          

HSP 7 Score: 152.14 bits (383), Expect = 1.077e-36
Identity = 221/938 (23.56%), Postives = 361/938 (38.49%), Query Frame = 3
Query:  786 AMMTYLSQFP---NAKVNPGAPITSKLNPNKV----RVYGPGIESKDLIAGQTAEFTVDAFSAGR-GNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINI-FLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSN-------GIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLT-TGVVGKAAIFVTDTNGELGSLGFSI-----EG-PSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVY----GPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPV---VISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPG-SPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKA---IDAK--GKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFT----NQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNL--DGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPI--RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPF 3461
            + MT+   F      ++ P  P   +  P+ +    + + P   S   +    +EF VDA +  R G   +     A   I  +     +    Y   Y P   G + + V YA   +PRSPF+V +     DPS+V+V GPG+E  G +   +  F I T  AG G +   V  P     + +    ++    + VEY A   G +  +I +  +A    SPFGV V    N   V  SG G+  +        +R G    F +D   AG+  L+V    P  + E V++ +         Y PS  G Y L + Y    V  SPF ++VL       +   G G++ +GV        T    E G    SI     +G P  A++   D  DG  ++ Y P   G Y+V +    +++P SP+  +   +    D SK  +     GP +Q          E T+  +  K   + + +C   +  ++ +   V+ +A +  +  V+     G + + V    Q +P SPF V            +  E L       P  FS+       G++  E++   G      + ++ D     V + P   G ++   I+Y+G +IP  SP    +  E+D   V       T +       +V   A   ID K  G+G +      PS  K+    + N DG+ S SY P   G Y + V +    I  SP+   +      + +L  G   +          P   T D            I  PS  +  C      DG   + +S    G + + ++     V  SPF++ +   +  +   V+  G  L      R  +   F VD   AG     + C   +G   P  ++   E+   G   + + P E G + + IK A   +PG+PF
Sbjct: 1090 SRMTFTCLFKYIKAVRLTPVLPTKLRARPSLLSSFHQSFKPTPPSHPALRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGC-DPSRVRVHGPGLE--GGLTHRANVFSIDTRAAGCGGLGLHVEGPG----EAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARV--LDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATG---DASKCFLADGGPGPAIQI--------GEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLAMSED------ISTESLRPFHLVVP--FSLRK-----GHITGEVHMPSGRKASPRIIDNRD-GTMSVSFAPIEKG-LHEMDIKYNGHHIPSRSPLQFYVD-EMDGPSV-------TAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPS--KAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIREDSLRASLLSRGSTHDVSLRIPDDTDPALLTAD------------IAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEA---RTCEAAEFIVDTRYAG---FGSMCVSMEG---PSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPF 1961          

HSP 8 Score: 122.865 bits (307), Expect = 7.610e-28
Identity = 123/456 (26.97%), Postives = 185/456 (40.57%), Query Frame = 3
Query: 1980 PNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTID--------CIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQP-SNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVE----INDEIG--NILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEID-----ISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGE---------PLTPGSINRVDQPI 3254
            P +P    + P N          +GPGV+  G ++    EF ++         + +  D  PE         E  V   +   + +  VY+P   G HKV V    Q + +SPF V VA P  +   V   G G+  +        YF I T   G G    +    + D  G  + +  TL    D  +    Y+P   GP +  S+ Y G  +P SPF++ I    +      S   +++    +   +  R +      D    G  KA   +P   +        G+G +   Y P   G +++ +T+    I  SPF + V     P KV  +G GLE G   +   F ++  G   G LG +IEGPS A+I C D  DG+C V Y  T PG Y +++  ++ DV  SPF   I      A+  CF E         P  PG + R  QP+
Sbjct:  147 PGAPLRPKLNPKNAHA-------FGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVED--PEGH-----KEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRD-AVLRCTYRPLVPGP-HIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSDF---GMCKASGEEPMRHRE------VGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHIL----PASRDCFPERVRHRPSAKPPLPG-LPRAPQPL 572          

HSP 9 Score: 115.161 bits (287), Expect = 1.722e-25
Identity = 107/378 (28.31%), Postives = 160/378 (42.33%), Query Frame = 3
Query: 4728 LKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFT----PREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCG--ISNEMNSFTVDTREAGYGGLS-------LSIEGPSKA-EIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGE---PSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMD 5810
            ++  N  +  +   V  P G +E    +  P ++   SF     PR  G H + V  +G HI  SPF ++V     GDA KV   G G++    ++ +   F + T   G G          L   G   A E+      D   + +Y P  PG +++++ YA   V  SPF+V I GE   P A        Q     +        LT K  G+     +A+        EV E      G +  ++ P  +G H + +     HIP SPF+  V    + G  KV A G GL+ G      +F +       G L  +IEGPS+A I  +DR DGSC V+Y  TEPG+Y   +  +++ +  SPF   +     D
Sbjct:  182 VETENAGLGEVLVFVEDPEGHKEEA--RVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPH-GDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNI-GEACNPGACRASGRGLQSRGVRVGDAAGFRVLT-KQAGSDFGMCKASGEEPMRHREVGE------GVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVS--AEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRD 546          

HSP 10 Score: 107.842 bits (268), Expect = 2.830e-23
Identity = 114/421 (27.08%), Postives = 172/421 (40.86%), Query Frame = 3
Query: 1713 SPFKINVLPTKTSHIAAFGPGLTT--GVVGKAAIFVTDT-NGELGSLGFSIEGPS----EAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTC-----SGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKV--FVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPG---CDPSKV 2918
            +P +  + P K +H  AFGPG+      V +AA FV +T N  LG +   +E P     EA++   +++  S    Y P   G + V +L  G+ I  SP+   + P +   D  K+   GPGV+  G        F I      +         T        + + + +    +   RC Y+PL  G H V V     +VP SPF V + +  NP   R  G GL S        A F + T  AG      + + E     P     +    + +  Y+P   GP +  +I + G +IP SPF + +  E    KV  +   L+T +   S   FVV A   D    GT+      PS  +        GDGS    Y P + G Y + V  ++  +  SPF   ++P    C P +V
Sbjct:  149 APLRPKLNP-KNAH--AFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPH--GDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSDFGMCKASGE----EPMR-HREVGEGVHEFEYKPLALGP-HVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRS-ADFVVEAIGTDV---GTLGFSIEGPSQARIA--CDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERV 552          

HSP 11 Score: 82.4185 bits (202), Expect = 1.569e-15
Identity = 92/392 (23.47%), Postives = 168/392 (42.86%), Query Frame = 3
Query: 4422 AYGPGLSHGRTGL--PAEFTIVTKDAGAGGLSLAIEGPS----KAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF---IANIIGEPQRRSQICIG--STSDVPLKINNLDISTLTA-----------SVRAPSGKEESC--ILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKC-GIS-NEMNSFTVDTREAG--YGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGP 5513
            A+GPG+      +   AEF + T++AG G + + +E P     +A +  ++++  S    Y P + G + + + FA  +I  SPF   +A   G+  + +    G   + +V  K    DI T              +V  P G+ ++    L++  +  L  ++ P   G H ++V  +GA +  SPF + +G  E  +    R  G GL+  G+   +   F V T++AG  +G    S E P +     R+  +G  +  Y P   G ++I I +  +H+  SPF V ++ E      +K+       +    G   +  ++  GT    +  ++         C+  D  DG   ++++P E G + V V      +  SPF   + P
Sbjct:  162 AFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIG--EACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSDFGMCKASGEEPMRH----REVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGP---QKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACD--DRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILP 542          

HSP 12 Score: 77.411 bits (189), Expect = 4.084e-14
Identity = 100/434 (23.04%), Postives = 169/434 (38.94%), Query Frame = 3
Query: 2283 PKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNI--LPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKP-EIDISKVF-----VENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSG--SMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDA----------SRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE---PDKVK 3503
            P +P + K+    NP N    G G+ +   +    A F ++T NAG G + V + D  G+      T  ND       V Y+P  +GP +  ++ + G +I  SPF + + P   D  KV      VE       + ++           A        +  DP   +      ++   D    C+Y P   G +I+ V Y    + +SPF++ +   C+P      G GL+  G        F +    AG  + G+  +   +  +   +  +G    EY     G + I I +    +  SPF++ +        V+ +G  L  G   R      F V+A          S  G +  +  C D++G               G  D+ +VPTE G +A+ +      V  +PF+ +ILP S    P++V+
Sbjct:  147 PGAPLRPKL----NPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAV-YRPRVAGP-HKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVL-DPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGS-DFGMC-KASGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSAD---FVVEAIGTDVGTLGFSIEGPSQARIAC-DDRGD--------------GSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVR 553          

HSP 13 Score: 71.2478 bits (173), Expect = 3.654e-12
Identity = 110/442 (24.89%), Postives = 171/442 (38.69%), Query Frame = 3
Query: 2574 PGSPFTIQIKPEIDISKVF---VENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDG--SYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVP-GCDPSKVLVFGEGLE--GGFTNQPNFFTI-----------------DLDGAGQGN-LGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTG--GFLTPSVPVQFHIDVSEAG---QGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIE 3806
            PG+P   ++ P+   +  F   VE +  ++  E    FVV     +  G G V     DP   K  + V    D   S+   Y P  AG + + V +    I  SPF + V P   D  KV   G G+E  G    +  +F I                  LD  G+ + + + +E   DA + CT          Y   +PG + + + +    V  SPF + I +  N    +  G  L    + RV     F V   +AG       CK +   E P+  + RE    G+++  + P  LGPH I I      +P +PF   +  ++ P KV+  G G+  TG  G     V      DV   G   +G  Q  ++  D           G G    +Y PT+ G + + V  ++  V   PF+  ++    +  CF E
Sbjct:  147 PGAPLRPKLNPKN--AHAFGPGVEAVGNSV--ERAAEFVVET---ENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCT----------YRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGV-RVGDAAGFRVLTKQAGSD--FGMCKASG--EEPM--RHRE-VGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLE-TGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDD----------RGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPA--SRDCFPE 550          

HSP 14 Score: 58.151 bits (139), Expect = 2.921e-8
Identity = 85/413 (20.58%), Postives = 144/413 (34.87%), Query Frame = 3
Query: 3165 PIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPF-LFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXE------GKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPY 4382
            P+R  +N  N   FG P      N V++   F V+   AG   +    +D +GH+    +  R +       + + P   GPH + +  A   +  +PF +    P  +  KV   G GV P+G     +    F I  +  G G     ++             E         V  C Y P   G H ++V +  + V + PF V + +  +   C       +   +               G         ++ G  K++   P+     G G     Y P  L  +++ I +GG  IP   F+          +        ++  A     + D+      VE    I      +   +  PS  R +    D  +GS  +RY P E G + ++V CD   +  SP+
Sbjct:  150 PLRPKLNPKNAHAFG-PGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAV-YRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKAT--YFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAG---------SDFGMCKASGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMA---GRSADFV-----VEA---IGTDVGTLGFSIEGPSQARIAC--DDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPF 536          
BLAST of Filamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004195.1 (pep scaffold:Pmarinus_7.0:GL476636:147693:235244:1 gene:ENSPMAG00000003806.1 transcript:ENSPMAT00000004195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 457/1389 (32.90%), Postives = 700/1389 (50.40%), Query Frame = 3
Query: 1350 VEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKI--AEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP---TKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAP---GEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSD---IKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRY-DGVNI-PGSPFTI--QIKPEIDISKVFVENLQT-TIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVN-GSPFKLPIRDPINTANVKCFGEPL-------TPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI--------------EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEI-ENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQF-------------KEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDY-----TNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQI-QGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIG--EPQRRSQICIGSTSDVPLKI-NNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPG 5321
            V+YT    G  +I +F S  ++++SPFG+ V P  +A  V V G GI + G+     A F + T+ AG  +L+V+   P +   +V I  +EI  N+   +   Y P + G   L + Y    V  SPF + V P        +   G  L  G   +  + VT   G  G L   +  P+  K+ C       A       A    G + + +  DG  +P SP+ M  ++P+N     SK++V+G G++   V +  P EF +D          +  E  C      E  +     G+      Y P+  G + V +   +  VP SPF   V      + V+V G G+   T + P       + +   +L      +     P          +  V+Y P+     + C  +Y   V + P  P  +  Q      I+K   +   +    +++   F V+A+ I   G   V+     PS   +   V  N DG+Y+  Y P  AG + ++VTY    +  SPF + V  GCDPS+V V G GLEGG T++ N F+ID   AG G LGL +EGP +A +   ++ +G  TVEY +  PG Y  +I +    +  GSPF +P+RD +N A V+C G  L         G++ R   P  F+VD SRAG+A L    +   G   P+E+      + GI+ +T+ P+ +GP+++ +++A   VP +PF  ++L   +  +V+V G GV+ +G  +  S+P  F ID  EAG   + +++ +PD       ++D G G+F   Y P  AG++ + V +    V   PF V     GDA+KCF+              + G    I +   T++ +N  EAG GK++CR++           L L V++ EN  +GT SI ++  +   Y++ ++FGG  IPN  F             +  T                + +     +E+        T  + P    +P SL   ++   V  PSG + S  + DN +G++++ + P E+G+HEM++  +G  I  GSP +F+ +      V AYGPGLSHG  G  A FTI TKDAG GGLSLA+EGPSKAEI C+DN++G+C V+Y P  PGDYSI +KFA  +IPGSP++A II   +  R S +  GST DV L+I ++ D + LTA + APSG+++ C+LK++ +  +GISF+P+EVG H ++V + G H+  SPF++ VG +E+GDA +VR  G GL+   + E   F VDTR AG+G + +S+EGPS+ E+ C D  DG C+V Y P EPGTY + IK+A E + GSPF V ++G P  +  E  +CQ  AA +  VGS C L L +PG
Sbjct:  705 VKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHDASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDP-RVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMGCEQEVRV-VTRGAGGRGQLEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLPANP----SKVRVWGEGLRGGEVGI--PAEFCVDTTAAGVGGLGLTVEGPC------EARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKGTTFLPPPLHSSCSLSDSHSLLELYRSD-----PNQQPEHLKWKLLFVYYSPSFKM-TFTCLFKYIKAVRLTPVLPTKLHKQKTTTTSITKASSQAPPSHPALRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAV-RAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVV---QAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASG--VPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVL-------TPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASLLSRGSTHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLVSG-PGRQKEEVSLCQA-AAPVAVVGSTCSLPLAIPG 2058          

