Ras-like GTP-binding protein RHO

Overview
NameRas-like GTP-binding protein RHO
Smed IDSMED30012446
Length (bp)1060
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-like GTP-binding protein RHO (SMED30012446) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-like GTP-binding protein RHO (SMED30012446) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-like GTP-binding protein RHO (SMED30012446) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-like GTP-binding protein RHO (SMED30012446) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012446

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30012446SMESG000068769.1 Contig2864GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30012446SMESG000068769.1 dd_Smed_v4_4294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012446SMESG000068769.1 dd_Smed_v4_4294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012446SMESG000068769.1 dd_Smed_v4_4294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012446SMESG000018613.1 OX_Smed_1.0.04912ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30012446SMESG000068769.1 dd_Smed_v4_4294_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30012446SMESG000068769.1 dd_Smed_v4_4294_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Human
Match: RHOB (ras homolog family member B [Source:HGNC Symbol;Acc:HGNC:668])

HSP 1 Score: 197.593 bits (501), Expect = 8.231e-62
Identity = 90/186 (48.39%), Postives = 123/186 (66.13%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWC 642
            I+KKLV++GDG  GKT LL+V+  +EFPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ N+ EKW PE  HFC   PI+LV  K DLR+  +   +        V  ++G+ +A +I+A D+ ECSAK    V+E+F  AT   + K     N C
Sbjct:    4 IRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGC 189          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Human
Match: RHOA (ras homolog family member A [Source:HGNC Symbol;Acc:HGNC:667])

HSP 1 Score: 196.052 bits (497), Expect = 2.886e-61
Identity = 93/190 (48.95%), Postives = 124/190 (65.26%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  +  K  + C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Human
Match: RHOC (ras homolog family member C [Source:HGNC Symbol;Acc:HGNC:669])

HSP 1 Score: 194.897 bits (494), Expect = 7.987e-61
Identity = 92/183 (50.27%), Postives = 122/183 (66.67%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATN--LTMPKSKK 627
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLR   +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   L + K+K+
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKR 186          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Human
Match: RHOC (ras homolog family member C [Source:HGNC Symbol;Acc:HGNC:669])

HSP 1 Score: 194.897 bits (494), Expect = 9.573e-61
Identity = 94/190 (49.47%), Postives = 122/190 (64.21%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSK-KPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLR   +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +   K K    C IL
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Human
Match: RHOC (ras homolog family member C [Source:HGNC Symbol;Acc:HGNC:669])

HSP 1 Score: 194.897 bits (494), Expect = 9.573e-61
Identity = 94/190 (49.47%), Postives = 122/190 (64.21%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSK-KPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLR   +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +   K K    C IL
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Celegans
Match: rho-1 (Ras-like GTP-binding protein rhoA [Source:UniProtKB/Swiss-Prot;Acc:Q22038])

HSP 1 Score: 196.438 bits (498), Expect = 8.233e-62
Identity = 92/189 (48.68%), Postives = 125/189 (66.14%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FP+ YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLR+      +        V   +G+ +A+QI A  + ECSAK    ++E+F  AT   + + KK  + C IL
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPDVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVRHFCPNVPIILVGNKRDLRSDPQTVRELAKMKQEPVKPEQGRAIAEQIGAFAYLECSAKTKDGIREVFEKATQAALQQKKKKKSKCMIL 192          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Celegans
Match: ced-10 (Ras-related protein ced-10 [Source:UniProtKB/Swiss-Prot;Acc:Q03206])

HSP 1 Score: 168.318 bits (425), Expect = 7.863e-51
Identity = 81/180 (45.00%), Postives = 113/180 (62.78%), Query Frame = 1
Query:  115 KLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATN--LTMPKSKK 627
            K V++GDG  GKT LL+ Y  N FP  Y+PTVF+ Y+  V  + + I+L LWDTAGQEDYDRLRPLSY   DV L+C+ +++  S  NV+ KW PE +H C   PI+LVGTK DLR   +  ++        VS+ +G ++A++IKA  + ECSA     ++++F  A    LT P+  K
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTVERLRERRLQPVSQTQGYVMAKEIKAVKYLECSALTQRGLKQVFDEAIRAVLTPPQRAK 184          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Celegans
Match: cdc-42 (Cell division control protein 42 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q05062])

HSP 1 Score: 162.155 bits (409), Expect = 1.539e-48
Identity = 81/187 (43.32%), Postives = 115/187 (61.50%), Query Frame = 1
Query:  115 KLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQ-------TNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            K V++GDG  GKT LL+ Y  N+FP  YVPTVF+ YA+ V    +  +L L+DTAGQEDYDRLRPLSY   DV L+C+++ +  S  NV+EKW PE +H C+  P +LVGT++DLR+          N  + VS + G+ LA+++KA  + ECSA     ++ +F  A    + P  ++    C IL
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVAPASFENVREKWVPEISHHCSKTPFLLVGTQVDLRDDPGMLEKLAKNKQKPVSTDVGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALDPPQQEKKKKCNIL 191          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Celegans
Match: mig-2 (Rac-like GTPase [Source:UniProtKB/TrEMBL;Acc:G5EBV3])

HSP 1 Score: 160.999 bits (406), Expect = 4.653e-48
Identity = 78/187 (41.71%), Postives = 112/187 (59.89%), Query Frame = 1
Query:  115 KLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFT-AATNLTMPKSKKPLNWCWIL 651
            K V++GDG  GKT +L+ Y  + FP  YVPTVF+ Y+  +  +   ++L LWDTAGQEDYDRLRPLSY   DV ++C+++ S  S  NV  KW PE    C  AP++LVGTK+DLR++              +S+ +G  +AQ+IKA  + ECSA     + ++F  A  ++  PK +K    C I+
Sbjct:    9 KCVVVGDGTVGKTCMLISYTTDSFPVQYVPTVFDNYSAQMSLDGNVVNLGLWDTAGQEDYDRLRPLSYPQTDVFILCFSVVSPVSFDNVASKWIPEIRQHCPDAPVILVGTKLDLRDEAEPMRALQAEGKSPISKTQGMKMAQKIKAVKYLECSALTQQGLTQVFEDAVRSILHPKPQKKKKSCNIM 195          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Celegans
Match: rac-2 (Ras-related protein rac-2 [Source:UniProtKB/Swiss-Prot;Acc:Q94124])

HSP 1 Score: 158.303 bits (399), Expect = 6.978e-47
Identity = 76/180 (42.22%), Postives = 112/180 (62.22%), Query Frame = 1
Query:  115 KLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAA--TNLTMPKSKK 627
            K V++GDG  GKT LL+ Y  N FP  Y+ TVF+TY+  V  + + I+L LWDTAGQ+DYD+ R LS+   DV L+C+ +++  S  NV+ KW PE +H C   PI+LVGTK DLR   +  ++        VS  +G ++A++IKA  + ECSA     ++++F  A  T LT P++ +
Sbjct:    5 KCVVVGDGAVGKTCLLLSYTTNAFPGEYILTVFDTYSTNVMVDGRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTIERLRERRLQPVSHTQGYVMAKEIKAVKYLECSALTQIGLKQVFDEAIRTGLTPPQTPQ 184          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Fly
Match: Rho1 (gene:FBgn0014020 transcript:FBtr0087212)

