Non-specific serine/threonine protein kinase

Overview
NameNon-specific serine/threonine protein kinase
Smed IDSMED30012419
Length (bp)2220
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Non-specific serine/threonine protein kinase (SMED30012419) t-SNE clustered cells

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30012419) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Non-specific serine/threonine protein kinase (SMED30012419) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30012419) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012419

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 Contig37128uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 Contig37128newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30012419SMESG000069962.1 SMESG000069953.1 SMESG000069952.1 dd_Smed_v4_3244_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30012419SMESG000069952.1 dd_Smed_v4_6414_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012419SMESG000069952.1 dd_Smed_v4_6414_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 107.071 bits (266), Expect = 2.338e-25
Identity = 57/152 (37.50%), Postives = 88/152 (57.89%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIE 2104
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EMI G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR SA  L++
Sbjct:   94 ECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQ 239          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK2 (p21 (RAC1) activated kinase 2 [Source:HGNC Symbol;Acc:HGNC:8591])

HSP 1 Score: 110.538 bits (275), Expect = 9.911e-25
Identity = 57/157 (36.31%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  E + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR SA  L++ P  +
Sbjct:  351 ECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLK 501          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 107.842 bits (268), Expect = 8.525e-24
Identity = 56/157 (35.67%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  +R SA  L++ P  +
Sbjct:  369 ECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK 519          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 107.457 bits (267), Expect = 9.983e-24
Identity = 56/157 (35.67%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  +R SA  L++ P  +
Sbjct:  370 ECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK 520          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: PAK3 (p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;Acc:HGNC:8592])

HSP 1 Score: 107.457 bits (267), Expect = 9.983e-24
Identity = 56/157 (35.67%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  +R SA  L++ P  +
Sbjct:  370 ECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK 520          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 97.8265 bits (242), Expect = 2.562e-22
Identity = 58/158 (36.71%), Postives = 82/158 (51.90%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYI-PYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +HR SI+HRDIKSDN++L      KL D G    I P   R          V GT ++M+PE+L  + Y   +DIW+ GI+A+EMI G  PY    PLKA  +I +  K +      +S EF  F+D CL  D  +R     L+  P  +
Sbjct:  102 ECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQIQPGSKR--------DTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLK 251          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 100.908 bits (250), Expect = 4.344e-22
Identity = 55/157 (35.03%), Postives = 86/157 (54.78%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            ++L+ +  +H R +IHRDIKSDNI+L  + + KL DFG    +  E R          + GT ++MAPE++  + Y   +D+W+ GI+A+EM+ G  PY N  PL+A  +I    K  +    +++  F +F+D  LE     R SA  L+  P  R
Sbjct:  348 EVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSPEQRK------RTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFLR 498          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pak-2 (Serine/threonine-protein kinase pak-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFU0])

HSP 1 Score: 100.138 bits (248), Expect = 7.373e-22
Identity = 62/207 (29.95%), Postives = 110/207 (53.14%), Query Frame = 2
Query: 1508 NVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFG----LSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIF 2116
            N++++F     + ++   +++ME GSL  ++   +         +S Q+L  +  +H R +IHRDIKSD+I+L  +   KL DFG    LS+ +P    ++          GT ++ A E++  EPY    DIW+FGI+ +EM+ G  P+ N  P +A   I+ + + +++    +S E +E +  C+  D +KR  A +L+  P F
Sbjct:  287 NIVRFFSSHLVDDELWVVMEFMEGGSLTDIVTATRMTEPQIAT-ISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDFGFCGQLSEEVPRRRSLV----------GTPYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEHEARFSRHAKVSVELSELLSHCIVKDVNKRWPAKDLLRHPFF 482          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pak-2 (Serine/threonine-protein kinase pak-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFU0])

