Conserved plasma membrane protein

Overview
NameConserved plasma membrane protein
Smed IDSMED30012431
Length (bp)1149
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Conserved plasma membrane protein (SMED30012431) t-SNE clustered cells

Violin plots show distribution of expression levels for Conserved plasma membrane protein (SMED30012431) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Conserved plasma membrane protein (SMED30012431) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Conserved plasma membrane protein (SMED30012431) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012431

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012431SMESG000042684.1 SmedASXL_005268SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30012431SMESG000042684.1 dd_Smed_v4_2904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012431SMESG000042684.1 dd_Smed_v4_2904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Conserved plasma membrane protein vs. TrEMBL
Match: V3ZTR5 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_235699 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.906e-27
Identity = 90/318 (28.30%), Postives = 166/318 (52.20%), Query Frame = 3
Query:   90 KIRTFSKLNKFELLVLIMGTIGLLFSMAVAIYNLANDSHKKSDVPVSENXXXXXXXXXXXXXXXXYLYRGIFEERSYELIIYVISAISLMFYIIINYATVMIDKKSENILISVRLGISLLIIPATAIIGSLLAYNYNIKGKLIFYTVGSVQMLQDCCKHLFIFQGLLQLDFQFELCMITLCICQTSKIGIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFVFGFIEPSXXXXXXXXXXXXXXXSHAEPILFPVTTVASVTFACCXXXXXXXXXXXVMSIVVIKNFGKGLKEKLINAGKAFNSIHTDDNDVNP 1043
            K R    + K E+L +++  + ++ +  ++IY +A  S   +D   +      ++ ++ + F I Y+  G+ +ER+YEL I +I+ + ++ Y ++N++  ++DK+    +   RL I  ++ P   +       +Y   G LIF T+G+   LQ  CK L++F  LL+LD Q  + M+ L +  T  + +  YI+L++G  FSI+W I G  + + EN +G   FF+   +EP+         +   +   AE +    T + S +  C +L+L  R+ L++ S++V +NFGKGLKEK I++       +      NP
Sbjct:   38 KARRIQDVEKTEILFVVLSCLSIIATAVLSIYKMATTSVTDTDFTFA------LLLLVNAGFCIFYVIHGVLKERAYELGILLIAVVGIVLYSVLNFS--LVDKRGPVKI--ARLVIVCVMSPPIMLFCVKYGLDYYRSGNLIFRTIGANATLQGICKTLYLFHDLLKLDLQLGISMVILILNSTVDVALDDYIILSVGGVFSIIWFIIGFFSSRNENTVGMVFFFLGSPVEPA--------YVLYKMVKSAEQV---DTNLKSASLTCGVLALGFRVILIIYSVLVWRNFGKGLKEKEISSKTTDYKSNQQATTENP 334          
BLAST of Conserved plasma membrane protein vs. TrEMBL
Match: A0A1S3JTC9 (uncharacterized protein LOC106175968 OS=Lingula unguis OX=7574 GN=LOC106175968 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 2.538e-27
Identity = 103/325 (31.69%), Postives = 167/325 (51.38%), Query Frame = 3