HSP 1 Score: 201.06 bits (510), Expect = 1.979e-63
Identity = 92/189 (48.68%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNN-------SDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  N          + V   EG+ +A++I A  + ECSAK    V+++F  AT   +   K+    C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTRCLLL 192          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Fly
Match: Rho1 (gene:FBgn0014020 transcript:FBtr0087213)

HSP 1 Score: 201.06 bits (510), Expect = 1.979e-63
Identity = 92/189 (48.68%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNN-------SDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  N          + V   EG+ +A++I A  + ECSAK    V+++F  AT   +   K+    C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTRCLLL 192          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Fly
Match: Rho1 (gene:FBgn0014020 transcript:FBtr0087216)

HSP 1 Score: 201.06 bits (510), Expect = 1.979e-63
Identity = 92/189 (48.68%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNN-------SDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  N          + V   EG+ +A++I A  + ECSAK    V+++F  AT   +   K+    C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTRCLLL 192          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Fly
Match: Rho1 (gene:FBgn0014020 transcript:FBtr0087214)

HSP 1 Score: 201.06 bits (510), Expect = 1.979e-63
Identity = 92/189 (48.68%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNN-------SDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  N          + V   EG+ +A++I A  + ECSAK    V+++F  AT   +   K+    C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTRCLLL 192          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Fly
Match: Rho1 (gene:FBgn0014020 transcript:FBtr0087211)

HSP 1 Score: 201.06 bits (510), Expect = 1.979e-63
Identity = 92/189 (48.68%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNN-------SDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  N          + V   EG+ +A++I A  + ECSAK    V+++F  AT   +   K+    C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTRCLLL 192          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Zebrafish
Match: rhoaa (ras homolog gene family, member Aa [Source:NCBI gene;Acc:406411])

HSP 1 Score: 198.364 bits (503), Expect = 2.357e-62
Identity = 94/190 (49.47%), Postives = 125/190 (65.79%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKK-PLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +   K+   N C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELQKMKQEPVKPEEGRDMANRINAFGYLECSAKTKEGVREVFEMATRAALQAKKRGKKNACALL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Zebrafish
Match: rhoaa (ras homolog gene family, member Aa [Source:NCBI gene;Acc:406411])

HSP 1 Score: 198.364 bits (503), Expect = 2.357e-62
Identity = 94/190 (49.47%), Postives = 125/190 (65.79%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKK-PLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +   K+   N C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELQKMKQEPVKPEEGRDMANRINAFGYLECSAKTKEGVREVFEMATRAALQAKKRGKKNACALL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Zebrafish
Match: rhoac (ras homolog gene family, member Ac [Source:NCBI gene;Acc:406659])

HSP 1 Score: 197.978 bits (502), Expect = 4.411e-62
Identity = 91/181 (50.28%), Postives = 121/181 (66.85%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKK 627
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +   K+
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRINAFGYLECSAKTKDGVREVFEMATRAALQARKR 184          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Zebrafish
Match: rhoab (ras homolog gene family, member Ab [Source:NCBI gene;Acc:100006041])

HSP 1 Score: 197.593 bits (501), Expect = 5.779e-62
Identity = 94/190 (49.47%), Postives = 125/190 (65.79%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  +  K  N C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKSNKCCLL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Zebrafish
Match: rhoab (ras homolog gene family, member Ab [Source:NCBI gene;Acc:100006041])

HSP 1 Score: 197.593 bits (501), Expect = 5.779e-62
Identity = 94/190 (49.47%), Postives = 125/190 (65.79%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  +  K  N C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKSNKCCLL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Xenopus
Match: nsd3 (nuclear receptor binding SET domain protein 3 [Source:Xenbase;Acc:XB-GENE-5992933])

HSP 1 Score: 198.749 bits (504), Expect = 3.047e-62
Identity = 93/190 (48.95%), Postives = 126/190 (66.32%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+++  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK N  V+E+F  AT   +  K  +  N C ++
Sbjct:    4 IRKKLVIVGDGACGKTCLLIMFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVRAEEGRDMANRISAFGYLECSAKTNDGVREVFEMATRAALQAKRGRKRNTCCLV 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Xenopus
Match: plek (pleckstrin [Source:Xenbase;Acc:XB-GENE-484214])

HSP 1 Score: 196.823 bits (499), Expect = 1.356e-61
Identity = 90/176 (51.14%), Postives = 119/176 (67.61%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM 612
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKPEEGRDMANRISAYGYMECSAKTKDGVREVFELATRAAL 179          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Xenopus
Match: plek (pleckstrin [Source:Xenbase;Acc:XB-GENE-484214])

HSP 1 Score: 196.438 bits (498), Expect = 1.528e-61
Identity = 90/176 (51.14%), Postives = 119/176 (67.61%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM 612
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKPEEGRDMANRISAYGYMECSAKTKDGVREVFELATRAAL 179          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Xenopus
Match: plek (pleckstrin [Source:Xenbase;Acc:XB-GENE-484214])

HSP 1 Score: 196.823 bits (499), Expect = 1.575e-61
Identity = 90/176 (51.14%), Postives = 119/176 (67.61%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM 612
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKPEEGRDMANRISAYGYMECSAKTKDGVREVFELATRAAL 179          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Xenopus
Match: man1a2 (mannosidase, alpha, class 1A, member 2 [Source:Xenbase;Acc:XB-GENE-1010312])

HSP 1 Score: 195.667 bits (496), Expect = 4.835e-61
Identity = 91/193 (47.15%), Postives = 127/193 (65.80%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPK----SKKPLNWCWIL 651
            I+KKLV++GDG  GKT LL+V+  +EFPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ N+ EKW PE  HFC   PI+LV  K DLRN  +  ++        V   +G+ +A +I A ++ ECSAK    V+E+F  AT   + K    S + ++ C +L
Sbjct:    4 IRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDVKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPSVPIILVANKKDLRNDEHVRNELARMKQEPVRTEDGRAMAVRINAFEYLECSAKTKEGVREVFETATRAALQKKHGRSGECMSCCKLL 196          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Mouse
Match: Rhob (ras homolog family member B [Source:MGI Symbol;Acc:MGI:107949])

HSP 1 Score: 197.593 bits (501), Expect = 5.651e-62
Identity = 90/186 (48.39%), Postives = 123/186 (66.13%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWC 642
            I+KKLV++GDG  GKT LL+V+  +EFPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ N+ EKW PE  HFC   PI+LV  K DLR+  +   +        V  ++G+ +A +I+A D+ ECSAK    V+E+F  AT   + K     N C
Sbjct:    4 IRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGC 189          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Mouse
Match: Rhoa (ras homolog family member A [Source:MGI Symbol;Acc:MGI:1096342])