HSP 2 Score: 462.996 bits (1190), Expect = 9.163e-132
Identity = 240/558 (43.01%), Postives = 337/558 (60.39%), Query Frame = 3
Query:  390 DSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIIST----EDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIK 2045
            DS  IVD  LKLILGLVW LILHYSISMP+WE E+      KQTPKQR++ WI  ++P+  + N + DW DG A+GALVDSCAPGLCPDW  W     + + +EAM  AE WL V Q+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP     +GPG+E+      + AEF V+  +AG G + + + D  G   + ++    DK+  +   Y P   G + +TV +A + I RSPF V +    GD  KV  +GPG+E +G +   +TYF I T      AG G+++  VL P G +D +   + Q      R  Y     G H +++  + A + +SPF V +    N      SGRG+QS G+RVGD A F + T+ AG+G+LNV L +P + EE ++  E+     E  Y P   G + + I +    + RSPF++ V        + A+GPGL TG+ G++A FV +  G ++G+LGFSIEGPS+A+I C D  DGS  + Y PT PG+YAVH+LCD ED+  SP+MA+I+P++      +++
Sbjct:    1 DSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEEDD-EAKKQTPKQRLLGWIQHKLPDLPISNFSQDWKDGRALGALVDSCAPGLCPDWEIWDVHQPIDNAREAMQQAEDWLGVAQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNP-RGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVR 556          

HSP 3 Score: 304.679 bits (779), Expect = 4.531e-83
Identity = 332/1410 (23.55%), Postives = 580/1410 (41.13%), Query Frame = 3
Query:  960 GNLDITITDNAGKLI----DVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSP--SGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNA-GNGKLNVKLLSPEKSE-ESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKIN-VLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGE-LGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSP-------NEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEG--LHSATRYTPAYFSIDT---TNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPI-KNSPFNIEVVPGCDPSKVLVFGEGL----EGGF-----TNQPNFFTIDLDGAGQGNLGLAIEGPSDAK--INCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAP-------TGGFLTPSV----PVQFHIDVSEAGQGDIQ-XXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANK--------CFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCR-------IVPLT-ENGEVKSNLSLPV------EIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQ----FKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPY--KFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVC--KDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFI----ANIIGEPQRRSQICIG-------STSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVV 4928
            G++ + I   AG ++    DV  + I +  +     YTPPC G +TI V ++E+++  SPF + +   S D SKV+V+GPGI   GV  +   +F + T  AG  E+      P        ++ +I      SY V+YT  + G   + +      +  SPF V V+P  +   + V G G +   + +G + E  + T+ A G G+L  +LLSP + +                     + G + + + YD  PV  SPF +  VLP   S +  +G GL  G VG  A F  DT    +G LG ++EGP EA++EC D+ DG+ ++ Y P   GEYAV+IL     +P SP+ A + PS E    S ++V+GPGV+K    L  P       ++       Y+SD  P           + V  S +    + C+++ +             +  P  P K+   + +  +  +   +    H A R   + F++D    +  G  ++   +    G     +++++ D   + V Y P+++GP +   + Y G  +P SPF + +    D S+V V         E  +    N  +ID +  G            ++    + + +G ++  Y     G Y+  +TY    I   SPF + V    +P+KV   G GL     GG         P  F++D   AG   L +  +GP   +  +     +DG   + Y+ ++ G Y +++++   DV  SPF + +    +   V+  G  ++   +     P  FT+D   AG+APL     D  G  +P   +  +    G++ ++++P   G +++ + +    VPG+PF  +     +  K   +   V P       T G   P++    P    ++  EAG+G +    L+     L    + +   G F   +T T  G + I V F    + N PF V V     A +                   L   E     + + A    IS         +VP +   G +   + +P        I +N +GT S+ ++P E   + +DIK+ G  IP G     + ++   P+              + A+F  +T D   G                +   V  PS    S    DN +G+ ++ Y P   G + + V   G  I GSPY  +  A    L + +    G +H  +        +  D     L+  I  PS  + VC  K  ++G   +++ P   G++ + ++    ++P SPF     A+ +G+ +R     +G         ++  +        ++  S+  PS  E  C  + + +    + + P E G + + +  +   I GSPF ++V
Sbjct:  671 GDVSVGIKCAAGAMVPVDSDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDV-VPSHDASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTK---LEMGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVE---TSGVQVFGPGVEKGTTFLPPPLHSSCSLSDSHSLLELYRSD--PNQQPEHLKWKLLFVYYSPSFKMTFTCLFKYIK----------AVRLTPVLPTKLHKQKTTTTSITKASSQAPPSHPALRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHD-GTYAVEYVPSSAGP-HAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGL----EGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVP-ASLPTDFTIDTREAGDAPLSITIVDPDG--FPRRARVLDGG-DGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKC-FLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEG---------------GLSLAVEGPSKAEISC--QDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSL-RASLLSRGSTHDVS------LRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHC--EDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLV 2024          

HSP 4 Score: 300.442 bits (768), Expect = 7.373e-82
Identity = 250/879 (28.44%), Postives = 400/879 (45.51%), Query Frame = 3
Query: 3369 GIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPV-KNCPFIVEVIQVGDANKCFIED---------GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAG----------------LGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEI---VCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEP-QRRSQ-----------------ICIGSTSDVPLKINNL--DIST------------------LTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHI-LGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI-TGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPG-THHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVN 5795
            G Y + +VP+  GPHA+E+ +A   VP +PF   +    +P +V+V G G+    G LT    V F ID   AG G + L +  P +  + F+   EG   F  +Y     G++   + +  + +    PF V V    +  K              GV   +      + +++ + AG+  +      +T  G        PVE+    +G  ++ Y+P+ +  Y + +++ G  +P+  F    +   +     +      +      +  TD+T     ++ R     G   +   +  P G    A V D  +G  ++ Y P   G + + V     ++ GSP+   A   G                 G     GPG +  + G P    +  K+AG G ++  +  P + E+   V ++  +G+  + +    PG Y I ++F    IP SPF   +   P  RR++                 +C       P +   +  DIST                  +T  V  PSG++ S  +    +  + +SF P E G H +++  +G HI  GSP +  V +    D   V  +G GL  G+  +  +FT+DT++AG GGLSL++EGPSKAEI C+DN DGTC VSY P+ PG Y I +K+A +H+ GSP+  +I  GE S +           A +   GS  +++L++P  T  + + A +    G  +VC +  LDDG   I F PKE+G H V V+    H+P SPF+  VG    G A +V ASG GL+   T    EF + TR AG G + +++EGPS+ E+  ED +DG C V Y   EPG Y  +IKF ++ I  SPF ++V+
Sbjct: 1184 GTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLE---GGLTHRANV-FSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGG--FTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALD-----VTAQG--PHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVP-ASLPTDFT-----IDTR---EAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAI-QIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEM---DGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLR-----------ASLLSRGSTHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLVS 2025          

HSP 5 Score: 272.322 bits (695), Expect = 3.459e-73
Identity = 248/901 (27.52%), Postives = 393/901 (43.62%), Query Frame = 3
Query: 3954 IENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQI-QGSPYKF-FAENAGLGKVAAYGPGL--SHG-------RTGLPAEFTIVTKDAGAGGLSLAIEGP--SKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIG---STSDVPLKI-NNLDIST-------LTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASK----VRV-----------FGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIEC---RDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLME---------------KIICQQE-----------AADITQVGSQCELTLKVP-GTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIP-GSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPF--RIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQH-ADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQS 6434
            + +N +GT ++ Y P+    + V++ + G  +P   F+           +  +  + +          T   N ++ ++ R   + G   +   V  P          ++  G  T+ Y     G +  ++T  G  I  GSP+     +     KV   GPGL  S G       R G P  F++    AG   L +  +GP  ++  +      +G   +TY P + G YS+ +++A  ++P SPF  +++           G   S S VP  +  +  I T       L+ ++  P G      +    +    +S+ P   G + + V      + GSPF   V     GDASK    VRV            G G    I  E     V+ +EAG G ++  +  P + E++     +  DGT  + +T ++PG Y+I +++  + +  SPF V +   P A+                  + +C++E           + DI+   S     L VP       +   V    G      IID  DG  S+ F P E GLH + +++   HIP GSP QF V  + DG +  V A G GL  G       F+I T++AG GGLS+A+EGPSKAEI  +D KDG+C V Y  T PG+Y  ++KF   HI  SP+  RI+  E            D+  A   + G     ++  P  T       L A I  PS  ++  +++ ++  Q  I F PKE GEHL++V +    +H+P SPFRV +G     D   V A G GL      +   FIV+T  +G G + V+++GPS+V+L+ ++ E+G     Y P  PG Y + +K+     I GSPFT  +SG      E+ + Q +
Sbjct: 1178 VTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFR-------VAVADGCDPSRVRVHGPGLEGGLTHRAN-VFSIDTR---AAGCGGLGLHVEGPG--EAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFP--VHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQI-GEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDIS-TESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEM-DGPS--VTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGE------------DSLRASLLSRGSTHDVSLRIPDDT---DPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVRE--GGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKF-AEEQIPGSPFTVLVSGPGRQKEEVSLCQAA 2040          

HSP 6 Score: 251.521 bits (641), Expect = 6.482e-67
Identity = 244/923 (26.44%), Postives = 388/923 (42.04%), Query Frame = 3
Query: 2211 YRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNI-PGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKA-----IDAK--GKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGPSD--AKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCF------GEPLT-------PGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVI--------------GEGVAPTGGFLTPSVPVQFHIDVSEAG-------------QGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPV-KNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLG---KVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQI----------CIGSTSDVPLKINNLDISTLTASVRAP 4781
            Y   Y P + G H V V+     VP+SPF+V VA   +P+ VRV G GL     +    FSIDT  AG G L + +       + F    +     F V Y   + G  Y   I Y G  I  GSPF + ++ E++ +KV        +     +   V A A     +D    G   +      P   +    V    DG ++ +Y+P   G Y L V Y    + +SPF ++V+   D  +V V G G+   G   + P  FTID   AG   L + I  P     +    D  DG  +V Y   + G Y + + +   +V GSPF  P+         KCF        PL        PG   ++ +P    V+A  AG    K  C+     +  L++   EN   G + I F  T+ GP+ I ++    L+P +PF  ++L ++ P   +                G G+     +  PS  +    D+S                +G I   +  P        IID   G     + P + G H + + +N   +    P    V ++   +      G+  + ++      TI+T +AGEG +S     L   G  K+ +S     ++N +GT S+ Y P    +Y + +KF G  IP   +  +          +   +  ++   S R  T D       V  R+P       + A ++ PSG ++  L+   ++G + I + P+E G H ++V   G  +  SP++     + +G   +V A G GL   RT   AEF + T+ AG G + +++EGPS+ E+ C+D E+G C V Y P  PG Y + IKFA+  IPGSPF   + G  +++ ++           +GST  +PL I   ++   TA  + P
Sbjct: 1186 YAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAF---EEDPEGGFTVEYHAPSPGE-YLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPF--PVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRG--KVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPF--HVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLS-HGMVGKHAAFTIDTKDAGEGGLS-----LAVEGPSKAEIS----CQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARI---------IAGEDSLRASLLS-RGSTHD-------VSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLVSGPGRQKEEVSLCQAAAPVAVVGSTCSLPLAIPGNELFNCTAQRQLP 2071          

HSP 7 Score: 243.432 bits (620), Expect = 2.038e-64
Identity = 159/478 (33.26%), Postives = 250/478 (52.30%), Query Frame = 3
Query: 5382 EIIDLDDGHYSIKFIPKEM-GLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPG---EYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQY---AIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTS------MPTQS-SVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            +++ L  G  S  F+ + M   H+V  +  +  +     + T   + +GG  KV   G             F  +T + GA   S+ ++  +       DR      V    T+ G   +Y  S++F D+HI  SPF + V+    +   VA  G   L   W +  PA+F V+        + G++ A +  PS + E   +  I+K+++   A RF+P+E+G H ++VT +     +PGSPFRV +G+    AD  +V A G GL  G  G    F+V+T  +G G L V IDGPSKV++   E  EGY F Y+P+APG Y +++ YGG +HIAGSP+ A ++G    S    +H+ S+  V+        +      +P ++ S + KV+ HG G+  A + + N F VD  +AG+++L VG+ GP   CEEV VKH G  +F + Y V+E+G + L+VKWG++++PGSPF V V
Sbjct: 2154 DLLKLKAGQGSYPFVTELMCSKHSVTYKASSQRVAVCKDRRTSRLVGNGGHRKVRLWGVSPSRATQPVCTRFYFWTHKKGARASSVDVDCVALNSFAVHDRLHVDKRVSQ--TKNGINRDYEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSG--LLESGWKVNHPASFAVHLNG-----AKGRIEAKVHTPSGSVENCFVSEIDKDKWSLLAARFVPRENGVHPVSVTCD--GASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGP-RLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2619          

HSP 8 Score: 230.335 bits (586), Expect = 1.861e-60
Identity = 265/1014 (26.13%), Postives = 418/1014 (41.22%), Query Frame = 3
Query: 3984 IYYSPNE------LSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNI-PGSPFIANIIGEPQRRSQIC-------------IGSTSDVPLKINNLDIS-----TLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKC-GISNEM-NSFTVDTREAGYGGLSLSIEGPSKAEIECR--DNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVK--ITGEPSAKLMEKIICQQEAADITQVGSQ------CELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLD------DGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVG----------PIVDGGAHKVVASGNGL-KLGHTSGPNEFSIYTREAGA----------------GGLSIAIEGPS--KAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHI-INSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPF--RVVIGQQHADPGMVHAKGDGLMSGFVGK-KNHFIVNTLNSGTGPLNVTID-----GPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGS-VNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKS---QCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            +YYSP+       L +Y+  ++   V +P    K+KT   +          +      + R+  +++      V+ R     G  +V   V  PSGI     V DN++G+  + Y P   G H + VT  G ++  SP++   A+     +V  +GPGL  G T     F+I T+ AG GGL L +EGP +A +  +++  G   V Y+   PG+Y   I +    I  GSPF   +  E       C             +G+      ++ ++D S      L  + + P G  E   + +  +    +++TP  VG + ++V  +G  +  SPF + V      DA +VRV G G+   G+   +   FT+DTREAG   LS++I  P       R  D  DG   VSY P   G Y + + Y  + V GSPF V    TG+ S   +   +       +T  G         E TL +     +  R  VT    T E  E +D+D      DG +SI F   + G + + V+     IP SPF   V           P          A G GL +      P+E    + +                   G ++  +  PS  KA     D +DG+  V +   E G +   IK+N  HI   SP +  V+E  MD  SV + G         +GK AAFT++    T    +G L   + GPS+ E     Q+ +    ++ ++P   G++ I V  +   +HIPGSP+  R++ G+            D L +  + +   H +   +   T P  +T D     G   V L  + ++      + P   GE+ ++V+ GG  H+  SPF   +  S V D                               A++V+  GLG+++A   +   F VD   AG   + V + GP      CE++     GR +  + Y   E G ++L +K+ E+ IPGSPF V V
Sbjct: 1086 VYYSPSFKMTFTCLFKYIKAVRLTPV-LPTKLHKQKTTTTSITKASS----QAPPSHPALRDAVSEFA-----VDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAY--DAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAG-RGKVTCRVLTPEQLE-LDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDE--MDGPSVTAYGPG--LSHGMVGKHAAFTID----TKDAGEGGLSLAVEGPSKAE--ISCQDNKDGTCSVSYLPTAPGDYSIAV--KFAGQHIPGSPYMARIIAGE------------DSLRASLLSRGSTHDVSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGR-HVPSSPFRVAVGASEVGD-------------------------------ARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDL---EDGRCR--VWYCPPEPGTYHLAIKFAEEQIPGSPFTVLV 2024          