HSP 1 Score: 100.138 bits (248), Expect = 7.553e-22
Identity = 62/207 (29.95%), Postives = 110/207 (53.14%), Query Frame = 2
Query: 1508 NVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFG----LSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIF 2116
            N++++F     + ++   +++ME GSL  ++   +         +S Q+L  +  +H R +IHRDIKSD+I+L  +   KL DFG    LS+ +P    ++          GT ++ A E++  EPY    DIW+FGI+ +EM+ G  P+ N  P +A   I+ + + +++    +S E +E +  C+  D +KR  A +L+  P F
Sbjct:  285 NIVRFFSSHLVDDELWVVMEFMEGGSLTDIVTATRMTEPQIAT-ISRQVLGALDFLHARKVIHRDIKSDSILLKRDGTVKLTDFGFCGQLSEEVPRRRSLV----------GTPYWTAAEVIAREPYDTRADIWSFGIMLIEMVEGEPPFFNDQPFQAMKRIRDEHEARFSRHAKVSVELSELLSHCIVKDVNKRWPAKDLLRHPFF 480          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pak-1 (Serine/threonine-protein kinase pak-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17850])

HSP 1 Score: 100.523 bits (249), Expect = 7.906e-22
Identity = 55/157 (35.03%), Postives = 86/157 (54.78%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            ++L+ +  +H R +IHRDIKSDNI+L  + + KL DFG    +  E R          + GT ++MAPE++  + Y   +D+W+ GI+A+EM+ G  PY N  PL+A  +I    K  +    +++  F +F+D  LE     R SA  L+  P  R
Sbjct:  397 EVLQALEFLHSRHVIHRDIKSDNILLGMDGSVKLTDFGFCAQLSPEQRK------RTTMVGTPYWMAPEVVTRKQYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRAIYLIATNGKPDFPGRDSMTLLFKDFVDSALEVQVENRWSASQLLTHPFLR 547          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak3 (gene:FBgn0044826 transcript:FBtr0083312)

HSP 1 Score: 103.99 bits (258), Expect = 9.004e-23
Identity = 80/265 (30.19%), Postives = 132/265 (49.81%), Query Frame = 2
Query: 1358 KIHNELSRGSYGQVIRCID-ENQKEFVLK--DPLNKSS---IHQDIMIQSRFRKAG--NVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRDFS 2128
            K   E+ +G+ G V    D +N+ +  +K  D  N+SS   I  +I +   F      N L  + LL    ++   ++YM+ G L  ++ E           +  + L  IS +H + IIHRDIKSDN++L  + + K+ DFG    I  +++        + + GT ++MAPE++  + Y   +DIW+ GI+A+EMI G  PY    PL+A  +I    +    S   +S    +F+D CL+ +  +R +AD L+  P   D S
Sbjct:  294 KTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILTEIRVLKDFNHKNLVNFLDAY-LLEPEDQLWVVMEYMDGGPLTDVVTETVMKERQIAC-VCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDEK-------RQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDCS 549          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak3 (gene:FBgn0044826 transcript:FBtr0305003)

HSP 1 Score: 103.99 bits (258), Expect = 9.004e-23
Identity = 80/265 (30.19%), Postives = 132/265 (49.81%), Query Frame = 2
Query: 1358 KIHNELSRGSYGQVIRCID-ENQKEFVLK--DPLNKSS---IHQDIMIQSRFRKAG--NVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRDFS 2128
            K   E+ +G+ G V    D +N+ +  +K  D  N+SS   I  +I +   F      N L  + LL    ++   ++YM+ G L  ++ E           +  + L  IS +H + IIHRDIKSDN++L  + + K+ DFG    I  +++        + + GT ++MAPE++  + Y   +DIW+ GI+A+EMI G  PY    PL+A  +I    +    S   +S    +F+D CL+ +  +R +AD L+  P   D S
Sbjct:  294 KTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILTEIRVLKDFNHKNLVNFLDAY-LLEPEDQLWVVMEYMDGGPLTDVVTETVMKERQIAC-VCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDEK-------RQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDCS 549          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak3 (gene:FBgn0044826 transcript:FBtr0330047)