HSP 1 Score: 196.823 bits (499), Expect = 1.314e-61
Identity = 94/190 (49.47%), Postives = 124/190 (65.26%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  +  K  + C IL
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLIL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Mouse
Match: Rhoc (ras homolog family member C [Source:MGI Symbol;Acc:MGI:106028])

HSP 1 Score: 194.897 bits (494), Expect = 6.573e-61
Identity = 94/190 (49.47%), Postives = 122/190 (64.21%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSK-KPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLR   +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +   K K    C IL
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Mouse
Match: Rhoc (ras homolog family member C [Source:MGI Symbol;Acc:MGI:106028])

HSP 1 Score: 194.897 bits (494), Expect = 6.573e-61
Identity = 94/190 (49.47%), Postives = 122/190 (64.21%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSK-KPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLR   +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +   K K    C IL
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Mouse
Match: Rhoc (ras homolog family member C [Source:MGI Symbol;Acc:MGI:106028])

HSP 1 Score: 194.897 bits (494), Expect = 6.573e-61
Identity = 94/190 (49.47%), Postives = 122/190 (64.21%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSK-KPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLR   +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +   K K    C IL
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL 193          
BLAST of Ras-like GTP-binding protein RHO vs. UniProt/SwissProt
Match: sp|P06780|RHO1_YEAST (GTP-binding protein RHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RHO1 PE=1 SV=3)

HSP 1 Score: 202.216 bits (513), Expect = 1.171e-62
Identity = 97/181 (53.59%), Postives = 125/181 (69.06%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLT-MPKSK 624
            I++KLVI+GDG  GKT LL+V+   +FPE YVPTVFE Y   V+ + + + L LWDTAGQEDYDRLRPLSY +++VVLIC++ID  DS+ NV+EKW  E  HFC G PI+LVG K+DLRN     +Q        V+  EG+ +A QI A  ++ECSAK    V+E+F AAT  + M KSK
Sbjct:    9 IRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSK 189          
BLAST of Ras-like GTP-binding protein RHO vs. UniProt/SwissProt
Match: sp|P48148|RHO1_DROME (Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster OX=7227 GN=Rho1 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.983e-62
Identity = 92/189 (48.68%), Postives = 124/189 (65.61%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNN-------SDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  N          + V   EG+ +A++I A  + ECSAK    V+++F  AT   +   K+    C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDPNTIRDLAKMKQEPVKPQEGRAMAEKINAFAYLECSAKSKEGVRDVFETATRAALQVKKRKKTRCLLL 192          
BLAST of Ras-like GTP-binding protein RHO vs. UniProt/SwissProt
Match: sp|O42825|RHO1_CANAL (GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RHO1 PE=3 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 5.707e-62
Identity = 92/176 (52.27%), Postives = 123/176 (69.89%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNN-------SDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM 612
            +++KLVI+GDG  GKT LL+V+    FPE YVPTVFE Y   V+ + +++ L LWDTAGQEDYDRLRPLSY +++V+LIC+++DS DS+ NV EKW  E  HFC G PI+LVG K DLR+  +          Q VS +EG+ +AQ+I A D+ ECSAK    V+E+F AAT  ++
Sbjct:    8 LRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGRKVELALWDTAGQEDYDRLRPLSYPDSNVILICFSVDSPDSLDNVLEKWISEVLHFCQGVPIILVGCKSDLRDDPHTIEALRQQQQQPVSTSEGQQVAQRIGAADYLECSAKTGRGVREVFEAATRASL 183          
BLAST of Ras-like GTP-binding protein RHO vs. UniProt/SwissProt
Match: sp|Q6NUX8|RHOAA_DANRE (Rho-related GTP-binding protein RhoA-A OS=Danio rerio OX=7955 GN=rhoaa PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.779e-61
Identity = 94/190 (49.47%), Postives = 125/190 (65.79%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKK-PLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +   K+   N C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELQKMKQEPVKPEEGRDMANRINAFGYLECSAKTKEGVREVFEMATRAALQAKKRGKKNACALL 193          
BLAST of Ras-like GTP-binding protein RHO vs. UniProt/SwissProt
Match: sp|Q7T2E8|RHOAC_DANRE (Rho-related GTP-binding protein RhoA-C OS=Danio rerio OX=7955 GN=rhoac PE=1 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 3.330e-61
Identity = 91/181 (50.28%), Postives = 121/181 (66.85%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKK 627
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +   K+
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRINAFGYLECSAKTKDGVREVFEMATRAALQARKR 184          
BLAST of Ras-like GTP-binding protein RHO vs. TrEMBL
Match: Q9XZG7 (Rho GTPase OS=Schistosoma mansoni OX=6183 GN=Rho1 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.057e-63
Identity = 100/189 (52.91%), Postives = 131/189 (69.31%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLR------NQTNNSDQF-VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            ++KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ +N+++ L LWDTAGQEDYDRLRPLSY + DVVL+CY+IDS DS  N++EKW PE  HFC   PIVLVG K DLR      N+ + + Q  V+ NEGK +A++I A  FFECSAK    V ++F AAT   +  +KK    C ++
Sbjct:    5 VRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDNRQVELALWDTAGQEDYDRLRPLSYPDTDVVLLCYSIDSPDSFANIEEKWLPEIRHFCPDVPIVLVGNKKDLRHDEATKNELHRTKQLPVTFNEGKQVAEKISAYAFFECSAKTKEGVSDVFVAATRAALNSAKKKRRRCDLI 193          
BLAST of Ras-like GTP-binding protein RHO vs. TrEMBL
Match: A0A1I8CLR1 (Uncharacterized protein OS=Rhabditophanes sp. KR3021 OX=114890 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 3.959e-63
Identity = 94/189 (49.74%), Postives = 130/189 (68.78%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQ-------TNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FP+ YVPTVFE+Y I ++ + KE+ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG KMDLRN          N  + ++  +G+ +A++I A D+ ECSAK    ++++F  AT   + + KK    C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFTKDQFPDVYVPTVFESYVIDIEVDAKEVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLDNIPEKWTPEVRHFCPNVPIILVGNKMDLRNDPQTIRELAKNKQEPINSQQGRAIAEKIGAYDYLECSAKTKGGIRQVFERATQAALQRRKKKKGKCDVL 192          
BLAST of Ras-like GTP-binding protein RHO vs. TrEMBL
Match: T1ITM7 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 4.002e-63
Identity = 96/189 (50.79%), Postives = 127/189 (67.20%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN +N   +        V  +EG+ +A++I A  + ECSAK    V+E+F  AT   +   KK  N C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDSNTIKELSKMKQEPVKPDEGRAMAEKISAFSYLECSAKSKEGVREVFETATRAALQVKKKKRNRCIVL 192          
BLAST of Ras-like GTP-binding protein RHO vs. TrEMBL
Match: A0A132ADC2 (Ras-like protein GTP-binding protein Rho1-like protein OS=Sarcoptes scabiei OX=52283 GN=QR98_0069690 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 7.748e-63
Identity = 96/185 (51.89%), Postives = 128/185 (69.19%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQ---TNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE+YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW+PE  HFC   P++LVG K DLRN      +  + VS  EGK +A++I A  + ECSAK    V+E+F  AT   +   KK    C IL
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEFYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWSPEVRHFCPNVPVILVGNKKDLRNDPYTIKSKIKTVSAEEGKAMAEKINAFGYLECSAKTKEGVREVFEVATRAALQSKKKRRKKCVIL 188          
BLAST of Ras-like GTP-binding protein RHO vs. TrEMBL
Match: A0A3S2LK94 (Uncharacterized protein OS=Oryzias javanicus OX=123683 GN=OJAV_G00229120 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.004e-62
Identity = 94/186 (50.54%), Postives = 126/186 (67.74%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWC 642
            I+KKLV++GDG  GKT LL+V+  +EFPE YVPTVFETY   ++ +NK++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  N  ++        V   +G+ +A +I A D+ ECSAK    + E+F  AT   + K + P + C
Sbjct:    4 IRKKLVVVGDGACGKTCLLIVFSRDEFPEVYVPTVFETYVADIEVDNKQVQLALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLQNIPEKWVPEVKHFCPNVPIILVGNKKDLRNDENTKNELSRLKLEPVKAEDGRAMAARIGAYDYLECSAKTKEGIWEVFETATRAALQKRRTPGDGC 189          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Cavefish
Match: rhoca (rho-related GTP-binding protein RhoA-D-like [Source:NCBI gene;Acc:103035456])