HSP 9 Score: 216.083 bits (549), Expect = 3.583e-56
Identity = 204/832 (24.52%), Postives = 347/832 (41.71%), Query Frame = 3
Query:  843 ITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPR-SPFKVTIDKTSGDPSKVKVKGPGI---EQNGVI----VSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKTSHIAAFG--------PGLTT-GVVGKA-------AIFVTDTNGELGSLGFSIEGPS--EAKIECCDN-QDGSATICYWPTAPGEYAVHILCDGEDIPNSPY--MANIMPSNEKTD--VSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEA-------------------SCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPK-SPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPG--CDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDP 3179
            +    +P++VRV+GPG+E    +  +   F++D  +AG G L + + +  G+   V  EE  D +  +   Y  P  G Y   + Y    I   SPF V + +   +P+KV+  GPG+      GV+          F +    AG   +      P G ++ +  ++ Q     + + YT    G +S+++  +   + +SPFGV V    +A  V VSG G+ ++G+      +F IDT+ AG+  L++ ++ P+      ++ +     F   Y+P   G Y + + Y    V  SPF ++   T  +              PG+TT G  G A        + V       G +   +  P   E  ++  +N  DG+ +I +  T PG Y + +   G+ IPNSP+  +    P   +T    +   +  P     G+          + I    DI  E+                        SG +    I    +      + P+  G H++ +  +   +P  SP +  V +   P +V   G GL        A F+IDT +AG G L++ +    G         D       V Y P   G  Y+ ++++ G +IPGSP+  +I    D       +L+ ++         V+ +  D      + A    PS  +   ++K   DG    S+SP + G +++ V      + +SPF + V      D  +V   G GLE   T +   F +D   AG G++ +++EGPS  +++C D  DG C V Y    PGTY + IKF +  + GSPF + +  P
Sbjct: 1218 VADGCDPSRVRVHGPGLEGG--LTHRANVFSIDTRAAGCGGLGLHV-EGPGE-AHVAFEE--DPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPV-RDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPV--EVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGP-SVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVE---GPSKAEISCQDNKDGTCSVSYLPTAPGD-YSIAVKFAGQHIPGSPYMARIIAGED-------SLRASLLSRGSTHD-VSLRIPDDTDPALLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLVSGP 2027          

HSP 10 Score: 202.216 bits (513), Expect = 5.757e-52
Identity = 176/634 (27.76%), Postives = 287/634 (45.27%), Query Frame = 3
Query:  834 GAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSK----VKVKG---PGIEQNG-----VIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVS---------PRSNAKLVT---VSGRGI--------------QSNGIRVGDKAEFFIDTQ-NAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYD--NIPVTRSPFKINVLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTN--GELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKV--AQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQI 2600
            G  + +  +  +VRV G G+ +  + A    +FT+D   AG   L ITI D  G     ++ +  D    +  +Y P   G Y++ V Y   ++P SPF V    T GD SK    V+V     PG+  +G     + +   T  +++ ++AG G+++C VL+P   +  ++  +   +  ++ + +TA + G + I +      I NSPF V+V          P +  + +T     GRG+               S  I       F +    +   G +  ++  P   + S +I +         + P + G++E+ I Y+  +IP T SP +  V       + A+GPGL+ G+VGK A F  DT   GE G L  ++EGPS+A+I C DN+DG+ ++ Y PTAPG+Y++ +   G+ IP SPYMA I+   +    S +           V+L  P++   D     +DI         SG +   ++    + +    + P   G H V V    + VP SPF+V V  ++  +   VR  G GL  A     A F +DT  AG G++ V +    G         D +     V Y P   G  Y+ +I++    IPGSPFT+ +
Sbjct: 1413 GVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGD--GLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFAT-GDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVD-VVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIP-TGSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGE-GGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASLLSRG----STHDVSLRIPDD--TDPALLTADIA------APSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSME---GPSRVELHCEDLEDGRCRVWYCPPEPG-TYHLAIKFAEEQIPGSPFTVLV 2024          

HSP 11 Score: 179.104 bits (453), Expect = 6.007e-45
Identity = 175/725 (24.14%), Postives = 300/725 (41.38%), Query Frame = 3
Query: 4767 SVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHV-SGSPFAVKITGEPSAKLMEKIICQQEAADIT---------QVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAI---EG-PSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRI---MVNEKQMDFISV--------ASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTE-EPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVI-----GQQHADP----GMVH--AKGDGL--------------MSGFVGKKN----HFIVN-TLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL 6770
            +V APSG      +    +    + + P   G H + V  +GA +  SPF++ V      D S+VRV G GL+ G+++  N F++DTR AG GGL L +EGP +A +   ++ +G   V Y    PG Y+ +I Y    + +GSPF V +  E +     K+ C      ++         + G+    ++       + +  T    +GT E  E++   DG +++ + P  +G +++ VQ+    +P SPF   V    D G  +V  +G        S P +F+I TREAG   LSI I   +G P +A +   D  DG   V Y     G Y  ++ +  D +  SPF +      +    F++V            D        IG+P    VN  +       GK+   ++ P + E +  +++N     ++I F   + G ++I V      + IP SPF V++      ++   P     + H  A G GL              MS  +  ++    H +V  +L  G     V +    K      +N +G   + + P   G +++ +KY G++   GSP             + YV +                          V  +G G+    + +   F +D   AG   L + + GP     E+S +        ++YL    G + + VK+  ++IPGSP++  ++
Sbjct: 1165 AVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADG--CDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPA---KVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARV--LDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEA----GRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAV--RFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPL------------QFYVDEMDG---------------------PSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKA--EISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARII 1841          

HSP 12 Score: 161.77 bits (408), Expect = 1.376e-39
Identity = 179/750 (23.87%), Postives = 303/750 (40.40%), Query Frame = 3
Query:  834 GAPITSKLNPNKVRVYGPGIESK-------DLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGR-------GIQSNG-----IRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAE-INPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-------------LPTKTSHIAAFGPGLTTGVVGKAAI------------------FVTDTNGELGSLGFSIEGPS--EAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPN-SPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRC--VYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEG-LHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKP-------EIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            G P+  ++NP KVR  GPG+           + AG    F+VD   AG   LD+T     G    V++ +  D    +  TYTP   G Y++ V+YA +D+P SPF V +   + D  +V+V G G+  +GV  S  T F I T +AG   +S  ++ P G   +   ++       + V Y  +  G +S+ +   + ++  SPF V      +A    ++ R       G+ ++G     I++G+     ++ + AG GK+  ++L+PE+ E  V + E      F  ++  ++PG Y + + +    +  SPF + V              P   +H AA G GL    + +A                     V   +   G +   +  PS  +A     DN+DG+ ++ + P   G + + I  +G  IP  SP    +    ++ D   +  YGPG+    V  ++   FTID  +       E              IS   NK   C   Y P   G++ + V    Q +P SP+  ++    +     ++  G  H  +   P     D T+     L  +I    G      L    D  I  + + P   G  +  S+R  G ++P SPF + +          +  S + +E  +T    E    F+V+ +     G G++      PS  +     +   DG     Y P + GTY L + + +  I  SPF + V
Sbjct: 1309 GVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVD--GIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDV-LAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRA--RVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYV----DEMDGPSVTAYGPGLSHGMVGKHA--AFTIDTKDAG-----EGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASLLSRGSTHDVSLRIP-----DDTDP--ALLTADIAAPSGRQDVCLLKRLDDGQI-GISFSPKEVGE-HLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAE----FIVDTR---YAGFGSMCVSMEGPSRVE--LHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFTVLV 2024          

HSP 13 Score: 158.688 bits (400), Expect = 1.044e-38
Identity = 218/924 (23.59%), Postives = 355/924 (38.42%), Query Frame = 3
Query:  924 AEFTVDAFSAGR-GNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINI-FLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSN-------GIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLT-TGVVGKAAIFVTDTNGELGSLGFSI-----EG-PSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDV-SKIKVYG---PGVQKEG-----VALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPV---VISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKV---------KVAQPSNPNNV---RVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSN--------------------DTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIP-GSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKA---IDAK--GKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEG------LEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNL--DGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPI--RDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSR-ENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPF 3461
            +EF VDA +  R G   +     A   I  +     +    Y   Y P   G + + V YA   +PRSPF+V +     DPS+V+V GPG+E  G +   +  F I T  AG G +   V  P     + +    ++    + VEY A   G +  +I +  +A    SPFGV V    N   V  SG G+  +        +R G    F +D   AG+  L+V    P  + E V++ +         Y PS  G Y L + Y    V  SPF ++VL       +   G G++ +GV        T    E G    SI     +G P  A++   D  DG  ++ Y P   G Y+V +    +++P SP+  +   + + +     ++V     PGV  +G     + +  P   T+  +  K   + + +C   +  ++ +   V+ +A +  +  V+     G + + V    Q +P SPF V         +   P+ P  +      G GL     +     SI  +     +++ E       ++PF+L                      D       V + P   G ++   I+Y+G +IP GSP    +  E+D   V       T +       +V   A   ID K  G+G +      PS  K+    + N DG+ S SY P   G Y + V +    I  SP+   ++ G D  +  +   G      L       P   T D            I  PS  +  C      DG   + +S    G + + ++     V  SPF++ +   +  +   V+  G  L      R  +   F VD   AG     + C   +G   P  ++   E+   G   + + P E G + + IK A   +PG+PF
Sbjct: 1145 SEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGC-DPSRVRVHGPGLE--GGLTHRANVFSIDTRAAGCGGLGLHVEGPG----EAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARV--LDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEP---TLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLTHPAAGGRGLCERELWRAPSESIAMSE----DISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKG-LHEMDIKYNGHHIPTGSPLQFYVD-EMDGPSV-------TAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPS--KAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASLLSRGSTHDVSLRIPDDTDPALLTAD------------IAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEA---RTCEAAEFIVDTRYAG---FGSMCVSMEG---PSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPF 2020          

HSP 14 Score: 144.436 bits (363), Expect = 2.221e-34
Identity = 100/353 (28.33%), Postives = 165/353 (46.74%), Query Frame = 3
Query: 4605 DYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKIN---------NLDISTLTASVRAPSGKEESCILKKMPNDN---LGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQ-NEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYAN-EHVSGSPFAVKITG----------EPSAKLME-------------------------KIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDG---HYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTV 5507
            DY + ++F D +IPGSPF+  + G  +   ++ +    +   K+N         N     + A V  PSG  E+C + ++  D    L   F PRE G H ++V   GA + GSPF++ VG+     DA+ V  FG GL+ G +     F VDT  AG G L+++I+GPSK  ++C +  +G     Y P+ PG Y+++I Y    H++GSP+  ++TG          E S+ L+E                         K+           VG Q   T+   G   S++   +  + G +  CE + +       +++ +  KE G + ++V+  + H+PGSPF+ TV
Sbjct: 2271 DYEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSGLLESGWKVNHPASFAVHLNGAKGRIEAKVHTPSGSVENCFVSEIDKDKWSLLAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGY-HFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDC-GRAGSNV--LLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2619          

HSP 15 Score: 141.739 bits (356), Expect = 1.575e-33
Identity = 190/761 (24.97%), Postives = 314/761 (41.26%), Query Frame = 3
Query: 4236 VSTPSGIRESALVHDNNNGSVTIR--YEPRERGMHEMNVTCDGIQIQGSPYKF-FAENAGLGKVAAYGPGL-SHG-RTGLPAEFTIVTKDAGAGGLSLAIEGPSKAE-IVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGE--PQRRSQI-------CIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFK---IVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGY--GGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADI-TQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCE------IIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLG--HTSGPNEFSIYTREAGAGGLSIAIEGPSKAE----IDFE--DRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEP-AIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDS 6407
            V  P G R++  +         +R  Y P   G H ++V   G  +  SP+     E    G   A G GL S G R G  A F ++TK AG+G L++ +  P   E +  ++   G  +  Y PL  G + I I +   +IP SPF   +  E  PQ+             G ++D  ++    D+ TL  S+  PS    +C  +   + +  + + P E G++ ++V      +  SPF    +   ++   +  + R   +    G+          T++  +    L L+   P K E+  R    G   VS      G+ +I +  +   +    F + +T  P        +C +E+    T+V +     + VP     D+   +    G     +      II  D+   ++K+ P   G  T++V      +  SPF   V P  D  A KV   G G+       + P  F++YTR AG   L +  E P        +D E  D  D S  VKY   + G     + +  DH+  SPF + V       + +  +    L  +  +G      V    T      G+L A ++ P+R + P +     E    A      E+G H ++VT +     +PGSPF ++     A+P  V   G+GL  G VG    F V+T  +G G L +T++GP + +L   ++ +G   + Y+P   GEY + + +  + H+ GSPFTA +  SV  S
Sbjct:  300 VLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRG--DGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVRHRPSAKPPLPGLPRAPQPLKTKTKKQPWPFAALYLTWALPLKFEVVSRSTMRGN-SVS---DRAGSNVIIVSSSRIIIIIIIFLIDVTQSP------LTVCTRESKCFSTKVSANAISPVVVP---PGDVSVGIKCAAGAMVPVDSDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHD--ASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPP----LDLGKIRVEGLGTKLEMGCEQEVRV---VTRGAGGRGQLEARLLSPTRQKVPCSSEPLAEAAAPAAAAALLETGPHRMDVTYD--GHPVPGSPF-LMEAVLPANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTCSVSYLPVQAGEYAVNILF-ADAHVPGSPFTAVVKPSVETS 1032          