Query:   81 VVYKIRTFSKLNKFELLVLIMGTIGLLFSMAVAIYNLANDSHKKSDVPVSENXXXXXXXXXXXXXXXXYLYRGIFEERSYELIIYVISAISLMFYIIINYATVMID--KKSENILISV---RLGISLLIIPATAIIGSLLAYNYNIKGKLIFYTVGSVQMLQDCCKHLFIFQGLLQLDFQFELCMITLCICQTSKIGIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFVFGFIEPSXXXXXXXXXXXXXXXSHAEPILFPVTTVASVTFACCXXXXXXXXXXXVMSIVVIKNFGKGLKEKLINAGKAFNSIHTDDNDVN 1040
            V+ K RT+  L K E+   I+  I LL S+ VAIY+ A  +          +  F+++ I+   F   Y+  G+  ER YE  I+VI+ + ++ Y+  N+A    D     +++  +V   RL  +++++P    +G  ++Y Y   G LIF TVG+ + LQ+ CK LF  +  L+ D Q    M+ L +      G     VL IG  F+++W + G+  ++ EN+I ++IFF     EP YII+  Y    ++   + EP     T++ +VTF    L+L++RI LLV    V +N+G GLKEK+   G   + I  D  D  
Sbjct:   29 VLGKTRTWQDLEKKEIAFFIIAIISLLASLGVAIYSAATQT--------GHDFTFALLIIVNIGFCFLYVVEGVLRERPYETFIFVIANVIIIVYVCSNFAITYPDIANGKDDVRFTVKLVRLIFTVILVPLNVYLGLWVSYTYFQSGNLIFRTVGASEDLQNSCKTLFFTEAALKFDVQMASSMLILILKDGHTTGTLGICVLTIGFAFTVVWVLLGYFAVRFENKILTFIFFATSVFEPGYIIFKVYQAATDVAYENQEPD----TSIDAVTFVGAGLALIVRIILLVFCYKVYRNYGVGLKEKVY--GSPSSDIEDDPEDAT 339          
BLAST of Conserved plasma membrane protein vs. TrEMBL
Match: A0A1S3JH81 (uncharacterized protein LOC106173212 OS=Lingula unguis OX=7574 GN=LOC106173212 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.523e-23
Identity = 94/311 (30.23%), Postives = 156/311 (50.16%), Query Frame = 3
Query:   69 NAPIVVYKIRTFSKLNKFELLVLIMGTIGLLFSMAVAIYNLANDSHKKSDVPVSENXXXXXXXXXXXXXXXXYLYRGIFEERSYELIIYVISAISLMFYIIINYATVMID--KKSENILISV---RLGISLLIIPATAIIGSLLAYNYNIKGKLIFYTVGSVQMLQDCCKHLFIFQGLLQLDFQFELCMITLCICQTSKIGIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFVFGFIEPSXXXXXXXXXXXXXXXSHAEPILFPVTTVASVTFACCXXXXXXXXXXXVMSIVVIKNFGKGLKEKL 986
             A  V+ K RT+  L K E+   I+  I LL  +  AIY+    +          +  F+++ I+   F   Y+   +  ER YE  I+VI+ + ++ Y+  N+A    D     +++  +V   RL  +++++P    +G  + Y Y   G LI  TVG+ + LQ+ CK LF  +  L +D Q    M+ L +      G     VL IG  F++ W + G+  ++ EN+I ++IFF     EP YII+  Y    ++ + + EP     T++ +VTF    L+L++R+ LLV    V  N+G GLKEK+
Sbjct:   25 TAETVLGKTRTWQDLEKKEIAFFIIAVISLLALLGFAIYSAVTQT--------GHDFTFALLIIVNIGFCFLYVVGAVLGERPYETFIFVIANVIIIVYVCSNFAITYPDIANGKDDVRFTVKLVRLIFTVILVPLNIYLGLWVWYTYFQSGNLILRTVGASEALQNSCKTLFFTEAALDVDVQMASSMLLLILKDGHTTGTLWICVLTIGFAFTVAWSVLGYFAMRYENKILTFIFFATSVFEPGYIIFKVYQAATDVADENQEPD----TSIDAVTFVGAGLALIVRVILLVFCYKVYSNYGVGLKEKV 323          
BLAST of Conserved plasma membrane protein vs. TrEMBL
Match: A0A0B7AMB0 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF127908 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 3.060e-22
Identity = 77/242 (31.82%), Postives = 126/242 (52.07%), Query Frame = 3
Query:  294 RGIFEERSYELIIYVISAISLMFYIIINYATVMIDKKSENILISVRLGISLLIIPATAIIGSLLAYNYNIKGKLIFYTVGSVQMLQDCCKHLFIFQGLLQLDFQFELCMITLCICQTSKIGIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFVFGFIEPSXXXXXXXXXXXXXXXSHAEPILFPVTT--VASVTFACCXXXXXXXXXXXVMSIVVIKNFGKGLKEKLINAGKAFNS 1013