HSP 1 Score: 199.134 bits (505), Expect = 1.067e-62
Identity = 94/190 (49.47%), Postives = 125/190 (65.79%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMP-KSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  + K+  + C IL
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAALQVRKKRKRSGCLIL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Cavefish
Match: rhoaa (rho-related GTP-binding protein RhoA-A [Source:NCBI gene;Acc:103028705])

HSP 1 Score: 199.134 bits (505), Expect = 1.215e-62
Identity = 94/190 (49.47%), Postives = 124/190 (65.26%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  K +   N C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKAEEGRDMANRIYAAGYLECSAKTKDGVREVFEMATRAALQAKKRSKKNACALL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Cavefish
Match: rhocb (rho-related GTP-binding protein RhoA-D [Source:NCBI gene;Acc:103031338])

HSP 1 Score: 198.364 bits (503), Expect = 2.615e-62
Identity = 93/190 (48.95%), Postives = 125/190 (65.79%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMP-KSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  + +K  + C +L
Sbjct:    6 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAALQVRKRKKRSGCLLL 195          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Cavefish
Match: rhocb (rho-related GTP-binding protein RhoA-D [Source:NCBI gene;Acc:103031338])

HSP 1 Score: 197.978 bits (502), Expect = 2.762e-62
Identity = 93/190 (48.95%), Postives = 125/190 (65.79%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMP-KSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  + +K  + C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAALQVRKRKKRSGCLLL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Cavefish
Match: rhoab (rho-related GTP-binding protein RhoA-B [Source:NCBI gene;Acc:103027457])

HSP 1 Score: 197.978 bits (502), Expect = 3.145e-62
Identity = 94/190 (49.47%), Postives = 125/190 (65.79%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  +  K  N C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKAEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKSNKCLLL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004439.1 (pep scaffold:Pmarinus_7.0:GL476335:1598569:1600956:1 gene:ENSPMAG00000004041.1 transcript:ENSPMAT00000004439.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 198.364 bits (503), Expect = 4.663e-63
Identity = 94/190 (49.47%), Postives = 124/190 (65.26%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMP-KSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  N   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  + +K    C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDDNTKRELAKMKQEPVRVEEGRDMANRINAFGYMECSAKTKDGVREVFEMATRAALQVRKRKKTGGCRLL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001838.1 (pep scaffold:Pmarinus_7.0:GL478831:173097:182385:-1 gene:ENSPMAG00000001664.1 transcript:ENSPMAT00000001838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.438 bits (498), Expect = 3.013e-62
Identity = 91/181 (50.28%), Postives = 120/181 (66.30%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKK 627
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  + K
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDESTRRELAKMKQEPVKSEEGRDMANRINAFGYMECSAKTKDGVREVFEMATRAALQLTAK 184          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002754.1 (pep scaffold:Pmarinus_7.0:GL476453:253767:255265:1 gene:ENSPMAG00000002511.1 transcript:ENSPMAT00000002754.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.274 bits (482), Expect = 8.533e-60
Identity = 86/180 (47.78%), Postives = 119/180 (66.11%), Query Frame = 1
Query:  109 KKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKK 627
            +KKLV++GDG  GKT LLMV+  ++FP+ YVPTVFETY   ++ + +++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ NV EKW PE  HFC   PIVLV  K DLR   +   +        +   +G+ +A +I+A D+ ECSA+    V+ +F  AT   + K  K
Sbjct:    7 RKKLVVVGDGACGKTCLLMVFSKDKFPDVYVPTVFETYVADIEVDGRQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENVPEKWVPEVQHFCPNVPIVLVANKKDLRGDESVLQELARIKREPLKPEDGRTMASRIQAFDYVECSAQTKDGVRLVFETATRAAIQKQSK 186          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006108.1 (pep scaffold:Pmarinus_7.0:GL480344:135:8553:-1 gene:ENSPMAG00000005525.1 transcript:ENSPMAT00000006108.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.555 bits (436), Expect = 7.498e-54
Identity = 75/128 (58.59%), Postives = 95/128 (74.22%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF 489
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  N   + 
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDENTRREL 131          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008827.1 (pep scaffold:Pmarinus_7.0:GL480655:11470:16574:-1 gene:ENSPMAG00000007986.1 transcript:ENSPMAT00000008827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 168.318 bits (425), Expect = 1.948e-51
Identity = 82/192 (42.71%), Postives = 118/192 (61.46%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKE-----ISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQFVSRNEGKLLAQQIKA----GDFFECSAKENANVQEIFTAATNLTMP-KSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K+     + L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLR+      +     + ++  + +         F+   + +  V+E+F  AT   +  ++ K   +C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQSVVNQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKRDLRHDDATRRELAKMKQNEVNEKTLDVIQNDVSLFKRIRRSSTLVREVFELATRAALHVRTHKKNGFCRLL 195          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Yeast
Match: RHO1 (GTP-binding protein of the rho subfamily of Ras-like proteins; involved in establishment of cell polarity; regulates protein kinase C (Pkc1p) and the cell wall synthesizing enzyme 1,3-beta-glucan synthase (Fks1p and Gsc2p) [Source:SGD;Acc:S000006369])