HSP 16 Score: 130.183 bits (326), Expect = 4.631e-30
Identity = 110/359 (30.64%), Postives = 153/359 (42.62%), Query Frame = 3
Query: 4212 GAQNVEAIVSTPSGIRESALVHDNNNG--SVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAE--NAGLGKVAAYGPGL--SHGRTGLPAEFTIVTKDAGAGGLS-------LAIEGPSKA-EIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI-----------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI 5213
            G   V   V  P G +E A V   N+   S    Y PR  G H++ V   G  I  SP+       +   GKV A GPG+  S    G    F I T   GAG          L   G   A E+  +   +     TY PL+PG + + + +A   +P SPF  NI            G   +   + +G  +   +         L   +R P G EE    +++        + P  +G H I +   G HI  SPF+++V   E G   KVR +G GL+ G++     F V+      G L  SIEGPS+A I C D  DG+C V Y P+EPG Y +++    E V+ SPF   I
Sbjct:  188 GLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRG-EEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLV-SAEAG-PQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHI 543          

HSP 17 Score: 123.25 bits (308), Expect = 6.066e-28
Identity = 124/454 (27.31%), Postives = 186/454 (40.97%), Query Frame = 3
Query: 1980 PNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTID--------CIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQP-SNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVE----INDEIG--NILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEID--ISKVFVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGE---------PLTPGSINRVDQPI 3254
            P +P    + P N          +GPGV+  G ++    EF ++         + +  D  PE         E  V   +   + +  VY+P   G HKV V    Q + +SPF V VA P  +   V   G G+  +        YF I T   G G    +    + D  G  + +  TL    D  +    Y+P   GP +  S+ Y G  +P SPF++ I    +    +     LQ+  +       F V  K     G G +  +  +P   +     +  G+G +   Y P   G +++ +T+    I  SPF + V     P KV  +G GLE G   +   F ++  G   G LG +IEGPS A+I C D  DG+C V Y  T PG Y +++  ++ DV  SPF   I      A+  CF E         P  PG + R  QP+
Sbjct:  147 PGAPLRPKLNPKNAHA-------FGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVED--PEGH-----KEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRD-AVLRCTYRPLVPGP-HIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQ---AGSGELNVLLRNPRG-EEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHIL----PASRDCFPERVRHRPSAKPPLPG-LPRAPQPL 575          

HSP 18 Score: 118.242 bits (295), Expect = 2.158e-26
Identity = 87/307 (28.34%), Postives = 134/307 (43.65%), Query Frame = 3
Query: 4179 YPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTI---RYEPRERGMHEMNVTCDGIQIQGSPYKF------FAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFAD-HNIPGSPFIANII--------------------GEPQRR---------------------------SQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVV 4928
            +P  F + ++     +EA V TPSG  E+  V + +    ++   R+ PRE G+H ++VTCDG  + GSP++        A +A L  V+A+GPGL  G TG PAEF + T  AG G L++AI+GPSK  + C +   G     Y P  PG Y + I +   H+I GSP+ A +                     GEP+R                            S   +G  +   +       + L   V  PS   E   +K        +++  +E G++ + V     H+ GSPF++ V
Sbjct: 2316 HPASFAVHLNGAKGRIEAKVHTPSGSVENCFVSEIDKDKWSLLAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAAL--VSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGY-HFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2619          

HSP 19 Score: 117.087 bits (292), Expect = 4.409e-26
Identity = 101/375 (26.93%), Postives = 161/375 (42.93%), Query Frame = 3
Query: 4728 LKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFT----PREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCG--ISNEMNSFTVDTREAGYGGLS-------LSIEGPSKA-EIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMD 5810
            ++  N  +  +   V  P G +E    +  P ++   SF     PR  G H + V  +G HI  SPF ++V     GDA KV   G G++    ++ +   F + T   G G          L   G   A E+      D   + +Y P  PG +++++ YA   V  SPF+V I GE       +   +   +   +VG      +        ++   + N  G  E     ++ +G +  ++ P  +G H + +     HIP SPF+  V    + G  KV A G GL+ G      +F +       G L  +IEGPS+A I  +DR DGSC V+Y  TEPG+Y   +  +++ +  SPF   +     D
Sbjct:  182 VETENAGLGEVLVFVEDPEGHKEEA--RVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPH-GDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNI-GEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGE-EPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVS--AEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRD 549          

HSP 20 Score: 116.316 bits (290), Expect = 6.655e-26
Identity = 117/421 (27.79%), Postives = 175/421 (41.57%), Query Frame = 3
Query: 1713 SPFKINVLPTKTSHIAAFGPGLTT--GVVGKAAIFVTDT-NGELGSLGFSIEGPS----EAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTC-----SGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKV--FVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPG---CDPSKV 2918
            +P +  + P K +H  AFGPG+      V +AA FV +T N  LG +   +E P     EA++   +++  S    Y P   G + V +L  G+ I  SP+   + P +   D  K+   GPGV+  G        F I      +         T        + + + +    +   RC Y+PL  G H V V     +VP SPF V + +  NP   R  G GL S        A F + T  AG G L V + +  G   P     +    + +  Y+P   GP +  +I + G +IP SPF + +  E    KV  +   L+T +   S   FVV A   D    GT+      PS  +        GDGS    Y P + G Y + V  ++  +  SPF   ++P    C P +V
Sbjct:  149 APLRPKLNP-KNAH--AFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPH--GDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGE-EPMR-HREVGEGVHEFEYKPLALGP-HVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRS-ADFVVEAIGTDV---GTLGFSIEGPSQARIA--CDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERV 555          

HSP 21 Score: 108.227 bits (269), Expect = 2.307e-23
Identity = 103/352 (29.26%), Postives = 157/352 (44.60%), Query Frame = 3
Query: 5421 FIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLK-LGHTSG-PNEFSIYTREAGAGGLS-------IAIEGPSKA-EIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLK 6443
            + P+  G H V V     HI  SPF   V P   G A KV A G G++  G+ +G    F I T   GAG          +   G   A E+  E R+D      Y    PG +I S+ +    + +SPF + + E        AS G    ++   +G  A F V   Q  +    G+L   +  P R EEP   + + +  +   + P   G H+I +T     KHIP SPF V++  + A P  V A G GL +G  G+   F+V  + +  G L  +I+GPS+ ++   +  +G  +  Y+P+ PG+Y + V       +A SPF A+I  +  D     V  + + K
Sbjct:  222 YRPRVAGPHKVTVLFAGQHIDRSPFPVLVAP-PHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRAS-GRGLQSRGVRVGDAAGFRVLTKQAGS----GELNVLLRNP-RGEEPMRHREVGEGVHEFEYKPLALGPHVITIT--WGGKHIPRSPFEVLVSAE-AGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHV-LCDEEDVALSPFMAHILPASRDCFPERVRHRPSAK 562          

HSP 22 Score: 103.99 bits (258), Expect = 3.692e-22
Identity = 90/311 (28.94%), Postives = 140/311 (45.02%), Query Frame = 3
Query:  864 NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITD-NAGKLIDVKIEEIPDKKN-CYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTTG 1787
            +KVRV GPGI +  + A + A FTV    AG+  LD+   D   G  + +   EI D  +  Y   YTP  +G   + V Y    +P SPF VT+     D  K++V+G G +    +       +++    G G++   +LSP+  K   +         +        ETG H +++      +  SPF +     +N   V V G G++  G  VG  AEF +DT  AG G L + +  P   E  ++  +         Y+P + G Y + I + +  V  SPF   V P+ +TS +  FGPG+  G
Sbjct:  742 SKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPL-DLGKIRVEGLGTKLE--MGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCS-SEPLAEAAAPAAAAALLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGLR--GGEVGIPAEFCVDTTAAGVGGLGLTVEGP--CEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKG 1044          

HSP 23 Score: 103.99 bits (258), Expect = 3.916e-22
Identity = 101/386 (26.17%), Postives = 169/386 (43.78%), Query Frame = 3
Query:  945 FSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPR-SPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSN-GIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK---TSHIAAFGPGLTTGVVGKAAIFVTDTN-GELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVAL 2084
            FS  +G++   +   +G+    +I  I ++      ++ P  KG + + ++Y    IP  SP +  +D+  G PS V   GPG+     +V     F I T+DAG G +S  V  PS  K +I+ +  ++   S  V Y     G +SI +  +   I  SP+   +    ++   ++  RG   +  +R+ D      DT  A    L   + +P   ++   +  ++       + P + G + + +      V  SPF++ V  ++      + A G GL      +AA F+ DT     GS+  S+EGPS  ++ C D +DG   + Y P  PG Y + I    E IP SP+               + V GPG QKE V+L
Sbjct: 1684 FSLRKGHITGEVHMPSGRKASPRI--IDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDG-PS-VTAYGPGLSHG--MVGKHAAFTIDTKDAGEGGLSLAVEGPS--KAEISCQDNKDGTCS--VSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASLLSRGSTHDVSLRIPD------DTDPA---LLTADIAAPSGRQDVCLLKRLDDGQIGISFSPKEVGEHLVSVREGGRHVPSSPFRVAVGASEVGDARRVRASGLGLEEARTCEAAEFIVDTRYAGFGSMCVSMEGPSRVELHCEDLEDGRCRVWYCPPEPGTYHLAIKFAEEQIPGSPFT--------------VLVSGPGRQKEEVSL 2036          

HSP 24 Score: 102.064 bits (253), Expect = 1.704e-21
Identity = 105/418 (25.12%), Postives = 167/418 (39.95%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXX--XXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFR-LPISLGAQNVEAIVSTPSGIRESALVH-DNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFF-AENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII 4673
            L PGAP    + PK  P      G GV   G  +  +   +F ++   AG G++ + +               ++ +  F   Y P  AG H +TV F    +   PF V V    GDA K      GV+    +  +       T           V +T         ++ + +E   +      Y P     ++V + + G ++P+  F     +  N           +S+     +             FR L    G+  +  ++  P G  E  + H +   G     Y+P   G H + +T  G  I  SP++   +  AG  KV A+GPGL  G  G  A+F +       G L  +IEGPS+A I C D  +GSCDV Y P  PGDY++ +   + ++  SPF+A+I+
Sbjct:  145 LKPGAP----LRPKLNPKNAHAFGPGVEAVGNSVERAA--EFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAG----------FRVLTKQAGSGELNVLLRNPRG--EEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHIL 544          

HSP 25 Score: 97.0561 bits (240), Expect = 5.660e-20
Identity = 96/357 (26.89%), Postives = 149/357 (41.74%), Query Frame = 3
Query: 1080 YTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGD-KDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSP---RSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNI-PVTRSPFKINV-----------------------------------LPTKT----SHIAAFGPGLTTGVVGKAAIFVTDTNGELGS--LGFSIEGPSEAKIECCDNQDGSA--TICYWPTAPGEYAVHILCDGEDIPNSPYMANI 2006
            Y ++VR+ ++ IP SPF +T+D    +  +V V   G+ ++G  V+    F +    A  G I   V +PSG  ++    +I ++  +     +   E GVH +++    A +  SPF V V      ++A LV+  G G++      G  AEF +DT  AG G L V +  P K    V  +E    Y  C Y+P+ PG+Y + I Y     +  SP++  V                                   LP KT    S + + GPGL+T +VGK   F  D  G  GS  L   + GPS    E      G     + Y     G Y + +    + +P SP+   +
Sbjct: 2272 YEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVS--GLLESGWKVNHPASFAVHLNGA-KGRIEAKVHTPSGSVENCFVSEIDKDKWSLLAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERG--TTGSPAEFVVDTSGAGPGSLAVAIDGPSKVR--VDCSEGPEGYHFC-YLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDC-GRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2619          

HSP 26 Score: 93.5893 bits (231), Expect = 6.308e-19
Identity = 94/362 (25.97%), Postives = 155/362 (42.82%), Query Frame = 3
Query: 1941 EYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCV---YQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNN---VRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVH--YQPNTSGPVYNCSIRYDGV-NIPGSPFTIQIK-PEI-------DISKVFVENLQTTIFQESF------IRFVVNAKAIDAKGKGTVKAIFTDPSSF-----KSGS-----------------MVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEV 2891
            +Y V +  + E IP SP++  +    E++     +V   G+ + G  +N P  F +     K  I  EA   T SG+     +S     K+  +   + P  +G H V V+CD  SVP SPF+V+V +P +  +   V   G GL   T  +PA F +DT+ AG G+LAV I+       P  +  D        H  Y P   G +Y  SI Y G  +I GSP+  ++  P +       + S   VE  +              ++   ++  +++ G G   A+    ++F     ++GS                  VK  G   ++ +Y+  + G+Y+L V + D  +  SPF + V
Sbjct: 2271 DYEVSVRFEDEHIPGSPFLLTVDGVCEESR----RVAVSGLLESGWKVNHPASFAVHLNGAKGRI--EAKVHTPSGSVENCFVSEIDKDKWSLLAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDG------PSKVRVDCSEGPEGYHFCYLPTAPG-LYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2619          

HSP 27 Score: 90.1225 bits (222), Expect = 6.303e-18
Identity = 91/361 (25.21%), Postives = 151/361 (41.83%), Query Frame = 3
Query: 2538 YNCSIRYDGVNIPGSPFTIQIKPEIDISK-VFVENLQTTIFQESF-IRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYS---CSYSPYDAGTYILDVTYEDLPIKNSPFNIEV-VPG--CDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGT--CTVEYSSTIPGTYDIYIKFNDV-DVNGSPFK--------------------------------------LPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNI 3473
            Y  S+R++  +IPGSPF + +    + S+ V V  L  + ++ +    F V+        KG ++A    PS       V       +S     + P + G + + VT +   +  SPF + V  PG   D + V  FG GLE G T  P  F +D  GAG G+L +AI+GPS  +++C++  +G   C   Y  T PG Y + I +     + GSP++                                      LP++   +++ V+  G  L+   + + +    FTVD  RAG   L        G   P E    ++     + +T+   E G + + +K  +  VPG+PF   +
Sbjct: 2272 YEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSGLLESGWKVNHPASFAVHLNG----AKGRIEAKVHTPSGSVENCFVSEIDKDKWSLLAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGYHFC---YLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQN---AFTVDCGRAGSNVLLVGV---LGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2619          