             G+  ER  EL I   + + +M Y+I+NYAT      S N +   RL I+    P   I+G ++A  Y++  +LIF TVG+ +MLQ   ++L +FQ  L+ D Q    MI L +     I +   I+L++G   +++W I G  T+ RE +IG+YIFF+F  +E      + Y   K    +H + I     +  +   T AC + ++ +R+ ++  + VV + FG GL++KL       NS
Sbjct:  121 EGVLRERPSELFILSFATVIIMVYLIVNYAT-----GSRNDVKLARLVIACFFCPVLFILGFVIACEYHMSKRLIFRTVGANEMLQVLYRNLLVFQDFLKFDLQLGGSMIILILTIAKDISLRDIIILSVGGFVTVVWFILGFFTMSREWKIGAYIFFLFSPVE------LAYVFYKIYDAAHYKDIPGNKDSDGLVDATIACGVGAVAVRLVVIFTAAVVFRKFGNGLRDKLKPPSSESNS 351          
BLAST of Conserved plasma membrane protein vs. TrEMBL
Match: A0A4Y2GT49 (Uncharacterized protein OS=Araneus ventricosus OX=182803 GN=AVEN_273881_1 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 6.198e-21
Identity = 92/300 (30.67%), Postives = 149/300 (49.67%), Query Frame = 3
Query:   90 KIRTFSKLNKFELLVLIMGTIGLLFSMAVAIYNLANDSHKKSDVPVSENXXXXXXXXXXXXXXXXYLYRGIFEERSYELIIYVISAISLMFYIIINYATVMIDKKSENILISVRLGISLLIIPATAIIGSLLAYNYNIKGKLIFYTVGSVQMLQDCCKHLFIFQGLLQLDFQFELCMITLCICQ-TSKIGIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFVFGFIEPSXXXXXXXXXXXXXXXSHAEPILFPVTTVASVTFACCXXXXXXXXXXXVMSI-VVIKNFGKGLKEK 983
            KIR F+     E   L +  I L  S+ + I  L  +   +SD   +      I+ ++  +F   Y+   IF ER  EL+++V+S I ++ Y I+NY           +   +RL +  ++ P   ++G L ++ Y     LIF TVG +  LQ+ C+  +I   LL+ D Q +L M+ L + +    + + Q ++LA GVP S+L+ + G + ++ ENR     F+V G  EP YIIY  + T+              V      TF C   +L+I + L+V ++  VI +FGKGLKEK
Sbjct:   37 KIRAFNTFTALEWTYLAVSLIALTASLGITISRLTEEKPSESDFTFA------ILLLLTIVFCFHYVTHAIFTERWDELMVFVVSNIIVLVYCIVNYI-----NSVRTLTKLIRLCLICVLGPFLIVVGVLQSFRYCRSNNLIFNTVGGISTLQESCRLFYICSSLLKFDLQLQLSMLILVMGKGVLDMSLTQKLILASGVPISVLFILIGFLGLRHENRALMIAFYVLGLFEPGYIIYKFHYTVTYEK---------DVDATYDATFVCGYFALVIWVLLIVSTVYFVIYHFGKGLKEK 316          
BLAST of Conserved plasma membrane protein vs. Ensembl Cavefish
Match: ENSAMXT00000015697.2 (uncharacterized LOC103022408 [Source:NCBI gene;Acc:103022408])

HSP 1 Score: 56.9954 bits (136), Expect = 1.179e-8
Identity = 45/165 (27.27%), Postives = 82/165 (49.70%), Query Frame = 3
Query:  285 YLYRGIFEERSYELIIYVISAISLMFYIIINYATVMIDKKSENILISVRLGISLLIIPATAIIGSLLAYNYNIKGKLIFYTVGSVQMLQDCCKHLFIFQ---GLLQLDFQFELCMITLCICQTSKIGIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFV 770
            Y+ RG+ +E   ELI++V+S I +M   + N++ +    +S + L+  R    L +     I G LL    N+   + F   G+++ LQ+     FI      ++  D Q +LC+  L +   + +  F  I+L IGV ++ L    G I + +E ++  +IFF+