HSP 1 Score: 202.216 bits (513), Expect = 1.687e-64
Identity = 97/181 (53.59%), Postives = 125/181 (69.06%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLT-MPKSK 624
            I++KLVI+GDG  GKT LL+V+   +FPE YVPTVFE Y   V+ + + + L LWDTAGQEDYDRLRPLSY +++VVLIC++ID  DS+ NV+EKW  E  HFC G PI+LVG K+DLRN     +Q        V+  EG+ +A QI A  ++ECSAK    V+E+F AAT  + M KSK
Sbjct:    9 IRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVFENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQEKWIAEVLHFCQGVPIILVGCKVDLRNDPQTIEQLRQEGQQPVTSQEGQSVADQIGATGYYECSAKTGYGVREVFEAATRASLMGKSK 189          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Yeast
Match: RHO2 (Non-essential small GTPase of the Rho/Rac family of Ras-like proteins; involved in the establishment of cell polarity and in microtubule assembly [Source:SGD;Acc:S000005034])

HSP 1 Score: 177.178 bits (448), Expect = 4.122e-55
Identity = 89/187 (47.59%), Postives = 121/187 (64.71%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQT----NNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKP-LNWCWIL 651
            +++KLVIIGDG  GKTSLL V+   +FPE Y PTVFE Y    + +  ++SL LWDTAGQE+Y+RLRP SYS AD++LI + +D+ +S+IN + KWA EA  +C  APIVLVG K DLR +     N +D+ V   + K +A+ I A  + ECSA     V ++F  AT  ++   K+P  N C IL
Sbjct:    6 VRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTDCRVDGIKVSLTLWDTAGQEEYERLRPFSYSKADIILIGFAVDNFESLINARTKWADEALRYCPDAPIVLVGLKKDLRQEAHFKENATDEMVPIEDAKQVARAIGAKKYMECSALTGEGVDDVFEVATRTSLLMKKEPGANCCIIL 192          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Yeast
Match: CDC42 (Small rho-like GTPase; essential for establishment and maintenance of cell polarity; plays a role late in cell fusion via activation of key cell fusion regulator Fus2p; mutants have defects in the organization of actin and septins; human homolog CDC42 can complement yeast cdc42 mutant [Source:SGD;Acc:S000004219])

HSP 1 Score: 162.925 bits (411), Expect = 1.375e-49
Identity = 81/187 (43.32%), Postives = 115/187 (61.50%), Query Frame = 1
Query:  115 KLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            K V++GDG  GKT LL+ Y  N+FP  YVPTVF+ YA+ V   ++  +L L+DTAGQEDYDRLRPLSY + DV L+C+++ S  S  NVKEKW PE +H C G P ++VGT++DLR+     ++        ++  +G  LA+++KA  + ECSA     ++ +F  A    + P   K    C IL
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKCAIL 191          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Yeast
Match: RHO3 (Non-essential small GTPase of the Rho/Rac family of Ras-like proteins; involved in the establishment of cell polarity; GTPase activity positively regulated by the GTPase activating protein (GAP) Rgd1p [Source:SGD;Acc:S000001380])

HSP 1 Score: 160.999 bits (406), Expect = 2.898e-48
Identity = 83/197 (42.13%), Postives = 112/197 (56.85%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLR----------------------------NQTNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM 612
            I++K+VI+GDG  GKTSLL V+    FPE Y PTVFE Y   +  ++K I+L LWDTAGQE++DRLR LSYS+   +++C++IDS+DS+ NV+ KW  E    C G  +VLV  K DLR                            N T+N    +S  EG  +A++I A  + ECSAK N  V E FT A  + +
Sbjct:   15 IERKIVILGDGACGKTSLLNVFTRGYFPEVYEPTVFENYIHDIFVDSKHITLSLWDTAGQEEFDRLRSLSYSDTQCIMLCFSIDSRDSLENVQNKWVGEITDHCEGVKLVLVALKCDLRNNENESNAITPNNIQQDNSVSNDNGNNINSTSNGKNLISYEEGLAMAKKIGALRYLECSAKLNKGVNEAFTEAARVAL 211          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Yeast
Match: RHO4 (Non-essential small GTPase; member of the Rho/Rac subfamily of Ras-like proteins; likely to be involved in the establishment of cell polarity; has long N-terminal extension that plays an important role in Rho4p function and is shared with Rho4 homologs in other yeasts and filamentous fungi [Source:SGD;Acc:S000001763])

HSP 1 Score: 162.155 bits (409), Expect = 5.086e-48
Identity = 78/170 (45.88%), Postives = 109/170 (64.12%), Query Frame = 1
Query:  115 KLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEI-SLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKS 621
            K+V++GDG  GKT LL+ Y    FP  Y+PT+FE Y   ++  N +I  L LWDTAGQE+Y RLRPLSY+NADV+++CY++ SK S+ NV++ W PE  HFC   PI+LVG K DL    N SD  V  +  + LA+++ A    +CSA+   N+ E+F  A +  +  S
Sbjct:   74 KIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPNGQIIELALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPIMLVGLKSDLYEADNLSD-LVEPSSAESLAKRLGAFAHIQCSARLKENIDEVFETAIHTLLSDS 242          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Nematostella
Match: EDO39465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9Y5])

HSP 1 Score: 196.438 bits (498), Expect = 4.680e-62
Identity = 94/189 (49.74%), Postives = 122/189 (64.55%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLR   N   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +   KK    C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRMDENTKRELQKMKQEPVKIEEGRAMADKISAYAYLECSAKTKDGVREVFETATRAALQTKKKKKGKCVLL 192          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Nematostella
Match: EDO35019 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMN7])

HSP 1 Score: 164.466 bits (415), Expect = 1.056e-49
Identity = 78/173 (45.09%), Postives = 106/173 (61.27%), Query Frame = 1
Query:  115 KLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM 612
            K V++GDG  GKT +L+ Y  N FP  Y+PTVF+ Y+  V  + + I+L LWDTAGQEDYDRLRPLSY   DV LIC+++ S  S  NV+ KW PE +H C G PI+LVGTK DLR      ++        +S + G  +A++IKA  + ECSA     ++ +F  A    +
Sbjct:    5 KCVVVGDGAVGKTCMLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSVISPASFENVRAKWYPEVSHHCPGTPIILVGTKTDLREDKEMIEKLKEKKLNPLSTSHGLQMAKEIKAAKYLECSALTQKGLKTVFDDAIRAVL 177          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Nematostella
Match: EDO38536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCK6])

HSP 1 Score: 164.466 bits (415), Expect = 1.236e-49
Identity = 83/184 (45.11%), Postives = 110/184 (59.78%), Query Frame = 1
Query:  115 KLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM---PKSKKPLN 636
            K V++GDG  GKT LL+ Y  N FP  Y+PTVF+ Y+  V  + K I+L LWDTAGQEDYDRLRPLSY   DV LIC+++ S  S  NV+ KW PE +H C   PIVLVGTK+DLR+     D+        +   +G  +A++I A  + ECSA     ++ +F  A    +     +KKP N
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLISPASYENVRAKWYPEVSHHCPNTPIVLVGTKLDLRDDKETIDKLKEKKLGPIGYTQGLQMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPTKPAKKPRN 188          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Nematostella
Match: EDO37472 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFJ1])