HSP 1 Score: 103.99 bits (258), Expect = 9.175e-23
Identity = 80/265 (30.19%), Postives = 132/265 (49.81%), Query Frame = 2
Query: 1358 KIHNELSRGSYGQVIRCID-ENQKEFVLK--DPLNKSS---IHQDIMIQSRFRKAG--NVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRDFS 2128
            K   E+ +G+ G V    D +N+ +  +K  D  N+SS   I  +I +   F      N L  + LL    ++   ++YM+ G L  ++ E           +  + L  IS +H + IIHRDIKSDN++L  + + K+ DFG    I  +++        + + GT ++MAPE++  + Y   +DIW+ GI+A+EMI G  PY    PL+A  +I    +    S   +S    +F+D CL+ +  +R +AD L+  P   D S
Sbjct:  294 KTTQEVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILTEIRVLKDFNHKNLVNFLDAY-LLEPEDQLWVVMEYMDGGPLTDVVTETVMKERQIAC-VCRETLYAISFLHAKGIIHRDIKSDNVLLGMDGSVKVTDFGFCANIEGDEK-------RQTMVGTPYWMAPEVVTRKKYGKKVDIWSIGIMAIEMIEGQPPYLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPFLNDCS 549          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 102.449 bits (254), Expect = 3.418e-22
Identity = 56/157 (35.67%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            ++L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +D+W+ GI+A+EM+ G  PY N  PLKA  +I    K +      +S  F +F+D CLE +  +R SA +L++ P  +
Sbjct:  532 EVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQI------SPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLK 682          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 102.449 bits (254), Expect = 3.418e-22
Identity = 56/157 (35.67%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            ++L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +D+W+ GI+A+EM+ G  PY N  PLKA  +I    K +      +S  F +F+D CLE +  +R SA +L++ P  +
Sbjct:  532 EVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQI------SPEQSKRTTMVGTPYWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATNGKPEIKEKDKLSSAFQDFLDQCLEVEVDRRASALDLLKHPFLK 682          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak2b (p21 protein (Cdc42/Rac)-activated kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-3759])

HSP 1 Score: 107.071 bits (266), Expect = 9.683e-24
Identity = 55/157 (35.03%), Postives = 88/157 (56.05%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  SP+ +S  F +F+  CLE D  KR  +  L++ P  +
Sbjct:  364 ECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPEKLSPIFRDFLGRCLEMDVEKRGGSKELLQHPFLK 514          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak2b (p21 protein (Cdc42/Rac)-activated kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-3759])

HSP 1 Score: 107.071 bits (266), Expect = 9.683e-24
Identity = 55/157 (35.03%), Postives = 88/157 (56.05%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  SP+ +S  F +F+  CLE D  KR  +  L++ P  +
Sbjct:  364 ECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPEKLSPIFRDFLGRCLEMDVEKRGGSKELLQHPFLK 514          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 106.686 bits (265), Expect = 1.089e-23
Identity = 54/157 (34.39%), Postives = 88/157 (56.05%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR     L++ P  +
Sbjct:  345 ECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLK 495          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 106.686 bits (265), Expect = 1.091e-23
Identity = 54/157 (34.39%), Postives = 88/157 (56.05%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR     L++ P  +
Sbjct:  344 ECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLK 494          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 106.686 bits (265), Expect = 1.091e-23
Identity = 54/157 (34.39%), Postives = 88/157 (56.05%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR     L++ P  +
Sbjct:  344 ECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLK 494          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 109.768 bits (273), Expect = 8.025e-25
Identity = 57/157 (36.31%), Postives = 87/157 (55.41%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  +   KL DFG    I       P +N    + GT ++MAPE++  + Y   +D+W+ GI+A+EM+ G  PY N  PL+A  +I      +   P+  S  F +F+  CLE D  KR SA +L++ P  +
Sbjct:  267 ECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQIS------PEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPQLQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLLQHPFLK 417          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 108.997 bits (271), Expect = 1.516e-24
Identity = 57/157 (36.31%), Postives = 87/157 (55.41%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  +   KL DFG    I       P +N    + GT ++MAPE++  + Y   +D+W+ GI+A+EM+ G  PY N  PL+A  +I      +   P+  S  F +F+  CLE D  KR SA +L++ P  +
Sbjct:  282 ECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQI------SPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPQLQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLLQHPFLK 432          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 109.383 bits (272), Expect = 1.680e-24
Identity = 57/157 (36.31%), Postives = 87/157 (55.41%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  +   KL DFG    I       P +N    + GT ++MAPE++  + Y   +D+W+ GI+A+EM+ G  PY N  PL+A  +I      +   P+  S  F +F+  CLE D  KR SA +L++ P  +
Sbjct:  313 ECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQI------SPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPQLQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLLQHPFLK 463          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 109.383 bits (272), Expect = 1.974e-24
Identity = 57/157 (36.31%), Postives = 87/157 (55.41%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  +   KL DFG    I       P +N    + GT ++MAPE++  + Y   +D+W+ GI+A+EM+ G  PY N  PL+A  +I      +   P+  S  F +F+  CLE D  KR SA +L++ P  +
Sbjct:  348 ECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQI------SPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPQLQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLLQHPFLK 498          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 108.612 bits (270), Expect = 2.600e-24
Identity = 57/157 (36.31%), Postives = 87/157 (55.41%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  +   KL DFG    I       P +N    + GT ++MAPE++  + Y   +D+W+ GI+A+EM+ G  PY N  PL+A  +I      +   P+  S  F +F+  CLE D  KR SA +L++ P  +
Sbjct:  306 ECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQI------SPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPQLQEPEKKSPAFRDFLSRCLEMDVEKRGSARDLLQHPFLK 456          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak2 (p21 (RAC1) activated kinase 2 [Source:MGI Symbol;Acc:MGI:1339984])