HSP 28 Score: 88.9669 bits (219), Expect = 1.424e-17
Identity = 92/391 (23.53%), Postives = 170/391 (43.48%), Query Frame = 3
Query: 4422 AYGPGLSHGRTGL--PAEFTIVTKDAGAGGLSLAIEGPS----KAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF---IANIIGEPQRRSQICIG--STSDVPLKINNLDISTLTA-----------SVRAPSGKEESC--ILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKC-GIS-NEMNSFTVDTREAGYGGLSLSIEGPSKAE-IECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGP 5513
            A+GPG+      +   AEF + T++AG G + + +E P     +A +  ++++  S    Y P + G + + + FA  +I  SPF   +A   G+  + +    G   + +V  K    DI T              +V  P G+ ++    L++  +  L  ++ P   G H ++V  +GA +  SPF + +G  E  +    R  G GL+  G+   +   F V T++AG G L++ +  P   E +  R+  +G  +  Y P   G ++I I +  +H+  SPF V ++ E      +K+       +    G   +  ++  GT    +  ++         C+  D  DG   ++++P E G + V V      +  SPF   + P
Sbjct:  162 AFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIG--EACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGP---QKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACD--DRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILP 545          

HSP 29 Score: 85.5001 bits (210), Expect = 1.521e-16
Identity = 102/435 (23.45%), Postives = 170/435 (39.08%), Query Frame = 3
Query: 2283 PKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNI--LPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKP-EIDISKVF-----VENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSG--SMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGP-SDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDA----------SRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE---PDKVK 3503
            P +P + K+    NP N    G G+ +   +    A F ++T NAG G + V + D  G+      T  ND       V Y+P  +GP +  ++ + G +I  SPF + + P   D  KV      VE       + ++           A        +  DP   +      ++   D    C+Y P   G +I+ V Y    + +SPF++ +   C+P      G GL+  G        F +    AG G L + +  P  +  +   +  +G    EY     G + I I +    +  SPF++ +        V+ +G  L  G   R      F V+A          S  G +  +  C D++G               G  D+ +VPTE G +A+ +      V  +PF+ +ILP S    P++V+
Sbjct:  147 PGAPLRPKL----NPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAV-YRPRVAGP-HKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVL-DPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSAD---FVVEAIGTDVGTLGFSIEGPSQARIAC-DDRGD--------------GSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVR 556          

HSP 30 Score: 79.337 bits (194), Expect = 1.103e-14
Identity = 109/442 (24.66%), Postives = 172/442 (38.91%), Query Frame = 3
Query: 2574 PGSPFTIQIKPEIDISKVF---VENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDG--SYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVP-GCDPSKVLVFGEGLE--GGFTNQPNFFTID-----------------LDGAGQGN-LGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTG--GFLTPSVPVQFHIDVSEAG---QGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIE 3806
            PG+P   ++ P+   +  F   VE +  ++  E    FVV     +  G G V     DP   K  + V    D   S+   Y P  AG + + V +    I  SPF + V P   D  KV   G G+E  G    +  +F I                  LD  G+ + + + +E   DA + CT          Y   +PG + + + +    V  SPF + I +  N    +  G  L    + RV     F V   +AG   L    ++ +G E    ++ RE    G+++  + P  LGPH I I      +P +PF   +  ++ P KV+  G G+  TG  G     V      DV   G   +G  Q  ++  D           G G    +Y PT+ G + + V  ++  V   PF+  ++    +  CF E
Sbjct:  147 PGAPLRPKLNPKN--AHAFGPGVEAVGNSV--ERAAEFVVET---ENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCT----------YRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGV-RVGDAAGFRVLTKQAGSGELNVLLRNPRGEE---PMRHRE-VGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLE-TGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDD----------RGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPA--SRDCFPE 553          

HSP 31 Score: 57.7658 bits (138), Expect = 4.473e-8
Identity = 52/225 (23.11%), Postives = 92/225 (40.89%), Query Frame = 3
Query: 1671 YELQINYDNIPVTRSPFKINV--LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECC----DNQDGSATIC--YWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDN-QSVPKSPFKVKVAQP 2318
            YE+ + +++  +  SPF + V  +  ++  +A  G   +   V   A F    NG  G +   +  PS   +E C     ++D  + +   + P   G + V + CDG  +P SP+   +       D + +  +GPG+++      SP EF +D     S   P +      G     V  S G + Y   Y P   G + V +       +  SP++ +V  P
Sbjct: 2272 YEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSGLLESGWKVNHPASFAVHLNGAKGRIEAKVHTPS-GSVENCFVSEIDKDKWSLLAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERG--TTGSPAEFVVD----TSGAGPGSLAVAIDGPSKVRVDCSEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGP 2489          
BLAST of Filamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004210.1 (pep scaffold:Pmarinus_7.0:GL476636:147693:235244:1 gene:ENSPMAG00000003806.1 transcript:ENSPMAT00000004210.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 553.518 bits (1425), Expect = 1.432e-161
Identity = 461/1594 (28.92%), Postives = 720/1594 (45.17%), Query Frame = 3
Query: 1350 VEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKI--AEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKINVLP---TKTSHIAAFGPGLTTGVVGKAAIFVTDTNGELGSLGFSIEGPSEAKIECCDNQDGSA---TICYWPTAPGEYAVHILCDGEDIPNSPY-MANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSD---IKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNC----SIRYDGVNI-PGSPFTIQIKPEIDISKVFVENLQTT-----IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVN-GSPFKLPIRDPINTANVKCFGEPL-------TPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFI--------------EDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVE-IENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQF-----------KEKTXXXXXXXXXXXXXXKTKSQFA-----SFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQI-QGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIG--EPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGIS-NEMNSFTVDTREAGYGGLSLSIEGPSKAEIEC---RDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQ-QEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDG--HYSIKFIPKEMGLHTVVVQHRN-MHIPGSPFQFTV-GPIVDGG-----------------------------------AHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKA--EIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMV 5792
            V+YT    G  +I +F S  ++++SPFG+ V P  +A  V V G GI + G+     A F + T+ AG  +L+V+   P +   +V I  +EI  N+   +   Y P + G   L + Y    V  SPF + V P        +   G  L  G   +  + VT   G  G L   +  P+  K+ C     G A   ++ +     G + + +  DG  +P SP+ M  ++P+N     SK++V+G G++   V +  P EF +D          +  E  C      E  +     G+      Y P+  G + V +   +  VP SPF   V      + V+V G G+   T + P       + +   +L           L +               QP +  P   C    S+    V + P  P  ++ +P +  S  F ++ + T       +++   F V+A+ I   G   V+     PS   +   V  N DG+Y+  Y P  AG + ++VTY    +  SPF + V  GCDPS+V V G GLEGG T++ N F+ID   AG G LGL +EGP +A +   ++ +G  TVEY +  PG Y  +I +    +  GSPF +P+RD +N A V+C G  L         G++ R   P  F+VD SRAG+A L    +   G   P+E+      + GI+ +T+ P+ +GP+++ +++A   VP +PF  ++L   +  +V+V G GV+ +G  +  S+P  F ID  EAG   + +++ +PD       ++D G G+F   Y P  AG++ + V +    V   PF V     GDA+KCF+              + G    I +   T++ +N  EAG GK++CR++           L L V+ +EN  +GT SI ++  +   Y++ ++FGG  IPN  F           + +           +    + SQ       S        T  + P    +P SL   ++   V  PSG + S  + DN +G++++ + P E+G+HEM++  +G  I  GSP +F+ +      V AYGPGLSHG  G  A FTI TKDAG GGLSLA+EGPSKAEI C+DN++G+C V+Y P  PGDYSI +KFA  +IPGSP++A II   +  R S +  GST DV L+I  L    L                    +    + + P E G++ ++V     HI GSPF + V      ++ +V V G  L+ G   N   SF V    A  G +   +  PS +   C     + D      + P E G + +++      V GSPF V++ GEP       ++       +    GS  E  +   G     +   +    G ++V   +D  +G   Y   ++P   GL+ V + +    HI GSP++  V GP + GG                                   + KV + G GL        N F++    AG+  L + + GPS    E+  +        V Y V E G Y+  +K+ D H+  SPFR+ V
Sbjct:  713 VKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHDASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDP-RVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMGCEQEVRV-VTRGAGGRGQLEARLLSPTRQKVPCSSEPPGHAVEHSLLFTLLETGPHRMDVTYDGHPVPGSPFLMEAVLPANP----SKVRVWGEGLRGGEVGI--PAEFCVDTTAAGVGGLGLTVEGPC------EARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKGTTFLPPPLHSSCSLSDSHSLLELTEGRGETHLMYRRPKRNP-------IQPLS--PCVMCLKRMSVSIKAVRLTPVLPTKLRARPSLLSS--FHQSFKPTPPSHPALRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAV-RAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVV---QAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASG--VPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVLDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVL-------TPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLWARVAQLTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASLLSRGSTHDVSLRILELHCEDLE-------------------DGRCRVWYCPPEPGDYEVSVRFEDEHIPGSPFLLTV-DGVCEESRRVAVSGL-LESGWKVNHPASFAVHLNGA-KGRIEAKVHTPSGSVENCFVSEIDKDKWIAARFVPRENGVHPVSVTCDGASVPGSPFRVRV-GEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAID---GPSKV--RVDCSEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2240          

HSP 2 Score: 510.76 bits (1314), Expect = 1.687e-147
Identity = 453/1621 (27.95%), Postives = 717/1621 (44.23%), Query Frame = 3
Query: 2223 YQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHS--ATRYTPAYFSIDTTNAGHGNLAVEIND-EIGNILPFTLSNDTD-HDI-FDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQ--ESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDG-SYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITF----TVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILP---KSEPDKVKVIGEGVAPTGGFLTPSVPV------QFHID---VSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPIS-LGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYK---FFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAI---EG-PSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF-----------------------IANIIGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESC-ILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLS-----------------------------IEGPS--KAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHV-SGSP--FAVKITGEPSAK-----LMEKIICQQEAADI-TQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQY-AIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQ--QHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTS------MPTQS-SVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCEEVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDV 6767
            Y P   G   + V    Q V  SPF + V    + + VRV G G+++       PA+F++ T  AG   L V+  D  +G  +P   S   D HD  + V Y P   G V    + Y G ++PGSPF + + P +D+ K+ VE L T +    E  +R V       A G+G ++A    P+  K     +  G    +S  ++  + G + +DVTY+  P+  SPF +E V   +PSKV V+GEGL GG    P  F +D   AG G LGL +EGP +A++ C D+ DGTC+V Y     G Y + I F D  V GSPF   ++  + T+ V+ FG    PG    V++  TF       +    ++       + +G  + +  + + N +            L P  + +K  ++ +  A  L  +LP   ++ P  +    +   PT     PS P       +F +D   +S  G   ++ ++  P  +     + D   G +  +Y P+ AG H + V +  + V   PF V V    D ++  +     E  L +   + +I+T  AG G +   +      GE        V  E +  G  ++ Y      EYL  I +GG +I  G      +   +                S             P  F +  S  G   ++     P G RE   V    +G   + Y P   G + ++V   G  +  SP+      A +AG  +V+  G   S     LP +FTI T++AG   LS+ I   +G P +A ++  D  +G   V+Y P + G YS+ + +    +PGSPF                       +  +  +      I IG  + V +         +T  V  P   E    +++   +    I FT  + G + I V   G  I  SPF ++V  + +   ++     + L   ++      T  ++  G  GLSL+                             +  PS  KA     DN DGT  VS+ P E G + ++IKY   H+ +GSP  F V     PS       L   ++ +  A  I T+   +  L+L V G   +++             C+  D  DG  S+ ++P   G +++ V+    HIPGSP+             +++A  + L+    S  +   +  R                 E+  ED +DG C V Y   EPG+Y  S++F D+HI  SPF + V+    +   VA  G   L   W +  PA+F V+        + G++ A +  PS + E   +  I+K+++ A RF+P+E+G H ++VT +     +PGSPFRV +G+    AD  +V A G GL  G  G    F+V+T  +G G L V IDGPSKV++   E  EGY F Y+P+APG Y +++ YGG +HIAGSP+ A ++G    S    +H+ S+  V+        +      +P ++ S + KV+ HG G+  A + + N F VD  +AG+++L VG+ GP   CEEV VKH G  +F + Y V+E+G + L+VKWG++++PGSPF V V
Sbjct:  715 YTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHDASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVC-LGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLEMGCEQEVRVVTRG----AGGRGQLEARLLSPTRQKVPCSSEPPGHAVEHSLLFTLLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFG----PG----VEKGTTFLPPPLHSSCSLSDSHSLLELTEGRGETHLMYRRPKRNPI----------QPLSPCVMCLKRMSVSI-KAVRLTPVLPTKLRARPSLLSSFHQSFKPT----PPSHPALRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGLEGGLTHRANVFSIDTRAAGCGGLGLHV---EGPGEAH------VAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGS--PFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARVL--DGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARRTRPPTTPQTLWARVAQ----LTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPSKAEIS------------CQ--DNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMA-----------RIIAGEDSLRASLLSRGSTHDVSLR---------------ILELHCEDLEDGRCRVWYCPPEPGDYEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSG--LLESGWKVNHPASFAVHLNG-----AKGRIEAKVHTPSGSVENCFVSEIDKDKWIAARFVPRENGVHPVSVTCD--GASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGYHFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGP-RLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDCGRAGSNVLLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2240          

HSP 3 Score: 463.381 bits (1191), Expect = 2.448e-132
Identity = 240/558 (43.01%), Postives = 337/558 (60.39%), Query Frame = 3
Query:  390 DSSDIVDCRLKLILGLVWALILHYSISMPIWEGEDSKVHESKQTPKQRMMSWITGRMPEKHVKNLTTDWNDGTAIGALVDSCAPGLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIIST----EDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIK 2045
            DS  IVD  LKLILGLVW LILHYSISMP+WE E+      KQTPKQR++ WI  ++P+  + N + DW DG A+GALVDSCAPGLCPDW  W     + + +EAM  AE WL V Q+I PEE++DPNVDE ++MTYLSQFP AK+ PGAP+  KLNP     +GPG+E+      + AEF V+  +AG G + + + D  G   + ++    DK+  +   Y P   G + +TV +A + I RSPF V +    GD  KV  +GPG+E +G +   +TYF I T      AG G+++  VL P G +D +   + Q      R  Y     G H +++  + A + +SPF V +    N      SGRG+QS G+RVGD A F + T+ AG+G+LNV L +P + EE ++  E+     E  Y P   G + + I +    + RSPF++ V        + A+GPGL TG+ G++A FV +  G ++G+LGFSIEGPS+A+I C D  DGS  + Y PT PG+YAVH+LCD ED+  SP+MA+I+P++      +++
Sbjct:    1 DSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEEDD-EAKKQTPKQRLLGWIQHKLPDLPISNFSQDWKDGRALGALVDSCAPGLCPDWEIWDVHQPIDNAREAMQQAEDWLGVAQVIAPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNP-RGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVR 556          

