60S ribosomal protein L37a

Overview
Name60S ribosomal protein L37a
Smed IDSMED30012421
Length (bp)446
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L37a (SMED30012421) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L37a (SMED30012421) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L37a (SMED30012421) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L37a (SMED30012421) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012421

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012421SMESG000078736.1 SmedASXL_051908SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30012421SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012421SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012421SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012421SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012421SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012421SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012421SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012421SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012421SMESG000078736.1 dd_Smed_v4_140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012421SMESG000078736.1 Contig21767newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012421SMESG000078736.1 Contig21767uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012421SMESG000078736.1 Contig52012newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012421SMESG000078736.1 Contig52012uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012421SMESG000079772.1 SMESG000078736.1 SMESG000029693.1 Contig11241newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012421SMESG000079772.1 SMESG000078736.1 SMESG000029693.1 Contig11241uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30012421SMESG000078736.1 OX_Smed_1.0.09315ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30012421SMESG000078736.1 dd_Smed_v6_140_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30012421SMESG000078736.1 dd_Smed_v6_140_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L37a vs. Ensembl Human
Match: RPL37A (ribosomal protein L37a [Source:HGNC Symbol;Acc:HGNC:10348])

HSP 1 Score: 99.3673 bits (246), Expect = 1.943e-27
Identity = 47/63 (74.60%), Postives = 52/63 (82.54%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY CSFCGK  +KR+ VGIWHC  C K 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Human
Match: RPL37A (ribosomal protein L37a [Source:HGNC Symbol;Acc:HGNC:10348])

HSP 1 Score: 98.2117 bits (243), Expect = 3.295e-27
Identity = 47/63 (74.60%), Postives = 52/63 (82.54%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY CSFCGK  +KR+ VGIWHC  C K 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Human
Match: RPL37A (ribosomal protein L37a [Source:HGNC Symbol;Acc:HGNC:10348])

HSP 1 Score: 97.4413 bits (241), Expect = 4.644e-27
Identity = 47/63 (74.60%), Postives = 52/63 (82.54%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY CSFCGK  +KR+ VGIWHC  C K 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Human
Match: RPL37A (ribosomal protein L37a [Source:HGNC Symbol;Acc:HGNC:10348])

HSP 1 Score: 77.7962 bits (190), Expect = 2.172e-19
Identity = 37/44 (84.09%), Postives = 40/44 (90.91%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGK 238
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY CSFCGK
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGK 44          
BLAST of 60S ribosomal protein L37a vs. Ensembl Human
Match: RPL37A (ribosomal protein L37a [Source:HGNC Symbol;Acc:HGNC:10348])

HSP 1 Score: 57.7658 bits (138), Expect = 1.456e-11
Identity = 25/38 (65.79%), Postives = 28/38 (73.68%), Query Frame = 2
Query:  182 IKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            +KKIEI  HAKY CSFCGK  +KR+ VGIWHC  C K 
Sbjct:    2 VKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKT 39          
BLAST of 60S ribosomal protein L37a vs. Ensembl Celegans
Match: rpl-43 (60S ribosomal protein L37a [Source:UniProtKB/Swiss-Prot;Acc:Q9U2A8])

HSP 1 Score: 95.1301 bits (235), Expect = 2.374e-26
Identity = 44/63 (69.84%), Postives = 53/63 (84.13%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK  KK+E+  H++Y CSFCGK+A+KRK  GIW+C  C KV
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMAKKLEVAQHSRYTCSFCGKEAMKRKATGIWNCAKCHKV 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Celegans
Match: rpl-43 (60S ribosomal protein L37a [Source:UniProtKB/Swiss-Prot;Acc:Q9U2A8])

HSP 1 Score: 95.1301 bits (235), Expect = 2.374e-26
Identity = 44/63 (69.84%), Postives = 53/63 (84.13%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK  KK+E+  H++Y CSFCGK+A+KRK  GIW+C  C KV
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMAKKLEVAQHSRYTCSFCGKEAMKRKATGIWNCAKCHKV 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Celegans
Match: rpl-43 (60S ribosomal protein L37a [Source:UniProtKB/Swiss-Prot;Acc:Q9U2A8])

HSP 1 Score: 95.1301 bits (235), Expect = 2.374e-26
Identity = 44/63 (69.84%), Postives = 53/63 (84.13%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK  KK+E+  H++Y CSFCGK+A+KRK  GIW+C  C KV
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMAKKLEVAQHSRYTCSFCGKEAMKRKATGIWNCAKCHKV 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Fly
Match: RpL37A (gene:FBgn0261608 transcript:FBtr0079017)