Sbjct:   99 YITRGVLQENRQELIVFVLSVIVVMVRSVANFSVL----QSHDPLLMARFVCILCVGLLHVICGVLLIQTPNM---MAFRVGGALESLQE---QYFILNLCFSMVTFDLQAQLCLCILILTSGTSVSYFHTIILGIGVVWACLTAATGAIAVLKEVKLLVWIFFL 253          
BLAST of Conserved plasma membrane protein vs. Ensembl Cavefish
Match: ENSAMXT00000034728.1 (uncharacterized LOC103022408 [Source:NCBI gene;Acc:103022408])

HSP 1 Score: 56.6102 bits (135), Expect = 1.459e-8
Identity = 45/165 (27.27%), Postives = 82/165 (49.70%), Query Frame = 3
Query:  285 YLYRGIFEERSYELIIYVISAISLMFYIIINYATVMIDKKSENILISVRLGISLLIIPATAIIGSLLAYNYNIKGKLIFYTVGSVQMLQDCCKHLFIFQ---GLLQLDFQFELCMITLCICQTSKIGIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFV 770
            Y+ RG+ +E   ELI++V+S I +M   + N++ +    +S + L+  R    L +     I G LL    N+   + F   G+++ LQ+     FI      ++  D Q +LC+  L +   + +  F  I+L IGV ++ L    G I + +E ++  +IFF+
Sbjct:  104 YITRGVLQENRQELIVFVLSVIVVMVRSVANFSVL----QSHDPLLMARFVCILCVGLLHVICGVLLIQTPNM---MAFRVGGALESLQE---QYFILNLCFSMVTFDLQAQLCLCILILTSGTSVSYFHTIILGIGVVWACLTAATGAIAVLKEVKLLVWIFFL 258          
BLAST of Conserved plasma membrane protein vs. Ensembl Nematostella
Match: EDO43306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYY2])

HSP 1 Score: 92.8189 bits (229), Expect = 3.391e-21
Identity = 93/313 (29.71%), Postives = 154/313 (49.20%), Query Frame = 3
Query:   51 IMDDVHNAPIVVY--KIRTFSKLNKFELLVLIMGTIGLLFSMAVAIYNLANDSHKKSDVPVSENXXXXXXXXXXXXXXXXYLYRGIFEERSYELIIYVISAISLMFYIIINYATVMIDKKSENILISVRLGISLLIIPATAIIGSLLAYNYNIKGKLIFYTVGSVQMLQDCCKHLFIFQGLLQLDFQFELCMITLCICQTSKIGIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFVFGFIEPSXXXXXXXXXXXXXXXSHAEPILFPVTTVASVTFACCXXXXXXXXXXXVMSI-VVIKNFGKGLKE 980
            + D +H+A  V    KI+TF+ L K E L +I+ T  +LF++ + I  L N     +D   +      II  I ++F + Y   G+  ER +E+  Y+ +   L+ YI+++ A       S   +   R G+ +   P+    G  +   +   G L F TVG+   LQ   +   IF  LL+ D Q  + ++ L I  T+ + + + +V+ IGVP  ++W   G I ++RE     ++F  + F+EP Y+IY TY+ I N  +     ILF        TF       LI   L+++S+  V+ NFG+GL+E
Sbjct:   20 VSDPIHHATAVTAFGKIKTFAGLEKDEWLFVIISTNNILFAIGLTIERLVNLPQNSTDYTFA------IILFINTVFCLYYAIHGVLREREFEIYAYIAATAVLIIYIVLDLAL----NTSRPAVKWARFGLLVFFGPSNVYYGYKVVKGF---GYLEFKTVGAAVSLQKMYRLAGIFSVLLKFDLQLAVSLLVLVIQNTTSLSLQEKLVVGIGVPVQVIWAYLGWIIMRREILNLVWVFLPWSFLEPGYLIYRTYDIIANWKSQDNSNILF-------YTFFGAAALALIIRVLVLVSLRFVVNNFGQGLRE 312          
BLAST of Conserved plasma membrane protein vs. Planmine SMEST
Match: SMESG000042684.1 (SMESG000042684.1)

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 338/338 (100.00%), Postives = 338/338 (100.00%), Query Frame = 3