HSP 1 Score: 159.458 bits (402), Expect = 8.837e-48
Identity = 79/182 (43.41%), Postives = 110/182 (60.44%), Query Frame = 1
Query:  115 KLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQ-------TNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIF----TAATNLTMPKSKK 627
            K V++GDG  GKT LL+ Y  N+FP  YVPTVF+ YA+ V    +  +L L+DTAGQEDYDRLRPLSY   DV L+C+++ S  S  NVKEKW PE  H C   P +LVGT++DLR+        + N  + ++    + LA++++A  + ECSA     ++ +F     AA     P+ KK
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQVDLRDDQGTIEKLSKNKQKPIAVEAAEKLARELRAVKYVECSALTQKGLKNVFDEAILAALEPPEPQKKK 186          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Nematostella
Match: EDO40156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7Y6])

HSP 1 Score: 140.584 bits (353), Expect = 2.721e-40
Identity = 71/168 (42.26%), Postives = 100/168 (59.52%), Query Frame = 1
Query:  115 KLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRN-------QTNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAA 597
            K VI+GDGG GKTSLL+ Y  + FP  YVPT F+TY + V+ N K   +E  DTAGQED+D LRPL YS+ADV ++C+++ S  S  NV  KW PE   F   API+LVGT  DL++        +    Q +S  + + L ++ +   + E S+    N++ +F  A
Sbjct:   20 KCVIVGDGGVGKTSLLVSYMMDGFPNSYVPTAFDTYHVTVEVNKKLCMIEFCDTAGQEDFDALRPLCYSSADVFIVCFSVVSPTSFANVASKWIPEIREFQPKAPIILVGTHSDLKDCYKILTELSQQDSQPISVKKAEGLVKKTRCVCYVETSSVTQKNLKTVFDEA 187          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Medaka
Match: RHOB (ras homolog family member B [Source:HGNC Symbol;Acc:HGNC:668])

HSP 1 Score: 203.371 bits (516), Expect = 1.963e-64
Identity = 94/183 (51.37%), Postives = 124/183 (67.76%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQW-NNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKP 630
            I+KKLV++GDG  GKT LL+V+  +EFPE YVPTVFETY   ++  NNK++ L LWDTAGQEDYDRLRPLSY + DV+L+C+++DS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  N  ++        V   +G+ +A +I A D+ ECSAK    + E+F  AT   + K + P
Sbjct:    4 IRKKLVVVGDGACGKTCLLIVFSRDEFPEVYVPTVFETYVADIEVDNNKQVQLALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLQNIPEKWVPEVKHFCPNVPIILVGNKKDLRNDENTKNELSRLKLEPVKAEDGRAMAARIGAYDYLECSAKTKEGIWEVFETATRAALQKRRTP 186          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Medaka
Match: ENSORLT00000033387.1 (rho-related GTP-binding protein RhoA-B [Source:NCBI gene;Acc:101167618])

HSP 1 Score: 197.593 bits (501), Expect = 4.139e-62
Identity = 94/190 (49.47%), Postives = 124/190 (65.26%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  +  K  N C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDDHTRRELAKMKQEPVKSEEGRDMAGRIAAFGYMECSAKTKEGVREVFEMATRAALQARRGKKSNKCVLL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Medaka
Match: ENSORLT00000040023.1 (rho-related GTP-binding protein RhoA-B [Source:NCBI gene;Acc:101167618])

HSP 1 Score: 197.593 bits (501), Expect = 4.139e-62
Identity = 94/190 (49.47%), Postives = 124/190 (65.26%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   EG+ +A +I A  + ECSAK    V+E+F  AT   +  +  K  N C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDDHTRRELAKMKQEPVKSEEGRDMAGRIAAFGYMECSAKTKEGVREVFEMATRAALQARRGKKSNKCVLL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Medaka
Match: ENSORLT00000023517.2 (transforming protein RhoA [Source:NCBI gene;Acc:101173444])

HSP 1 Score: 196.823 bits (499), Expect = 7.746e-62
Identity = 93/190 (48.95%), Postives = 124/190 (65.26%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   +G+ +A +I A  + ECSAK    V+E+F  AT   +  +  K  N C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEDGRDMANRIGASGYMECSAKTKDGVREVFEMATRAALQARRGKKSNRCVLL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Medaka
Match: ENSORLT00000003418.2 (rho-related GTP-binding protein RhoA-C [Source:NCBI gene;Acc:101160539])

HSP 1 Score: 196.052 bits (497), Expect = 1.940e-61
Identity = 93/190 (48.95%), Postives = 123/190 (64.74%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQF-------VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ + K++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +   +        V   E + +A +I A  + ECSAK    V+E+F  AT   +  K +K    C +L
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKSEEARDMANRINAFGYLECSAKTKDGVREVFEMATRAALQAKGRKKKGGCILL 193          
BLAST of Ras-like GTP-binding protein RHO vs. Planmine SMEST
Match: SMESG000068769.1 (SMESG000068769.1)

HSP 1 Score: 380.948 bits (977), Expect = 2.211e-134
Identity = 183/183 (100.00%), Postives = 183/183 (100.00%), Query Frame = 1
Query:  103 MIKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 651
            MIKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL
Sbjct:    1 MIKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTMPKSKKPLNWCWIL 183          
BLAST of Ras-like GTP-binding protein RHO vs. Planmine SMEST
Match: SMESG000022390.1 (SMESG000022390.1)

HSP 1 Score: 197.208 bits (500), Expect = 4.368e-62
Identity = 91/175 (52.00%), Postives = 119/175 (68.00%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQTN------NSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM 612
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ ++K + L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN  +      N  + V   +GK +A +I A  + ECSAK    V+E+F  AT   +
Sbjct:    5 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKSVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSSDSLENIPEKWTPEVKHFCQNVPIILVGNKKDLRNDDSSRKDGKNKVEIVKFEDGKAMADRIGAYAYIECSAKTKDGVREVFETATKAAL 179          
BLAST of Ras-like GTP-binding protein RHO vs. Planmine SMEST
Match: SMESG000001635.1 (SMESG000001635.1)

HSP 1 Score: 196.823 bits (499), Expect = 5.728e-62
Identity = 95/186 (51.08%), Postives = 122/186 (65.59%), Query Frame = 1
Query:  106 IKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQ-------TNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATN--LTMPKSKKPLN 636
            I+KKLVI+GDG  GKT LL+V+  ++FPE YVPTVFE Y   ++ +NK++ L LWDTAGQEDYDRLRPLSY + DV+L+C++IDS DS+ N+ EKW PE  HFC   PI+LVG K DLRN             + V   +G L A +I A  + ECSAK    V+E+F  AT   L++   KK  N
Sbjct:    4 IRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDNKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSTDSLENIVEKWYPEVKHFCPNVPIILVGNKKDLRNDERARHELAKMRQELVKYEDGLLTADKINAVKYLECSAKTKDGVREVFETATRAALSVKHKKKKCN 189          
BLAST of Ras-like GTP-binding protein RHO vs. Planmine SMEST
Match: SMESG000024968.1 (SMESG000024968.1)