HSP 1 Score: 96.6709 bits (239), Expect = 8.767e-27
Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KK+EI  H+KY CSFCGK ++KR  VGIW CK CK+ 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCKRT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Fly
Match: RpL37A (gene:FBgn0261608 transcript:FBtr0302570)

HSP 1 Score: 96.6709 bits (239), Expect = 8.767e-27
Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KK+EI  H+KY CSFCGK ++KR  VGIW CK CK+ 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCKRT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Fly
Match: RpL37A (gene:FBgn0261608 transcript:FBtr0079016)

HSP 1 Score: 96.6709 bits (239), Expect = 8.767e-27
Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KK+EI  H+KY CSFCGK ++KR  VGIW CK CK+ 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRAVVGIWSCKRCKRT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Zebrafish
Match: zgc:171772 (zgc:171772 [Source:ZFIN;Acc:ZDB-GENE-070928-31])

HSP 1 Score: 99.7525 bits (247), Expect = 6.938e-28
Identity = 48/63 (76.19%), Postives = 52/63 (82.54%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY CSFCGK  +KRK VGIWHC  C K 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRKAVGIWHCGSCMKT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Xenopus
Match: abhd3 (abhydrolase domain containing 3 [Source:Xenbase;Acc:XB-GENE-984642])

HSP 1 Score: 100.908 bits (250), Expect = 4.274e-28
Identity = 48/63 (76.19%), Postives = 53/63 (84.13%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY CSFCGK  +KRK VGIWHC  C K+
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRKAVGIWHCGSCMKI 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Xenopus
Match: gtf3c5 (general transcription factor IIIC subunit 5 [Source:Xenbase;Acc:XB-GENE-1012275])

HSP 1 Score: 83.5741 bits (205), Expect = 1.635e-21
Identity = 41/56 (73.21%), Postives = 46/56 (82.14%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWH 274
            MAKRTKKVGIVGKY T YG+S+RK +KKIEI  HAKY CSFCGK  +KRK +GI H
Sbjct:    1 MAKRTKKVGIVGKYWTWYGASLRKMVKKIEINQHAKYTCSFCGKTKMKRKAIGILH 56          
BLAST of 60S ribosomal protein L37a vs. Ensembl Mouse
Match: Rpl37a (ribosomal protein L37a [Source:MGI Symbol;Acc:MGI:98068])

HSP 1 Score: 99.3673 bits (246), Expect = 1.334e-27
Identity = 47/63 (74.60%), Postives = 52/63 (82.54%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY CSFCGK  +KR+ VGIWHC  C K 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Mouse
Match: Rpl37a (ribosomal protein L37a [Source:MGI Symbol;Acc:MGI:98068])

HSP 1 Score: 48.9062 bits (115), Expect = 2.262e-8
Identity = 21/33 (63.64%), Postives = 23/33 (69.70%), Query Frame = 2
Query:  197 IQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            I  HAKY CSFCGK  +KR+ VGIWHC  C K 
Sbjct:    2 ISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKT 34          
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Match: sp|Q751L1|RL43_ASHGO (60S ribosomal protein L43 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=RPL43 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 9.892e-28
Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGI GKYG RYGSS+R+ +KK+E+Q HA+YDCSFCGKKA+KR   GIW+C  CKK 
Sbjct:    1 MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGKKAVKRGAAGIWNCSSCKKT 63          
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Match: sp|P32046|RL37A_CHICK (60S ribosomal protein L37a OS=Gallus gallus OX=9031 GN=RPL37A PE=3 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 4.960e-27
Identity = 48/63 (76.19%), Postives = 52/63 (82.54%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY CSFCGK  +KRK VGIWHC  C K 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRKAVGIWHCGSCMKT 63          
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Match: sp|O61462|RL37A_CRYST (60S ribosomal protein L37a OS=Cryptochiton stelleri OX=6655 GN=RPL37A PE=3 SV=3)

HSP 1 Score: 99.7525 bits (247), Expect = 5.840e-27
Identity = 46/63 (73.02%), Postives = 54/63 (85.71%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KK+EI  H+KY C FCGK A+KR+ VGIW CK C+KV
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKTVKKMEITQHSKYTCQFCGKDAMKRQAVGIWGCKSCRKV 63          
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Match: sp|Q7SZB4|RL37A_XENLA (60S ribosomal protein L37a OS=Xenopus laevis OX=8355 GN=rpl37a PE=3 SV=3)