Query:   54 MDDVHNAPIVVYKIRTFSKLNKFELLVLIMGTIGLLFSMAVAIYNLANDSHKKSDVPVSENXXXXXXXXXXXXXXXXYLYRGIFEERSYELIIYVISAISLMFYIIINYATVMIDKKSENILISVRLGISLLIIPATAIIGSLLAYNYNIKGKLIFYTVGSVQMLQDCCKHLFIFQGLLQLDFQFELCMITLCICQTSKIGIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFVFGFIEPSXXXXXXXXXXXXXXXSHAEPILFPVTTVASVTFACCXXXXXXXXXXXVMSIVVIKNFGKGLKEKLINAGKAFNSIHTDDNDVNPLLSSSDQN 1067
            MDDVHNAPIVVYKIRTFSKLNKFELLVLIMGTIGLLFSMAVAIYNLANDSHKKSDVPVSENIIFSIIAIICSIFTISYLYRGIFEERSYELIIYVISAISLMFYIIINYATVMIDKKSENILISVRLGISLLIIPATAIIGSLLAYNYNIKGKLIFYTVGSVQMLQDCCKHLFIFQGLLQLDFQFELCMITLCICQTSKIGIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFVFGFIEPSYIIYITYNTIKNIINSHAEPILFPVTTVASVTFACCLLSLLIRITLLVMSIVVIKNFGKGLKEKLINAGKAFNSIHTDDNDVNPLLSSSDQN
Sbjct:    1 MDDVHNAPIVVYKIRTFSKLNKFELLVLIMGTIGLLFSMAVAIYNLANDSHKKSDVPVSENIIFSIIAIICSIFTISYLYRGIFEERSYELIIYVISAISLMFYIIINYATVMIDKKSENILISVRLGISLLIIPATAIIGSLLAYNYNIKGKLIFYTVGSVQMLQDCCKHLFIFQGLLQLDFQFELCMITLCICQTSKIGIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFVFGFIEPSYIIYITYNTIKNIINSHAEPILFPVTTVASVTFACCLLSLLIRITLLVMSIVVIKNFGKGLKEKLINAGKAFNSIHTDDNDVNPLLSSSDQN 338          
The following BLAST results are available for this feature:
BLAST of Conserved plasma membrane protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Conserved plasma membrane protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Conserved plasma membrane protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Conserved plasma membrane protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Conserved plasma membrane protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Conserved plasma membrane protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Conserved plasma membrane protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Conserved plasma membrane protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZTR51.906e-2728.30Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3JTC92.538e-2731.69uncharacterized protein LOC106175968 OS=Lingula un... [more]
A0A1S3JH811.523e-2330.23uncharacterized protein LOC106173212 OS=Lingula un... [more]
A0A0B7AMB03.060e-2231.82Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A4Y2GT496.198e-2130.67Uncharacterized protein OS=Araneus ventricosus OX=... [more]
back to top
BLAST of Conserved plasma membrane protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000015697.21.179e-827.27uncharacterized LOC103022408 [Source:NCBI gene;Acc... [more]