HSP 1 Score: 169.859 bits (429), Expect = 1.606e-51
Identity = 82/182 (45.05%), Postives = 117/182 (64.29%), Query Frame = 1
Query:  115 KLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRN--QTNNSDQFVSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM-PKSKKPLNWCWIL 651
            K V++GDG  GKT LL+ Y  + FP  Y+PTVF+ Y+  +  +NK ++L LWDTAGQEDYDRLRPLSY   DV +IC+++ +  S  NV+ KW PE N+ C   PI+LVGTK+DLR+  QTN +   +S  +G +L ++I A  + ECSA     ++ +F  +  + + PK K+    C IL
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTSAFPGEYIPTVFDNYSANIMVDNKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFIICFSLVNPSSYENVRAKWYPEVNNHCPNTPIILVGTKLDLRDESQTNKTGGHISYPQGLILMKEIGAKKYLECSALTQTGLKTVFDESIRVVLCPKQKQNKKRCSIL 186          
BLAST of Ras-like GTP-binding protein RHO vs. Planmine SMEST
Match: SMESG000005010.1 (SMESG000005010.1)

HSP 1 Score: 164.851 bits (416), Expect = 1.708e-49
Identity = 85/194 (43.81%), Postives = 118/194 (60.82%), Query Frame = 1
Query:  103 MIKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKEISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPEANHFCNGAPIVLVGTKMDLRNQT----NNSDQF----VSRNEGKLLAQQIKAGDFFECSAKENANVQEIFTAATNLTM--PKSKKP-LNWCWIL 651
            M   K V++GDG  GKT +L+ Y  + FP  +VPTVF+  +  V      I+L LWDTAGQE+YDRLRPLSY   DV LIC+++ +KDS  NVKEKW  E +HF    PI+LVGTK+DLR +     N+ +Q     V+  +G  L Q+I A  + ECSA+   N++++F  A  + +  PK   P   +C +L
Sbjct:    1 MRSIKCVVVGDGAVGKTCILISYTTDAFPTTHVPTVFDNMSANVMIEGTPINLGLWDTAGQEEYDRLRPLSYPETDVFLICFSLVNKDSFANVKEKWYKEVSHFSKETPIILVGTKLDLREERALNENDKNQIRSSPVTYQQGLALCQEIGAVKYIECSARTQVNLRQVFEEAIRVVINKPKPSNPRFKFCSLL 194          
The following BLAST results are available for this feature:
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RHOB8.231e-6248.39ras homolog family member B [Source:HGNC Symbol;Ac... [more]
RHOA2.886e-6148.95ras homolog family member A [Source:HGNC Symbol;Ac... [more]
RHOC7.987e-6150.27ras homolog family member C [Source:HGNC Symbol;Ac... [more]
RHOC9.573e-6149.47ras homolog family member C [Source:HGNC Symbol;Ac... [more]
RHOC9.573e-6149.47ras homolog family member C [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rho-18.233e-6248.68Ras-like GTP-binding protein rhoA [Source:UniProt... [more]
ced-107.863e-5145.00Ras-related protein ced-10 [Source:UniProtKB/Swis... [more]
cdc-421.539e-4843.32Cell division control protein 42 homolog [Source:... [more]
mig-24.653e-4841.71Rac-like GTPase [Source:UniProtKB/TrEMBL;Acc:G5EB... [more]
rac-26.978e-4742.22Ras-related protein rac-2 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rho11.979e-6348.68gene:FBgn0014020 transcript:FBtr0087212[more]
Rho11.979e-6348.68gene:FBgn0014020 transcript:FBtr0087213[more]
Rho11.979e-6348.68gene:FBgn0014020 transcript:FBtr0087216[more]
Rho11.979e-6348.68gene:FBgn0014020 transcript:FBtr0087214[more]
Rho11.979e-6348.68gene:FBgn0014020 transcript:FBtr0087211[more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhoaa2.357e-6249.47ras homolog gene family, member Aa [Source:NCBI ge... [more]
rhoaa2.357e-6249.47ras homolog gene family, member Aa [Source:NCBI ge... [more]
rhoac4.411e-6250.28ras homolog gene family, member Ac [Source:NCBI ge... [more]
rhoab5.779e-6249.47ras homolog gene family, member Ab [Source:NCBI ge... [more]
rhoab5.779e-6249.47ras homolog gene family, member Ab [Source:NCBI ge... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nsd33.047e-6248.95nuclear receptor binding SET domain protein 3 [Sou... [more]
plek1.356e-6151.14pleckstrin [Source:Xenbase;Acc:XB-GENE-484214][more]
plek1.528e-6151.14pleckstrin [Source:Xenbase;Acc:XB-GENE-484214][more]
plek1.575e-6151.14pleckstrin [Source:Xenbase;Acc:XB-GENE-484214][more]
man1a24.835e-6147.15mannosidase, alpha, class 1A, member 2 [Source:Xen... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rhob5.651e-6248.39ras homolog family member B [Source:MGI Symbol;Acc... [more]
Rhoa1.314e-6149.47ras homolog family member A [Source:MGI Symbol;Acc... [more]
Rhoc6.573e-6149.47ras homolog family member C [Source:MGI Symbol;Acc... [more]
Rhoc6.573e-6149.47ras homolog family member C [Source:MGI Symbol;Acc... [more]
Rhoc6.573e-6149.47ras homolog family member C [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P06780|RHO1_YEAST1.171e-6253.59GTP-binding protein RHO1 OS=Saccharomyces cerevisi... [more]
sp|P48148|RHO1_DROME1.983e-6248.68Ras-like GTP-binding protein Rho1 OS=Drosophila me... [more]
sp|O42825|RHO1_CANAL5.707e-6252.27GTP-binding protein RHO1 OS=Candida albicans (stra... [more]
sp|Q6NUX8|RHOAA_DANRE1.779e-6149.47Rho-related GTP-binding protein RhoA-A OS=Danio re... [more]
sp|Q7T2E8|RHOAC_DANRE3.330e-6150.28Rho-related GTP-binding protein RhoA-C OS=Danio re... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q9XZG71.057e-6352.91Rho GTPase OS=Schistosoma mansoni OX=6183 GN=Rho1 ... [more]
A0A1I8CLR13.959e-6349.74Uncharacterized protein OS=Rhabditophanes sp. KR30... [more]
T1ITM74.002e-6350.79Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A132ADC27.748e-6351.89Ras-like protein GTP-binding protein Rho1-like pro... [more]
A0A3S2LK941.004e-6250.54Uncharacterized protein OS=Oryzias javanicus OX=12... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhoca1.067e-6249.47rho-related GTP-binding protein RhoA-D-like [Sourc... [more]
rhoaa1.215e-6249.47rho-related GTP-binding protein RhoA-A [Source:NCB... [more]
rhocb2.615e-6248.95rho-related GTP-binding protein RhoA-D [Source:NCB... [more]
rhocb2.762e-6248.95rho-related GTP-binding protein RhoA-D [Source:NCB... [more]
rhoab3.145e-6249.47rho-related GTP-binding protein RhoA-B [Source:NCB... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004439.14.663e-6349.47pep scaffold:Pmarinus_7.0:GL476335:1598569:1600956... [more]
ENSPMAT00000001838.13.013e-6250.28pep scaffold:Pmarinus_7.0:GL478831:173097:182385:-... [more]
ENSPMAT00000002754.18.533e-6047.78pep scaffold:Pmarinus_7.0:GL476453:253767:255265:1... [more]
ENSPMAT00000006108.17.498e-5458.59pep scaffold:Pmarinus_7.0:GL480344:135:8553:-1 gen... [more]
ENSPMAT00000008827.11.948e-5142.71pep scaffold:Pmarinus_7.0:GL480655:11470:16574:-1 ... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RHO11.687e-6453.59GTP-binding protein of the rho subfamily of Ras-li... [more]
RHO24.122e-5547.59Non-essential small GTPase of the Rho/Rac family o... [more]
CDC421.375e-4943.32Small rho-like GTPase; essential for establishment... [more]
RHO32.898e-4842.13Non-essential small GTPase of the Rho/Rac family o... [more]
RHO45.086e-4845.88Non-essential small GTPase; member of the Rho/Rac ... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO394654.680e-6249.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350191.056e-4945.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385361.236e-4945.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374728.837e-4843.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401562.721e-4042.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RHOB1.963e-6451.37ras homolog family member B [Source:HGNC Symbol;Ac... [more]
ENSORLT00000033387.14.139e-6249.47rho-related GTP-binding protein RhoA-B [Source:NCB... [more]
ENSORLT00000040023.14.139e-6249.47rho-related GTP-binding protein RhoA-B [Source:NCB... [more]
ENSORLT00000023517.27.746e-6248.95transforming protein RhoA [Source:NCBI gene;Acc:10... [more]
ENSORLT00000003418.21.940e-6148.95rho-related GTP-binding protein RhoA-C [Source:NCB... [more]
back to top
BLAST of Ras-like GTP-binding protein RHO vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068769.12.211e-134100.00SMESG000068769.1[more]
SMESG000022390.14.368e-6252.00SMESG000022390.1[more]
SMESG000001635.15.728e-6251.08SMESG000001635.1[more]
SMESG000024968.11.606e-5145.05SMESG000024968.1[more]
SMESG000005010.11.708e-4943.81SMESG000005010.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012446 ID=SMED30012446|Name=Ras-like GTP-binding protein RHO|organism=Schmidtea mediterranea sexual|type=transcript|length=1060bp
CTCAACTCAATATCGTTCTAATTTAAGTTTCACTAGATTATTCATTATAT
TTTAAACTAAACTGGAAGTTACGTAACATTTGGAAATATTTTAGAAATTT
AAATGATTAAAAAGAAATTGGTAATTATTGGAGACGGTGGAGCTGGAAAA
ACATCACTTTTGATGGTCTATAAAGACAACGAATTTCCAGAATATTATGT
TCCTACAGTATTTGAAACTTATGCCATTCCCGTTCAATGGAATAATAAAG
AAATATCTTTGGAATTATGGGACACGGCAGGGCAAGAAGATTACGACCGA
TTACGGCCGCTGTCTTACTCCAACGCTGACGTAGTGCTAATCTGCTATAA
TATCGACTCGAAGGATAGTATTATCAACGTGAAAGAGAAATGGGCACCTG
AAGCGAATCACTTTTGCAATGGAGCTCCGATTGTTTTGGTGGGCACTAAA
ATGGATCTTAGAAACCAAACGAATAATTCAGATCAATTCGTTAGTAGAAA
CGAAGGAAAATTGCTAGCTCAGCAAATCAAAGCTGGAGATTTTTTCGAAT
GTTCAGCAAAAGAAAATGCAAATGTCCAGGAGATATTCACAGCGGCGACG
AATTTGACAATGCCGAAATCAAAGAAGCCCCTAAATTGGTGTTGGATTTT
ATGAAGAGGAACAAACAGGTCAATAAATATGAAATTTATCCATATTTTAT
TGAAATTATCGATTTTTTCACTATTACCAATAAATAAAACTGTAGTTCTT
TTTGATCAGATTCCGGCAGTGTTTTATTGTTTTGGTTGAATTTTCACTTG
TGAATTGAAATTTGTTTTGTCGTTCAAGTATTTCTTGTTTTTATTTCAGA
TTTGTTTTGATTGGTTGAATATGACAATATCTTTAGTTTATTATTCGTGA
GTGAAACTGAGTGCATTGTACTGCTTACCGTGAATGAGATTTGATTGGAT
ATTTTTACGCGGCTCCATCGACGGGATTTTGTGTGGATTTGACACTATTT
TGTACAACTCGGTGTTTTACACAGTATTTTGAGAATAAAACGTTATTTGT
TAAAAAAAAA
back to top