HSP 4 Score: 434.876 bits (1117), Expect = 2.264e-123
Identity = 420/1653 (25.41%), Postives = 700/1653 (42.35%), Query Frame = 3
Query:  960 GNLDITITDNAGKLI----DVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSP--SGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNA-GNGKLNVKLLSPEKSEESVKIAEINPNY---FECLYIPSKPGMYELQINYDNIPVTRSPFKIN-VLPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNGE-LGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY---------------------KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCV-YQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDT---TNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPI-KNSPFNIEVVPGCDPSKVLVFGEGL----EGGF-----TNQPNFFTIDLDGAGQGNLGLAIEGPSDAK--INCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAP-------TGGFLTPSV----PVQFHIDVSEAGQGDIQ-XXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCR---------------IVPLT-ENGEVKSNLSLPV------EIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQ----FKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFRLPISLGAQNVEAIVSTPSGIRESALVHDNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANIIGEPQRRSQICIGSTSDVPLKIN---------NLDISTLTASVRAPSGKEESCILKKMPNDN-LGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQ-NEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYAN-EHVSGSPFAVKITG----------EPSAKLME-------------------------KIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDG---HYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTV 5507
            G++ + I   AG ++    DV  + I +  +     YTPPC G +TI V ++E+++  SPF + +   S D SKV+V+GPGI   GV  +   +F + T  AG  E+      P        ++ +I      SY V+YT  + G   + +      +  SPF V V+P  +   + V G G +   + +G + E  + T+ A G G+L  +LLSP +  + V  +   P +      L+   + G + + + YD  PV  SPF +  VLP   S +  +G GL  G VG  A F  DT    +G LG ++EGP EA++EC D+ DG+ ++ Y P   GEYAV+IL     +P SP+ A + PS E    S ++V+GPGV+K    L  P   +    +                      ++ I+P + C  C      +   S   K  R     P         +S  +QS   +P       PS+P            A R   + F++D    +  G  ++   +    G     +++++ D   + V Y P+++GP +   + Y G  +P SPF + +    D S+V V         E  +    N  +ID +  G            ++    + + +G ++  Y     G Y+  +TY    I   SPF + V    +P+KV   G GL     GG         P  F++D   AG   L +  +GP   +  +     +DG   + Y+ ++ G Y +++++   DV  SPF + +    +   V+  G  ++   +     P  FT+D   AG+APL     D  G  +P   +  +    G++ ++++P   G +++ + +    VPG+PF  +     +  K   +   V P       T G   P++    P    ++  EAG+G +    L+     L    + +   G F   +T T  G + I V F    + N PF V V     A +           L      +T  +   G+  +S                 +VP +   G +   + +P        I +N +GT S+ ++P E   + +DIK+ G  IP G     + ++   P+              + A+F  +T D   G                +   V  PS    S    DN +G+ ++ Y P   G + + V   G  I GSPY        + ++ A   G    R  L +  +  T D     +SL I      E+ C+D E+G C V Y P  PGDY + ++F D +IPGSPF+  + G  +   ++ +    +   K+N         N     + A V  PSG  E+C + ++  D  +   F PRE G H ++V   GA + GSPF++ VG+     DA+ V  FG GL+ G +     F VDT  AG G L+++I+GPSK  ++C +  +G     Y P+ PG Y+++I Y    H++GSP+  ++TG          E S+ L+E                         K+           VG Q   T+   G   S++   +  + G +  CE + +       +++ +  KE G + ++V+  + H+PGSPF+ TV
Sbjct:  679 GDVSVGIKCAAGAMVPVDSDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDV-VPSHDASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTK---LEMGCEQEVRVVTRGAGGRGQLEARLLSPTR--QKVPCSSEPPGHAVEHSLLFTLLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVE---TSGVQVFGPGVEKGTTFLPPPLHSSCSLSDSHSLLELTEGRGETHLMYRRPKRNPIQPLSPCVMC------LKRMSVSIKAVRLTPVLPTKLRARPSLLSSFHQSFKPTP-------PSHP------------ALRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHD-GTYAVEYVPSSAGP-HAVEVTYAGARVPRSPFRVAVADGCDPSRVRVHGPGL----EGGLTHRANVFSIDTRAAGCGGLGLHVEGPGEAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVP-ASLPTDFTIDTREAGDAPLSITIVDPDG--FPRRARVLDGGD-GLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKC-FLAVRVPPSPLPGVTTDGGPGPAIQIGEPTLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVRTSPLARR--TRPPTTPQTLWARVAQLTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKGLHEMDIKYNGHHIPTGSPLQFYVDEMDGPSVTAYGPGLSHGMVGKHAAFTIDTKDAGEG---------------GLSLAVEGPSKAEISC--QDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPY--------MARIIA---GEDSLRASLLSRGS--THD-----VSLRI-----LELHCEDLEDGRCRVWYCPPEPGDYEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSGLLESGWKVNHPASFAVHLNGAKGRIEAKVHTPSGSVENCFVSEIDKDKWIAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERGTTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGY-HFCYLPTAPGLYLVSICYGGPHHIAGSPYRARVTGPRLSGGHNLHETSSFLVEAGEPRRAMNGLGSEPLPLKTTSDSSKVESHGPGLSTALVGKQNAFTVDC-GRAGSNV--LLVGVLGPSVPCEEVHVKHAGGRRFAVTYAVKERGSYLLIVKWGDQHVPGSPFRVTV 2240          

HSP 5 Score: 186.422 bits (472), Expect = 3.507e-47
Identity = 248/1044 (23.75%), Postives = 406/1044 (38.89%), Query Frame = 3
Query:  822 KVNPGAPITSKLNPNKV----RVYGPGIESKDLIAGQTAEFTVDAFSAGR-GNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINI-FLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNG-------IRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLT-TGVVGKAAIFVTDTNGELGSLGFSI-----EG-PSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDV-SKIKVYG---PGVQKEG-----VALNSPNEFTIDCIEYKSDIKPEASCFTCSGNEIPV---VISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGN--------ILPFTLSN--------------------DTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIP-GSPFTIQIKPEIDISKVFVENLQTTIFQESFIRFVVNAKA---IDAK--GKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYD------ITFVPTELGPHAIEIKHANILVPGAPFLFNI-LPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFN 3731
            ++ P  P   +  P+ +    + + P   S   +    +EF VDA +  R G   +     A   I  +     +    Y   Y P   G + + V YA   +PRSPF+V +     DPS+V+V GPG+E  G +   +  F I T  AG G +   V  P     + +    ++    + VEY A   G +  +I +  +A    SPFGV V    N   V  SG G+  +        +R G    F +D   AG+  L+V    P  + E V++ +         Y PS  G Y L + Y    V  SPF ++VL       +   G G++ +GV        T    E G    SI     +G P  A++   D  DG  ++ Y P   G Y+V +    +++P SP+  +   + + +     ++V     PGV  +G     + +  P   T+  +  K   + + +C   +  ++ +   V+ +A +  +  V+     G + + V    Q +P SPF V V   ++P   R              A  +  +   G   L++ ++++I          ++PF+L                      D       V + P   G ++   I+Y+G +IP GSP    +  E+D   V       T +       +V   A   ID K  G+G +      PS  K+    + N DG+ S SY P   G Y + V +    I  SP+   ++ G D  +  +    L  G T+  +   ++L                    +C D  DG C V Y    PG Y++ ++F D  + GSPF L +      +        L  G   +V+ P +F V  + A +  ++A      G        S EN      D        FVP E G H + +      VPG+PF   +  P    D   V   G     G  T   P +F +D S AG G + +++  P  + +      EG   FC  Y PT  G + +++ + 
Sbjct: 1115 RLTPVLPTKLRARPSLLSSFHQSFKPTPPSHPALRDAVSEFAVDARTISRCGGDHVRCAVMAPSGITTEGSVTDNHDGTYAVEYVPSSAGPHAVEVTYAGARVPRSPFRVAVADGC-DPSRVRVHGPGLE--GGLTHRANVFSIDTRAAGCGGLGLHVEGPG----EAHVAFEEDPEGGFTVEYHAPSPGEYLFHITYGGTAITAGSPFGVPVRDEVNPAKVRCSGPGLGLSAGGGVVGAVRAGAPQMFSVDCSRAGDAALDVTAQGPHGTREPVEVVQAVDGIHAMTYTPSLVGPYSLHVQYAGQDVPHSPFGVDVLAAYDAGRVRVSGAGVSASGVPASLPTDFTIDTREAGDAPLSITIVDPDGFPRRARV--LDGGDGLFSVSYLPDVAGRYSVAVGYGTDEVPGSPFPVHAFATGDASKCFLAVRVPPSPLPGVTTDGGPGPAIQIGEP---TLVLVNAKEAGRGKVTCRVLTPEQLELDVDVVENAADGTFSIVFTATQPGPYVIAVRFGGQLIPNSPFHVLVR--TSPLARRTRPPTTPQTLWARVAQLTSTSQTCGDAGLSLAMSEDISTESLRPFHLVVPFSLRKGHITGEVHMPSGRKASPRIIDNRDGTMSVSFAPIEKG-LHEMDIKYNGHHIPTGSPLQFYVD-EMDGPSV-------TAYGPGLSHGMVGKHAAFTIDTKDAGEGGLSLAVEGPS--KAEISCQDNKDGTCSVSYLPTAPGDYSIAVKFAGQHIPGSPYMARIIAGEDSLRASL----LSRGSTHDVSLRILEL--------------------HCEDLEDGRCRVWYCPPEPGDYEVSVRFEDEHIPGSPFLLTVDGVCEESRRVAVSGLLESGW--KVNHPASFAVHLNGA-KGRIEAKVHTPSG--------SVENCFVSEIDKDKWIAARFVPRENGVHPVSVTCDGASVPGSPFRVRVGEPGHAADAALVSAFGPGLERG--TTGSPAEFVVDTSGAGPGSLAVAIDGPSKVRVDCSEGPEGYH-FC--YLPTAPGLYLVSICYG 2093          

HSP 6 Score: 140.969 bits (354), Expect = 2.306e-33
Identity = 112/346 (32.37%), Postives = 158/346 (45.66%), Query Frame = 3
Query: 4821 NDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKC-GI-SNEMNSFTVDTREAGYGGLSLSIEGPSKA------EIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAV---------KITGEPSAKLMEKIICQQEAADITQ-VGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGH---YSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVN 5795
            ND L + +TP   G   I V+ S   +  SPF I V  +   DASKVRV G G+   G+ + +   FTV TR AG   L +  E P         + E  DN+D +  V YTP + G   + + Y  +HV GSPF V         KI  E     +E + C+QE   +T+  G + +L  ++              L  T +         GH   +S+ F   E G H + V +    +PGSPF      ++     KV   G GL+ G    P EF + T  AG GGL + +EGP +A ++  D  DG+C V Y   + GEY  +I F D H+  SPF  +V 
Sbjct:  708 NDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSH--DASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPLDLGKIRVEGLGTKLE-MGCEQEVRVVTRGAGGRGQLEARL--------------LSPTRQKVPCSSEPPGHAVEHSLLFTLLETGPHRMDVTYDGHPVPGSPFLMEA--VLPANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVK 1034          

HSP 7 Score: 130.183 bits (326), Expect = 3.983e-30
Identity = 110/359 (30.64%), Postives = 153/359 (42.62%), Query Frame = 3
Query: 4212 GAQNVEAIVSTPSGIRESALVHDNNNG--SVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAE--NAGLGKVAAYGPGL--SHGRTGLPAEFTIVTKDAGAGGLS-------LAIEGPSKA-EIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANI-----------IGEPQRRSQICIGSTSDVPLKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCGISNEMNSFTVDTREAGYGGLSLSIEGPSKAEIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKI 5213
            G   V   V  P G +E A V   N+   S    Y PR  G H++ V   G  I  SP+       +   GKV A GPG+  S    G    F I T   GAG          L   G   A E+  +   +     TY PL+PG + + + +A   +P SPF  NI            G   +   + +G  +   +         L   +R P G EE    +++        + P  +G H I +   G HI  SPF+++V   E G   KVR +G GL+ G++     F V+      G L  SIEGPS+A I C D  DG+C V Y P+EPG Y +++    E V+ SPF   I
Sbjct:  188 GLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRG-EEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLV-SAEAG-PQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHI 543          

HSP 8 Score: 123.25 bits (308), Expect = 6.354e-28
Identity = 124/454 (27.31%), Postives = 186/454 (40.97%), Query Frame = 3
Query: 1980 PNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTID--------CIEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQP-SNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVE----INDEIG--NILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEID--ISKVFVENLQTT-IFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGE---------PLTPGSINRVDQPI 3254
            P +P    + P N          +GPGV+  G ++    EF ++         + +  D  PE         E  V   +   + +  VY+P   G HKV V    Q + +SPF V VA P  +   V   G G+  +        YF I T   G G    +    + D  G  + +  TL    D  +    Y+P   GP +  S+ Y G  +P SPF++ I    +    +     LQ+  +       F V  K     G G +  +  +P   +     +  G+G +   Y P   G +++ +T+    I  SPF + V     P KV  +G GLE G   +   F ++  G   G LG +IEGPS A+I C D  DG+C V Y  T PG Y +++  ++ DV  SPF   I      A+  CF E         P  PG + R  QP+
Sbjct:  147 PGAPLRPKLNPKNAHA-------FGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVED--PEGH-----KEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRD-AVLRCTYRPLVPGP-HIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQ---AGSGELNVLLRNPRG-EEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHIL----PASRDCFPERVRHRPSAKPPLPG-LPRAPQPL 575          

HSP 9 Score: 117.087 bits (292), Expect = 3.661e-26
Identity = 101/375 (26.93%), Postives = 161/375 (42.93%), Query Frame = 3
Query: 4728 LKINNLDISTLTASVRAPSGKEESCILKKMPNDNLGISFT----PREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKCG--ISNEMNSFTVDTREAGYGGLS-------LSIEGPSKA-EIECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLGHTSGPNEFSIYTREAGAGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMD 5810
            ++  N  +  +   V  P G +E    +  P ++   SF     PR  G H + V  +G HI  SPF ++V     GDA KV   G G++    ++ +   F + T   G G          L   G   A E+      D   + +Y P  PG +++++ YA   V  SPF+V I GE       +   +   +   +VG      +        ++   + N  G  E     ++ +G +  ++ P  +G H + +     HIP SPF+  V    + G  KV A G GL+ G      +F +       G L  +IEGPS+A I  +DR DGSC V+Y  TEPG+Y   +  +++ +  SPF   +     D
Sbjct:  182 VETENAGLGEVLVFVEDPEGHKEEA--RVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPH-GDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNI-GEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGE-EPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVS--AEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRD 549          