ENSAMXT00000034728.11.459e-827.27uncharacterized LOC103022408 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Conserved plasma membrane protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Conserved plasma membrane protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Conserved plasma membrane protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO433063.391e-2129.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Conserved plasma membrane protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Conserved plasma membrane protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000042684.10.000e+0100.00SMESG000042684.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012431 ID=SMED30012431|Name=Conserved plasma membrane protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1149bp
CTATATAAATCTTATATGAAATTTGTATAAAATTTGGAAAGTCACAGTTT
ATCATGGATGATGTTCATAATGCTCCTATTGTTGTTTATAAGATTCGAAC
ATTTTCAAAACTAAATAAATTTGAATTATTAGTGTTAATTATGGGTACAA
TTGGATTGTTATTTTCCATGGCAGTAGCAATATACAATTTAGCGAATGAT
TCTCATAAAAAGTCGGATGTACCTGTTAGTGAAAACATTATATTCTCTAT
TATCGCAATTATTTGTTCGATTTTCACTATTTCCTACTTGTATCGTGGAA
TATTTGAAGAACGTTCATATGAATTGATAATTTATGTAATCTCAGCAATT
TCATTAATGTTTTATATAATTATAAATTATGCTACAGTAATGATAGATAA
AAAAAGTGAAAATATATTGATATCGGTCAGACTTGGTATCTCTTTATTGA
TTATTCCGGCTACAGCAATCATTGGATCCCTGCTAGCATATAATTATAAT
ATTAAAGGGAAACTCATTTTTTATACTGTCGGCAGTGTTCAAATGTTGCA
GGATTGCTGCAAACATTTATTTATTTTCCAAGGATTATTACAATTGGATT
TCCAATTTGAATTGTGTATGATTACTCTATGTATTTGTCAAACTTCCAAG
ATCGGTATATTTCAATATATTGTTTTGGCAATTGGGGTTCCTTTCTCAAT
TCTCTGGAGGATTTATGGACATATTACAATCAAACGAGAAAATCGAATCG
GATCTTATATTTTTTTTGTTTTTGGATTTATCGAACCGAGTTACATTATC
TATATTACTTACAATACGATCAAGAATATCATCAATTCCCATGCGGAGCC
TATATTGTTTCCAGTTACTACAGTAGCGTCGGTAACGTTTGCATGCTGCC
TATTGTCTCTATTAATTCGTATTACTCTTCTGGTAATGAGTATTGTTGTA
ATAAAAAATTTCGGGAAAGGACTGAAAGAAAAATTGATAAACGCTGGAAA
GGCATTCAATTCTATACATACAGATGATAATGACGTGAATCCACTTTTGT
CCTCAAGTGATCAGAACTAAACAATGAAATCAATTAAAGATTTATTAAAA
GCATCAATATTTTGTCATAATAAATTTATTTAGTTTTTGTAAAAAAAAA
back to top

protein sequence of SMED30012431-orf-1

>SMED30012431-orf-1 ID=SMED30012431-orf-1|Name=SMED30012431-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=339bp
MDDVHNAPIVVYKIRTFSKLNKFELLVLIMGTIGLLFSMAVAIYNLANDS
HKKSDVPVSENIIFSIIAIICSIFTISYLYRGIFEERSYELIIYVISAIS
LMFYIIINYATVMIDKKSENILISVRLGISLLIIPATAIIGSLLAYNYNI
KGKLIFYTVGSVQMLQDCCKHLFIFQGLLQLDFQFELCMITLCICQTSKI
GIFQYIVLAIGVPFSILWRIYGHITIKRENRIGSYIFFVFGFIEPSYIIY
ITYNTIKNIINSHAEPILFPVTTVASVTFACCLLSLLIRITLLVMSIVVI
KNFGKGLKEKLINAGKAFNSIHTDDNDVNPLLSSSDQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR39299FAMILY NOT NAMEDcoord: 23..324
NoneNo IPR availableTMHMMTMhelixcoord: 246..268
NoneNo IPR availableTMHMMTMhelixcoord: 183..202
NoneNo IPR availableTMHMMTMhelixcoord: 37..59
NoneNo IPR availableTMHMMTMhelixcoord: 212..234
NoneNo IPR availableTMHMMTMhelixcoord: 140..162
NoneNo IPR availableTMHMMTMhelixcoord: 74..96
NoneNo IPR availableTMHMMTMhelixcoord: 103..125
NoneNo IPR availableTMHMMTMhelixcoord: 278..300