HSP 1 Score: 99.7525 bits (247), Expect = 6.235e-27
Identity = 47/63 (74.60%), Postives = 53/63 (84.13%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTR+G+S+RK +KKIEI  HAKY CSFCGK  +KRK VGIWHC  C K+
Sbjct:    1 MAKRTKKVGIVGKYGTRFGASLRKMVKKIEISQHAKYTCSFCGKTKMKRKAVGIWHCGSCMKI 63          
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Match: sp|Q90YT0|RL37A_ICTPU (60S ribosomal protein L37a OS=Ictalurus punctatus OX=7998 GN=rpl37a PE=3 SV=3)

HSP 1 Score: 99.3673 bits (246), Expect = 9.029e-27
Identity = 47/63 (74.60%), Postives = 52/63 (82.54%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY CSFCGK  +KR+ VGIWHC  C K 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKT 63          
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Match: A7RI41 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g226223 PE=3 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 4.270e-27
Identity = 50/63 (79.37%), Postives = 55/63 (87.30%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVG+ GKYGTRYG+S+RK IKKIEIQ H+KY C FCGK+ LKRKCVGIWHCKGC K 
Sbjct:    1 MAKRTKKVGVTGKYGTRYGASLRKMIKKIEIQQHSKYTCVFCGKETLKRKCVGIWHCKGCGKT 63          
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Match: A0A267F9T5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029688g2 PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 8.733e-27
Identity = 48/64 (75.00%), Postives = 56/64 (87.50%), Query Frame = 2
Query:  104 SMAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
             MAKRTKKVGIVGKY TRYG+S+RK +KKIEIQ H+KY CSFCGK AL+R+ VGIWHC+GC+K 
Sbjct:    1 EMAKRTKKVGIVGKYATRYGASLRKTVKKIEIQQHSKYTCSFCGKDALRRQAVGIWHCRGCRKT 64          
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Match: A0A267GFZ1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026016g1 PE=3 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.010e-26
Identity = 48/63 (76.19%), Postives = 56/63 (88.89%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKY TRYG+S+RK +KKIEIQ H+KY CSFCGK AL+R+ VGIWHC+GC+K 
Sbjct:    1 MAKRTKKVGIVGKYATRYGASLRKTVKKIEIQQHSKYTCSFCGKDALRRQAVGIWHCRGCRKT 63          
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Match: A0A0L0TB51 (60S ribosomal protein L37a OS=Allomyces macrogynus (strain ATCC 38327) OX=578462 GN=AMAG_05221 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.313e-26
Identity = 49/63 (77.78%), Postives = 55/63 (87.30%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+++RK IKK+EI  HAKY CSFCGK ++KR  VGIWHCKGCKK 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGATLRKQIKKMEITQHAKYTCSFCGKDSVKRTAVGIWHCKGCKKT 63          
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Match: A0A2B4SWG0 (60S ribosomal protein L37a OS=Stylophora pistillata OX=50429 GN=RPL37A PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.432e-26
Identity = 48/62 (77.42%), Postives = 56/62 (90.32%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKK 292
            MAKRTKKVG+VGKYGTRYG+S+RK +KK+EI  H+KY C FCGK+ALKR+CVGIWHCKGC K
Sbjct:    1 MAKRTKKVGVVGKYGTRYGASLRKMVKKMEITQHSKYTCVFCGKEALKRQCVGIWHCKGCGK 62          
BLAST of 60S ribosomal protein L37a vs. Ensembl Cavefish
Match: zgc:171772 (ribosomal protein L37a [Source:NCBI gene;Acc:103037274])

HSP 1 Score: 97.8265 bits (242), Expect = 3.744e-27
Identity = 46/63 (73.02%), Postives = 51/63 (80.95%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY C FCGK  +KR+ VGIWHC  C K 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCYFCGKTKMKRRAVGIWHCTSCMKT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000001.1 (pep scaffold:Pmarinus_7.0:GL476426:6020:9121:-1 gene:ENSPMAG00000000001.1 transcript:ENSPMAT00000000001.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 2.034e-28
Identity = 47/63 (74.60%), Postives = 52/63 (82.54%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY CSFCGK  +KR+ VGIWHC  C K 
Sbjct:    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Yeast
Match: RPL43B (Ribosomal 60S subunit protein L43B; homologous to mammalian ribosomal protein L37A, no bacterial homolog; RPL43B has a paralog, RPL43A, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003855])