protein sequence of SMED30012446-orf-1

>SMED30012446-orf-1 ID=SMED30012446-orf-1|Name=SMED30012446-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=184bp
MIKKKLVIIGDGGAGKTSLLMVYKDNEFPEYYVPTVFETYAIPVQWNNKE
ISLELWDTAGQEDYDRLRPLSYSNADVVLICYNIDSKDSIINVKEKWAPE
ANHFCNGAPIVLVGTKMDLRNQTNNSDQFVSRNEGKLLAQQIKAGDFFEC
SAKENANVQEIFTAATNLTMPKSKKPLNWCWIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR003578Small_GTPase_Rho
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 4..25
score: 45.49
coord: 106..119
score: 47.51
coord: 27..43
score: 28.0
coord: 147..169
score: 35.75
coord: 44..66
score: 44.03
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 6..172
e-value: 8.0E-87
score: 304.4
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 9..177
e-value: 0.0028
score: -1.5
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 5..172
e-value: 3.4E-21
score: 86.4
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 1..172
e-value: 2.3E-20
score: 83.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..181
e-value: 9.8E-60
score: 203.1
NoneNo IPR availablePANTHERPTHR24072RHO FAMILY GTPASEcoord: 3..174
NoneNo IPR availablePANTHERPTHR24072:SF302coord: 3..174
IPR001806Small GTPasePFAMPF00071Rascoord: 5..167
e-value: 1.6E-51
score: 174.1
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 2..163
e-value: 2.6E-33
score: 113.1
IPR003578Small GTPase RhoPROSITEPS51420RHOcoord: 1..169
score: 22.091
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 5..167