HSP 10 Score: 116.701 bits (291), Expect = 6.064e-26
Identity = 117/421 (27.79%), Postives = 175/421 (41.57%), Query Frame = 3
Query: 1713 SPFKINVLPTKTSHIAAFGPGLTT--GVVGKAAIFVTDT-NGELGSLGFSIEGPS----EAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTC-----SGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYT--PAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKV--FVENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPG---CDPSKV 2918
            +P +  + P K +H  AFGPG+      V +AA FV +T N  LG +   +E P     EA++   +++  S    Y P   G + V +L  G+ I  SP+   + P +   D  K+   GPGV+  G        F I      +         T        + + + +    +   RC Y+PL  G H V V     +VP SPF V + +  NP   R  G GL S        A F + T  AG G L V + +  G   P     +    + +  Y+P   GP +  +I + G +IP SPF + +  E    KV  +   L+T +   S   FVV A   D    GT+      PS  +        GDGS    Y P + G Y + V  ++  +  SPF   ++P    C P +V
Sbjct:  149 APLRPKLNP-KNAH--AFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPH--GDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGE-EPMR-HREVGEGVHEFEYKPLALGP-HVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRS-ADFVVEAIGTDV---GTLGFSIEGPSQARIA--CDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERV 555          

HSP 11 Score: 114.775 bits (286), Expect = 1.871e-25
Identity = 100/352 (28.41%), Postives = 161/352 (45.74%), Query Frame = 3
Query: 5382 EIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLKLG--HTSGPNEFSIYTREAGAGGLSIAIEGPSKAE----IDFE--DRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNI-EKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGYEFI-YIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDS 6407
            +II  D+   ++K+ P   G  T++V      +  SPF   V P  D  A KV   G G+       + P  F++YTR AG   L +  E P        +D E  D  D S  VKY   + G     + +  DH+  SPF + V       + +  +    L  +  +G      V    T      G+L A ++ P+R + P   +      ++++ F   E+G H ++VT +     +PGSPF ++     A+P  V   G+GL  G VG    F V+T  +G G L +T++GP + +L   ++ +G   + Y+P   GEY + + +  + H+ GSPFTA +  SV  S
Sbjct:  702 DIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHD--ASKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPP----LDLGKIRVEGLGTKLEMGCEQEVRV---VTRGAGGRGQLEARLLSPTRQKVPCSSEPPGHAVEHSLLFTLLETGPHRMDVTYD--GHPVPGSPF-LMEAVLPANPSKVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGPCEARLECHDHGDGTCSVSYLPVQAGEYAVNILF-ADAHVPGSPFTAVVKPSVETS 1040          

HSP 12 Score: 112.079 bits (279), Expect = 1.545e-24
Identity = 94/315 (29.84%), Postives = 145/315 (46.03%), Query Frame = 3
Query:  864 NKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITD-NAGKLIDVKIEEIPDKKN-CYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVE----YTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPT-KTSHIAAFGPGLTTG 1787
            +KVRV GPGI +  + A + A FTV    AG+  LD+   D   G  + +   EI D  +  Y   YTP  +G   + V Y    +P SPF VT+     D  K++V+G G +    +       +++    G G++   +LSP+  K   +       P  + VE    +T  ETG H +++      +  SPF +     +N   V V G G++  G  VG  AEF +DT  AG G L + +  P   E  ++  +         Y+P + G Y + I + +  V  SPF   V P+ +TS +  FGPG+  G
Sbjct:  750 SKVRVEGPGINATGVEAAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVTYGGDHVPGSPFPVTVAPPL-DLGKIRVEGLGTKLE--MGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCS-----SEPPGHAVEHSLLFTLLETGPHRMDVTYDGHPVPGSPFLMEAVLPANPSKVRVWGEGLR--GGEVGIPAEFCVDTTAAGVGGLGLTVEGP--CEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETSGVQVFGPGVEKG 1052          

HSP 13 Score: 107.457 bits (267), Expect = 3.677e-23
Identity = 103/352 (29.26%), Postives = 157/352 (44.60%), Query Frame = 3
Query: 5421 FIPKEMGLHTVVVQHRNMHIPGSPFQFTVGPIVDGGAHKVVASGNGLK-LGHTSG-PNEFSIYTREAGAGGLS-------IAIEGPSKA-EIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRIMVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEGY-EFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLK 6443
            + P+  G H V V     HI  SPF   V P   G A KV A G G++  G+ +G    F I T   GAG          +   G   A E+  E R+D      Y    PG +I S+ +    + +SPF + + E        AS G    ++   +G  A F V   Q  +    G+L   +  P R EEP   + + +  +   + P   G H+I +T     KHIP SPF V++  + A P  V A G GL +G  G+   F+V  + +  G L  +I+GPS+ ++   +  +G  +  Y+P+ PG+Y + V       +A SPF A+I  +  D     V  + + K
Sbjct:  222 YRPRVAGPHKVTVLFAGQHIDRSPFPVLVAP-PHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRAS-GRGLQSRGVRVGDAAGFRVLTKQAGS----GELNVLLRNP-RGEEPMRHREVGEGVHEFEYKPLALGPHVITIT--WGGKHIPRSPFEVLVSAE-AGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHV-LCDEEDVALSPFMAHILPASRDCFPERVRHRPSAK 562          

HSP 14 Score: 101.679 bits (252), Expect = 1.995e-21
Identity = 105/418 (25.12%), Postives = 167/418 (39.95%), Query Frame = 3
Query: 3441 LVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHIDVSEAGQGDIQXXXX--XXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQV-GDANKCFIED-GVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGGVSIPNGQFKEKTXXXXXXXXXXXXXXKTKSQFASFRNETTDYTNGMYPVEFR-LPISLGAQNVEAIVSTPSGIRESALVH-DNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFF-AENAGLGKVAAYGPGLSHGRTGLPAEFTIVTKDAGAGGLSLAIEGPSKAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPFIANII 4673
            L PGAP    + PK  P      G GV   G  +  +   +F ++   AG G++ + +               ++ +  F   Y P  AG H +TV F    +   PF V V    GDA K      GV+    +  +       T           V +T         ++ + +E   +      Y P     ++V + + G ++P+  F     +  N           +S+     +             FR L    G+  +  ++  P G  E  + H +   G     Y+P   G H + +T  G  I  SP++   +  AG  KV A+GPGL  G  G  A+F +       G L  +IEGPS+A I C D  +GSCDV Y P  PGDY++ +   + ++  SPF+A+I+
Sbjct:  145 LKPGAP----LRPKLNPKNAHAFGPGVEAVGNSVERAA--EFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAG----------FRVLTKQAGSGELNVLLRNPRG--EEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDDRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHIL 544          

HSP 15 Score: 89.3521 bits (220), Expect = 1.208e-17
Identity = 92/391 (23.53%), Postives = 170/391 (43.48%), Query Frame = 3
Query: 4422 AYGPGLSHGRTGL--PAEFTIVTKDAGAGGLSLAIEGPS----KAEIVCKDNENGSCDVTYYPLIPGDYSIIIKFADHNIPGSPF---IANIIGEPQRRSQICIG--STSDVPLKINNLDISTLTA-----------SVRAPSGKEESC--ILKKMPNDNLGISFTPREVGNHFINVYQSGAHILGSPFKIVVGQNEIGDASKVRVFGEGLKC-GIS-NEMNSFTVDTREAGYGGLSLSIEGPSKAE-IECRDNYDGTCQVSYTPSEPGTYMINIKYANEHVSGSPFAVKITGEPSAKLMEKIICQQEAADITQVGSQCELTLKVPGTHHSDMRATVTNLYGTTEVCEIIDLDDGHYSIKFIPKEMGLHTVVVQHRNMHIPGSPFQFTVGP 5513
            A+GPG+      +   AEF + T++AG G + + +E P     +A +  ++++  S    Y P + G + + + FA  +I  SPF   +A   G+  + +    G   + +V  K    DI T              +V  P G+ ++    L++  +  L  ++ P   G H ++V  +GA +  SPF + +G  E  +    R  G GL+  G+   +   F V T++AG G L++ +  P   E +  R+  +G  +  Y P   G ++I I +  +H+  SPF V ++ E      +K+       +    G   +  ++  GT    +  ++         C+  D  DG   ++++P E G + V V      +  SPF   + P
Sbjct:  162 AFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIG--EACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGP---QKVRAWGPGLETGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACD--DRGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILP 545          

HSP 16 Score: 84.7297 bits (208), Expect = 2.848e-16
Identity = 101/435 (23.22%), Postives = 167/435 (38.39%), Query Frame = 3
Query: 2283 PKSPFKVKVAQPSNPNNVRVIGEGLHSA--TRYTPAYFSIDTTNAGHGNLAVEINDEIGNI--LPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKP-EIDISKVF-----VENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSG--SMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGLAIEGP-SDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDA----------SRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSE---PDKVK 3503
            P +P + K+    NP N    G G+ +   +    A F ++T NAG G + V + D  G+      T  ND       V Y+P  +GP +  ++ + G +I  SPF + + P   D  KV      VE       + ++           A        +  DP   +      ++   D    C+Y P   G +I+ V Y    + +SPF++ +   C+P      G GL+  G        F +    AG G L + +  P  +  +   +  +G    EY     G + I I +    +  SPF++ +        V+ +G  L  G   R      F V+A          S  G +  +  C D                  G  D+ +VPTE G +A+ +      V  +PF+ +ILP S    P++V+
Sbjct:  147 PGAPLRPKL----NPKNAHAFGPGVEAVGNSVERAAEFVVETENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAV-YRPRVAGP-HKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVL-DPRGRRDAVEMTLEQRRDAVLRCTYRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGVRVGDAAGFRVLTKQAGSGELNVLLRNPRGEEPMRHREVGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLETGMAGRSAD---FVVEAIGTDVGTLGFSIEGPSQARIACDDRGD---------------GSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPASRDCFPERVR 556          

HSP 17 Score: 78.9518 bits (193), Expect = 1.543e-14
Identity = 109/442 (24.66%), Postives = 172/442 (38.91%), Query Frame = 3
Query: 2574 PGSPFTIQIKPEIDISKVF---VENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDG--SYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVP-GCDPSKVLVFGEGLE--GGFTNQPNFFTI-----------------DLDGAGQGN-LGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTG--GFLTPSVPVQFHIDVSEAG---QGDIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIE 3806
            PG+P   ++ P+   +  F   VE +  ++  E    FVV     +  G G V     DP   K  + V    D   S+   Y P  AG + + V +    I  SPF + V P   D  KV   G G+E  G    +  +F I                  LD  G+ + + + +E   DA + CT          Y   +PG + + + +    V  SPF + I +  N    +  G  L    + RV     F V   +AG   L    ++ +G E    ++ RE    G+++  + P  LGPH I I      +P +PF   +  ++ P KV+  G G+  TG  G     V      DV   G   +G  Q  ++  D           G G    +Y PT+ G + + V  ++  V   PF+  ++    +  CF E
Sbjct:  147 PGAPLRPKLNPKN--AHAFGPGVEAVGNSV--ERAAEFVVET---ENAGLGEVLVFVEDPEGHKEEARVTPRNDKQRSFVAVYRPRVAGPHKVTVLFAGQHIDRSPFPVLVAPPHGDAGKVTARGPGVEPSGNVAGKATYFDICTAGDGAGAGVGDVAVTVLDPRGRRDAVEMTLEQRRDAVLRCT----------YRPLVPGPHIVSVGYAGAAVPHSPFSVNIGEACNPGACRASGRGLQSRGV-RVGDAAGFRVLTKQAGSGELNVLLRNPRGEE---PMRHRE-VGEGVHEFEYKPLALGPHVITITWGGKHIPRSPFEVLVSAEAGPQKVRAWGPGLE-TGMAGRSADFVVEAIGTDVGTLGFSIEGPSQARIACDD----------RGDGSCDVRYVPTEPGDYAVHVLCDEEDVALSPFMAHILPA--SRDCFPE 553          