HSP 1 Score: 97.4413 bits (241), Expect = 6.237e-28
Identity = 45/63 (71.43%), Postives = 51/63 (80.95%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGI GKYG RYGSS+R+ +KK+EIQ HA+YDCSFCGKK +KR   GIW C  CKK 
Sbjct:    1 MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGAAGIWTCSCCKKT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Yeast
Match: RPL43A (Ribosomal 60S subunit protein L43A; null mutation confers a dominant lethal phenotype; homologous to mammalian ribosomal protein L37A, no bacterial homolog; RPL43A has a paralog, RPL43B, that arose from the whole genome duplication [Source:SGD;Acc:S000006247])

HSP 1 Score: 97.4413 bits (241), Expect = 6.237e-28
Identity = 45/63 (71.43%), Postives = 51/63 (80.95%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVGI GKYG RYGSS+R+ +KK+EIQ HA+YDCSFCGKK +KR   GIW C  CKK 
Sbjct:    1 MAKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGAAGIWTCSCCKKT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Yeast
Match: OPI11 (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; largely overlaps verified gene RPL43A/YPR043W; deletion confers sensitivity to GSAO [Source:SGD;Acc:S000006248])

HSP 1 Score: 46.595 bits (109), Expect = 6.773e-8
Identity = 25/74 (33.78%), Postives = 41/74 (55.41%), Query Frame = -2
Query:   77 NNFLATFAVPNSDTLSF*CFLSTERTVIFSVRLNFNFLNIFSD*RTVSCSIFTDDANLLCSFGH*YYLNFVFEY 298
            +  L T   PN+ + S    L+TERT++ SV L+F  L++ S   T++ ++ T D NLL SF   +    + +Y
Sbjct:   40 DGLLTTGTSPNTSSTSLDGLLTTERTIVSSVLLDFQLLDLSSQRGTITDTVLTSDTNLLSSFSPVFKKEKISKY 113          
BLAST of 60S ribosomal protein L37a vs. Ensembl Nematostella
Match: EDO48962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI41])

HSP 1 Score: 106.301 bits (264), Expect = 5.905e-31
Identity = 50/63 (79.37%), Postives = 55/63 (87.30%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            MAKRTKKVG+ GKYGTRYG+S+RK IKKIEIQ H+KY C FCGK+ LKRKCVGIWHCKGC K 
Sbjct:    1 MAKRTKKVGVTGKYGTRYGASLRKMIKKIEIQQHSKYTCVFCGKETLKRKCVGIWHCKGCGKT 63          
BLAST of 60S ribosomal protein L37a vs. Ensembl Medaka
Match: zgc:171772 (ribosomal protein L37a [Source:NCBI gene;Acc:101161674])

HSP 1 Score: 98.2117 bits (243), Expect = 2.326e-27
Identity = 47/62 (75.81%), Postives = 52/62 (83.87%), Query Frame = 2
Query:  110 AKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKV 295
            AKRTKKVGIVGKYGTRYG+S+RK +KKIEI  HAKY CSFCGK  +KR+ VGIWHC  CKK 
Sbjct:    1 AKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCKKT 62          
BLAST of 60S ribosomal protein L37a vs. Planmine SMEST
Match: SMESG000078736.1 (SMESG000078736.1)