HSP 18 Score: 66.2402 bits (160), Expect = 1.168e-10
Identity = 87/396 (21.97%), Postives = 151/396 (38.13%), Query Frame = 3
Query: 5619 AGGLSIAIEGPSKAEIDFEDRKDGSCGVKYFVTEPGEYICSIKFNDDHIINSPFRI-MVNEKQMDFISVASVGDNALAKEWTIGKPAAFTVNYPQTTTIRSDGKLRATIVGPSRTEEPAIIQNIEKNQYAIRFIPKESGEHLINVTDEITNKHIPGSPFRVVIGQQHADPGMVHAKGDGLMSGFVGKKNHFIVNTLNSGTGPLNVTIDGPSKVQLYSQENEEG----YEFIYIPSAPGEYQITVKYGGNYHIAGSPFTANISGSVNDSSEIYVHQQSNLKVDTVGKSMVTSMPTQSSVAQKVQCHGLGIKKATLNQVNTFNVDASQAGNDILFVGIAGPKSQCE-EVSVKHMGRNQFIINYLVQEKGRHYLMVKWGEKNIPGSPFIVDVL*NMSTT 6788
            A G  + ++  S    D     + +  VKY     G +   + F++  + +SPF I +V       + V   G NA   E    KPA FTV          D +     VG +     + I +     Y +++ P + G   + VT      H+PGSPF V +     D G +  +G G       ++   +V     G G L   +  P++ ++       G    +  ++     G +++ V Y G + + GSPF                              M   +P   S   KV+  G G++   +     F VD + AG   L + + GP   CE  +     G     ++YL  + G + + + + + ++PGSPF   V  ++ T+
Sbjct:  688 AAGAMVPVD--SDVHFDIIKNDNDTLTVKYTPPCAGRFTIMVFFSEQEVRDSPFGIDVVPSHDASKVRVEGPGINATGVE--AAKPAHFTVYTRGAGKAELDVQFEDPRVGAAVPILDSEIIDNHDYSYTVKYTPGQQGGVCLGVT--YGGDHVPGSPFPVTVAPP-LDLGKIRVEGLGTKLEMGCEQEVRVVTRGAGGRGQLEARLLSPTRQKVPCSSEPPGHAVEHSLLFTLLETGPHRMDVTYDG-HPVPGSPFL-----------------------------MEAVLPANPS---KVRVWGEGLRGGEVGIPAEFCVDTTAAGVGGLGLTVEGP---CEARLECHDHGDGTCSVSYLPVQAGEYAVNILFADAHVPGSPFTAVVKPSVETS 1040          
BLAST of Filamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001908.1 (pep scaffold:Pmarinus_7.0:GL483086:279:38879:-1 gene:ENSPMAG00000001731.1 transcript:ENSPMAT00000001908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 485.337 bits (1248), Expect = 5.293e-148
Identity = 308/925 (33.30%), Postives = 465/925 (50.27%), Query Frame = 3
Query:  642 GLCPDWAEWKPVDALIHTKEAMDTAEQWLNVPQLIKPEEMIDPNVDEKAMMTYLSQFPNAKVNPGAPITSKLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVSTSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEF--FIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINV-LPTKTSHIAAFGPGLTTGVVGKAAIFVTDTNG-ELGSLGFSIEGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEK------TDVSKIKVYGPGVQKEGVALNSPNEFTIDC-IEYKSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNN-VRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFV--ENLQTTIFQESFIRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLE--GGFTNQPNFFTIDLDGAGQGNLGL----AIEGPSDAKINCTDNL--DGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAG--------EAPLKA--CCKDNQ 3320
            GLCPDW  W     + + +EAM  A+ WL VPQ+I PEE++DPNVDE ++MTYL+QFP AK+ PGAP+  KLNP K R +GPG+E+   +  + A FTV+  SAG+G + + + D AG   + K+  + DK   Y   YTP   G + +TV +A + I +SPF+V++ K   D SKV  +GPG+E NGVI    TYF I T  AG G++   +  P G  D ++ ++     + +R  Y A   G HS+ +      I  SPF V V+      L  V   G + + ++  +  +    I  +  G+G +   ++S  K +E  ++  + P    C Y+PS  G + + + +    + RSPF++ V  P     + A+GPGL +G+V   A FV +  G ++G+LGFSIEGPS+A+IEC D  DGS  + YWP   G+YAVH++CD +DI +SP+MA I+ +  +         +K+KV+GPG++   V +  P EFT+D     ++  K  A      G  I V +   G+  + C Y P     H    +    SVP SP +V++    +P   VRV G GL S     PA FS+DT  AG G L + +    G         D       V Y P  +G  +  ++ + G ++PGSPF   I P  D S+V      L+ +   E     V  +KA    G G +       S  ++    +   DG ++ +++P   G + + +TY   P+ + P  + V P  D S + V G G+E  G F      FT+D    G+   G      + GPS A ++       DGT  VEY+    G + + + F D  V  SPF++ + +  + + V+  G  L  G  N   QP  FTV+   AG        E P +A   C DN+
Sbjct:    1 GLCPDWETWDARPPVDNAREAMQQADDWLGVPQVIAPEEIVDPNVDEHSVMTYLAQFPKAKLKPGAPLRPKLNPKKARAFGPGVEAMGNMVMKPAAFTVETISAGQGEVLVFVEDPAGHKEEAKVSPVKDKNQTYSVVYTPKVVGPHKVTVLFAGQHINKSPFEVSVAKPQADASKVTARGPGLELNGVIAGKPTYFDIHTAGAGMGDVHVTITDPRGRSDTVDVELEDRGESVFRCAYRAVLEGAHSVAVSYGGTAIPRSPFPVNVAQACRVHLCHVCSNGQRESDLQKPEMVDIRPVIYEKERGDGSVKTFIIS--KGKERNQVKPLGPTR-SCEYMPSVQGKHVVSVTWAGQHIPRSPFEVEVGPPAGEQKVRAWGPGLRSGLVDHPAHFVVEAIGDDIGTLGFSIEGPSQARIECQDCGDGSCDVVYWPGEAGDYAVHVVCDDQDIKHSPFMAEIVETGVRGLFVPNALTTKVKVFGPGLESGKVVVGKPIEFTVDARAGGRAPFKVYAQ--DAEGTPIDVQVKDNGDGTFLCRYTPRKAIKHTFLTTWGGVSVPGSPHRVQLXAGRHPQRGVRVSGPGLQSGEVGRPAQFSVDTRGAGDGGLGLTVE---GPREARIECEDNGDGTCSVAYTPAEAGE-HLVNVLFAGQHVPGSPFRALIHPTFDPSRVLATGRGLEKSKMGEPATFNVDCSKA----GDGDLAVDVVSDSGKRADVKTRRGPDGLHAVTFTPVTHGPHTVSLTYGGKPVPHFPAKVAVDPAVDTSGIKVSGPGVEERGVFCEAITGFTVDARALGRAGNGARVVTRVTGPSGAMMDAPVKAKGDGTYAVEYTPCEIGVHTVDVLFEDTPVPRSPFRIAVDEGCDPSRVRVHGPGLKSGITN---QPNRFTVETRGAGTGGLGLQIEGPTEAIISCTDNK 909          

HSP 2 Score: 319.316 bits (817), Expect = 2.021e-91
Identity = 231/789 (29.28%), Postives = 359/789 (45.50%), Query Frame = 3
Query:  852 KLNPNKVRVYGPGIESKDLIAGQTAEFTVDAFSAGRGNLDITITDNAGKLIDVKIEEIPDKKNCYKCTYTPPCKGTYTITVRYAEKDIPRSPFKVTIDKTSGDPSKVKVKGPGIEQNGVIVS-------TSTYFIISTEDAGTGEISCVVLSPSGDKDKINPKITQESPTSYRVEYTAEETGVHSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINPNYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTK----------TSHIAAFGPGLTTG--VVGKAAIFVTDTNGELGSLGFSI-----EGPSEAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEYKSDIKPEASCFTCSG-NEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVEN---LQTTIFQESFIRFVVNAKAIDAKGKGT-VKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSKVLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFN 3131
            + + +KV   GPG+E   +IAG+   F +    AG G++ +TITD  G+   V +E     ++ ++C Y    +G +++ V Y    IPRSPF V + +        +V    +  NG   S            +I  ++ G G +   ++S   +++++ P     S      EY     G H +++  +   I  SPF V V P +  + V   G G++S    V   A F ++      G L   +  P  S+  ++  +      + +Y P + G Y + +  D+  +  SPF   ++ T           T+ +  FGPGL +G  VVGK   F  D     G   F +     EG +   ++  DN DG+    Y P    ++       G  +P SP+   +           ++V GPG+Q   V    P +F++D               T  G  E  +     G+      Y P   G H V V    Q VP SPF+  +    +P+ V   G GL  +    PA F++D + AG G+LAV++  + G           D  +  V + P T GP +  S+ Y G  +P  P  + + P +D S + V      +  +F E+   F V+A+A+   G G  V    T PS     + VK+ GDG+Y+  Y+P + G + +DV +ED P+  SPF I V  GCDPS+V V G GL+ G TNQPN FT++  GAG G LGL IEGP++A I+CTDN DG+C VEY     G YD+ + + 
Sbjct:  171 QADASKVTARGPGLELNGVIAGKPTYFDIHTAGAGMGDVHVTITDPRGRSDTVDVELEDRGESVFRCAYRAVLEGAHSVAVSYGGTAIPRSPFPVNVAQA------CRVHLCHVCSNGQRESDLQKPEMVDIRPVIYEKERGDGSVKTFIISKGKERNQVKPLGPTRS-----CEYMPSVQGKHVVSVTWAGQHIPRSPFEVEVGPPAGEQKVRAWGPGLRSG--LVDHPAHFVVEAIGDDIGTLGFSIEGP--SQARIECQDCGDGSCDVVYWPGEAGDYAVHVVCDDQDIKHSPFMAEIVETGVRGLFVPNALTTKVKVFGPGLESGKVVVGKPIEFTVDARAG-GRAPFKVYAQDAEG-TPIDVQVKDNGDGTFLCRYTPRKAIKHTFLTTWGGVSVPGSPHRVQLXAGRHPQ--RGVRVSGPGLQSGEV--GRPAQFSVDTRGAGDG----GLGLTVEGPREARIECEDNGDGTCSVAYTPAEAGEHLVNVLFAGQHVPGSPFRALIHPTFDPSRVLATGRGLEKSKMGEPATFNVDCSKAGDGDLAVDVVSDSGKRADVKTRRGPD-GLHAVTFTPVTHGP-HTVSLTYGGKPVPHFPAKVAVDPAVDTSGIKVSGPGVEERGVFCEAITGFTVDARALGRAGNGARVVTRVTGPSGAMMDAPVKAKGDGTYAVEYTPCEIGVHTVDVLFEDTPVPRSPFRIAVDEGCDPSRVRVHGPGLKSGITNQPNRFTVETRGAGTGGLGLQIEGPTEAIISCTDNKDGSCLVEYVPETAGDYDVLVTYG 932          

HSP 3 Score: 268.855 bits (686), Expect = 1.460e-74
Identity = 249/917 (27.15%), Postives = 394/917 (42.97%), Query Frame = 3
Query: 1380 HSINIFLSSAQIKNSPFGVMVSPRSNAKLVTVSGRGIQSNGIRVGDKAEFFIDTQNAGNGKLNVKLLSPEKSEESVKIAEINP--NYFECLYIPSKPGMYELQINYDNIPVTRSPFKINVLPTKT--SHIAAFGPGL-TTGVV-GKAAIFVTDTNGE-LGSLGFSIEGPS----EAKIECCDNQDGSATICYWPTAPGEYAVHILCDGEDIPNSPYMANIMPSNEKTDVSKIKVYGPGVQKEGVALNSPNEFTIDCIEY-KSDIKPEASCFTCSGNEIPVVISSAGNKKYRCVYQPLTDGNHKVFVSCDNQSVPKSPFKVKVAQPSNPNNVRVIGEGLHSATRYTPAYFSIDTTNAGHGNLAVEINDEIGNILPFTLSNDTDHDIFDVHYQPNTSGPVYNCSIRYDGVNIPGSPFTIQIKPEIDISKVFVENLQTT---IFQESF----------IRFVVNAKAIDAKGKGTVKAIFTDPSSFKSGSMVKSNGDGSYSCSYSPYDAGTYILDVTYEDLPIKNSPFNIEVVPGCDPSK-VLVFGEGLEGGFTNQPNFFTIDLDGAGQGNLGLAIEGPSDAKINCTDNLDGTCTVEYSSTIPGTYDIYIKFNDVDVNGSPFKLPIRDPINTANVKCFGEPLTPGSINRVDQPITFTVDASRAGEAPLKACCKDNQGHEYPLEIKSRENTMPGIYDITFVPTELGPHAIEIKHANILVPGAPFLFNILPKSEPDKVKVIGEGVAPTGGFLTPSVPVQFHID---VSEAGQG-DIQXXXXXXXXXXXXXXXXXEGKGVFCCQYTPTDAGKHCITVAFNDSPVKNCPFIVEVIQVGDANKCFIEDGVKEYXXXXXXXXXXXXXXXAGEGKISCRIVPLTENGEVKSNLSLPVEIENNGNGTQSIYYSPNELSEYLVDIKFGG 4040
            HS+  +L+         G  + P+ N K     G G+++ G  V   A F ++T +AG G++ V +  P   +E  K++ +      +  +Y P   G +++ + +    + +SPF+++V   +   S + A GPGL   GV+ GK   F   T G  +G +  +I  P        +E  D  +      Y     G ++V +   G  IP SP+  N+    +   V    V   G Q+E   L  P    I  + Y K         F  S  +    +   G  +  C Y P   G H V V+   Q +P+SPF+V+V  P+    VR  G GL S     PA+F ++      G L   I    G         D      DV Y P  +G  Y   +  D  +I  SPF  +I  E  +  +FV N  TT   +F              I F V+A+A    G+   K    D         VK NGDG++ C Y+P  A  +    T+  + +  SP  +++  G  P + V V G GL+ G   +P  F++D  GAG G LGL +EGP +A+I C DN DGTC+V Y+    G + + + F    V GSPF+  I    + + V   G  L     +++ +P TF VD S+AG+  L      + G     ++K+R     G++ +TF P   GPH + + +    VP  P    + P  +   +KV G GV   G F        F +D   +  AG G  +   ++ P   ++   +  +G G +  +YTP + G H + V F D+PV   PF + V +  D ++  +     +  + N     T+ T  AG G +  +I   TE           +   +N +G+  + Y P    +Y V + +GG
Sbjct:   48 HSVMTYLAQFPKAKLKPGAPLRPKLNPKKARAFGPGVEAMGNMVMKPAAFTVETISAGQGEVLVFVEDPAGHKEEAKVSPVKDKNQTYSVVYTPKVVGPHKVTVLFAGQHINKSPFEVSVAKPQADASKVTARGPGLELNGVIAGKPTYFDIHTAGAGMGDVHVTITDPRGRSDTVDVELEDRGESVFRCAYRAVLEGAHSVAVSYGGTAIPRSPFPVNVA---QACRVHLCHVCSNG-QRES-DLQKPEMVDIRPVIYEKERGDGSVKTFIISKGKERNQVKPLGPTR-SCEYMPSVQGKHVVSVTWAGQHIPRSPFEVEVGPPAGEQKVRAWGPGLRSGLVDHPAHFVVEAIGDDIGTLGFSIE---GPSQARIECQDCGDGSCDVVYWPGEAGD-YAVHVVCDDQDIKHSPFMAEIV-ETGVRGLFVPNALTTKVKVFGPGLESGKVVVGKPIEFTVDARA---GGRAPFKVYAQDAEGTPIDVQVKDNGDGTFLCRYTPRKAIKHTFLTTWGGVSVPGSPHRVQLXAGRHPQRGVRVSGPGLQSGEVGRPAQFSVDTRGAGDGGLGLTVEGPREARIECEDNGDGTCSVAYTPAEAGEHLVNVLFAGQHVPGSPFRALIHPTFDPSRVLATGRGL---EKSKMGEPATFNVDCSKAGDGDLAVDVVSDSGKR--ADVKTRRGP-DGLHAVTFTPVTHGPHTVSLTYGGKPVPHFPAKVAVDPAVDTSGIKVSGPGVEERGVFC--EAITGFTVDARALGRAGNGARVVTRVTGPSGAMMDAPVKAKGDGTYAVEYTPCEIGVHTVDVLFEDTPVPRSPFRIAVDEGCDPSRVRVHGPGLKSGITNQPNRFTVETRGAGTGGLGLQIEGPTE---------AIISCTDNKDGSCLVEYVPETAGDYDVLVTYGG 933          

HSP 4 Score: 243.432 bits (620), Expect = 3.322e-66
Identity = 243/890 (27.30%), Postives = 372/890 (41.80%), Query Frame = 3
Query: 4176 MYPVEFRLP-ISLGAQNVEAIVSTPSGIRESALVH--DNNNGSVTIRYEPRERGMHEMNVTCDGIQIQGSPYKFFAE--NAGLGKVAAYGPGLSHGR--TGLPAEFTIVTKDAGAGGLSLAIEGPS----KAE