HSP 1 Score: 127.487 bits (319), Expect = 6.069e-39
Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 2
Query:  107 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKVXXXXXXXXXXXXXXXXXXXXXXXNEGR 376
            MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKVIAGGAYTHTTTAAVTARAHIRRVNEGR
Sbjct:    1 MAKRTKKVGIVGKYGTRYGSSIRKNIKKIEIQSHAKYDCSFCGKKALKRKCVGIWHCKGCKKVIAGGAYTHTTTAAVTARAHIRRVNEGR 90          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L37a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL37A1.943e-2774.60ribosomal protein L37a [Source:HGNC Symbol;Acc:HGN... [more]
RPL37A3.295e-2774.60ribosomal protein L37a [Source:HGNC Symbol;Acc:HGN... [more]
RPL37A4.644e-2774.60ribosomal protein L37a [Source:HGNC Symbol;Acc:HGN... [more]
RPL37A2.172e-1984.09ribosomal protein L37a [Source:HGNC Symbol;Acc:HGN... [more]
RPL37A1.456e-1165.79ribosomal protein L37a [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpl-432.374e-2669.8460S ribosomal protein L37a [Source:UniProtKB/Swis... [more]
rpl-432.374e-2669.8460S ribosomal protein L37a [Source:UniProtKB/Swis... [more]
rpl-432.374e-2669.8460S ribosomal protein L37a [Source:UniProtKB/Swis... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RpL37A8.767e-2771.43gene:FBgn0261608 transcript:FBtr0079017[more]
RpL37A8.767e-2771.43gene:FBgn0261608 transcript:FBtr0302570[more]
RpL37A8.767e-2771.43gene:FBgn0261608 transcript:FBtr0079016[more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1717726.938e-2876.19zgc:171772 [Source:ZFIN;Acc:ZDB-GENE-070928-31][more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
abhd34.274e-2876.19abhydrolase domain containing 3 [Source:Xenbase;Ac... [more]
gtf3c51.635e-2173.21general transcription factor IIIC subunit 5 [Sourc... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Rpl37a1.334e-2774.60ribosomal protein L37a [Source:MGI Symbol;Acc:MGI:... [more]
Rpl37a2.262e-863.64ribosomal protein L37a [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q751L1|RL43_ASHGO9.892e-2871.4360S ribosomal protein L43 OS=Ashbya gossypii (stra... [more]
sp|P32046|RL37A_CHICK4.960e-2776.1960S ribosomal protein L37a OS=Gallus gallus OX=903... [more]
sp|O61462|RL37A_CRYST5.840e-2773.0260S ribosomal protein L37a OS=Cryptochiton steller... [more]
sp|Q7SZB4|RL37A_XENLA6.235e-2774.6060S ribosomal protein L37a OS=Xenopus laevis OX=83... [more]
sp|Q90YT0|RL37A_ICTPU9.029e-2774.6060S ribosomal protein L37a OS=Ictalurus punctatus ... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7RI414.270e-2779.37Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A267F9T58.733e-2775.00Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GFZ11.010e-2676.19Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0L0TB511.313e-2677.7860S ribosomal protein L37a OS=Allomyces macrogynus... [more]
A0A2B4SWG01.432e-2677.4260S ribosomal protein L37a OS=Stylophora pistillat... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1717723.744e-2773.02ribosomal protein L37a [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000001.12.034e-2874.60pep scaffold:Pmarinus_7.0:GL476426:6020:9121:-1 ge... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RPL43B6.237e-2871.43Ribosomal 60S subunit protein L43B; homologous to ... [more]
RPL43A6.237e-2871.43Ribosomal 60S subunit protein L43A; null mutation ... [more]
OPI116.773e-833.78Dubious open reading frame; unlikely to encode a f... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489625.905e-3179.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1717722.326e-2775.81ribosomal protein L37a [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of 60S ribosomal protein L37a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000078736.16.069e-39100.00SMESG000078736.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012421 ID=SMED30012421|Name=60S ribosomal protein L37a|organism=Schmidtea mediterranea sexual|type=transcript|length=446bp
AAAAGTTTTGGTAAAATAAAACTATTTTAGAAATATTTATTTTAATTATA
AAATTGTTGTTTAAATTTACTATTATATATTCAAATACAAAATTCAAATA
ATATCAATGGCCAAACGAACAAAGAAGGTTGGCATCGTCGGTAAATATGG
AACAAGATACGGTTCTTCAATCAGAAAAAATATTAAGAAAATTGAAATTC
AATCGCACGCTAAATATGACTGTTCTTTCTGTGGAAAGAAAGCATTAAAA
AGAAAGTGTGTCGGAATTTGGCACTGCAAAGGTTGCAAGAAAGTTATTGC
TGGAGGTGCTTATACTCACACCACCACAGCAGCAGTTACTGCTCGTGCAC
ATATTAGACGTGTTAACGAAGGCCGTTAATTTTTAAATAATAAATTTTGG
AGTAATGAAAAAAAAAAAAAAAAAANNNNATATTCCTGGAGTCTCG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR002674Ribosomal_L37ae
IPR011331Ribosomal_L37ae/L37e
IPR011332Ribosomal_zn-bd
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
GO:0005634nucleus
GO:0005925focal adhesion
GO:0022625cytosolic large ribosomal subunit
GO:0030529intracellular ribonucleoprotein complex
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
GO:0003723RNA binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002674Ribosomal protein L37aePFAMPF01780Ribosomal_L37aecoord: 4..88
e-value: 5.4E-39
score: 132.2
IPR002674Ribosomal protein L37aeTIGRFAMTIGR00280TIGR00280coord: 1..89
e-value: 1.8E-35
score: 119.1
IPR011331Ribosomal protein L37ae/L37eGENE3DG3DSA:2.20.25.30coord: 1..90
e-value: 5.1E-42
score: 144.0
IPR011332Zinc-binding ribosomal proteinSUPERFAMILYSSF57829Zn-binding ribosomal proteinscoord: 10..80