HSP 1 Score: 110.538 bits (275), Expect = 6.564e-25
Identity = 57/157 (36.31%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  E + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR SA  L++ P  +
Sbjct:  351 ECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLK 501          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 108.227 bits (269), Expect = 4.668e-24
Identity = 56/157 (35.67%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  +R SA  L++ P  +
Sbjct:  370 ECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK 520          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 108.227 bits (269), Expect = 4.668e-24
Identity = 56/157 (35.67%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  +R SA  L++ P  +
Sbjct:  370 ECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK 520          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 108.227 bits (269), Expect = 4.668e-24
Identity = 56/157 (35.67%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  +R SA  L++ P  +
Sbjct:  370 ECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK 520          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 108.227 bits (269), Expect = 4.668e-24
Identity = 56/157 (35.67%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  +R SA  L++ P  +
Sbjct:  370 ECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLK 520          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q54PX0|Y4251_DICDI (Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284251 PE=3 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 3.130e-24
Identity = 78/268 (29.10%), Postives = 143/268 (53.36%), Query Frame = 2
Query: 1337 IYGMGNTKIHNELSRGSYGQVIRCIDENQKEFVL-----KDPLNKSSIHQ---DIMIQSRFRKAGNVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIF 2116
            I  +G   +  ++ RG++GQV + ++    EFV       + +++SS+     ++ I  + R   N++K   ++    ++   ++Y+E GSLR ++++   LSE   I   YQ+L+ ++ +H   +IHRDIK+ NI++  E   KL DFG++  I  E ++         V GT ++MAPE +     +++ DIW+ G   +E++TG  PY    P+ A   I   +   +  P +ISKEF ++     + D ++R +A  L++ PIF
Sbjct:   30 IVKIGEYTLGEKIGRGAFGQVFKGLNGKTGEFVAIKQIDSNKIDESSLQSVKGEVEILHKLRH-NNIVKVLGVVEVQAQLNFILEYVENGSLRDVIEKFGPLSEELCIIYLYQMLQGLAYLHSNKVIHRDIKASNILITKEGVIKLADFGVASQIDSESQL------RFSVVGTPYWMAPESIEISGCSSASDIWSLGSTMIELLTGNPPYYTLQPMAAMFRIVSDQHPPF--PTDISKEFLDYFQQSFKKDPTQRPTAQELLQHPIF 288          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q8CIN4|PAK2_MOUSE (Serine/threonine-protein kinase PAK 2 OS=Mus musculus OX=10090 GN=Pak2 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 4.591e-24
Identity = 57/157 (36.31%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  E + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR SA  L++ P  +
Sbjct:  351 ECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLK 501          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q29502|PAK2_RABIT (Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus OX=9986 GN=PAK2 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 4.675e-24
Identity = 57/157 (36.31%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  E + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR SA  L++ P  +
Sbjct:  351 ECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLK 501          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q13177|PAK2_HUMAN (Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3)

HSP 1 Score: 110.538 bits (275), Expect = 4.760e-24
Identity = 57/157 (36.31%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  E + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR SA  L++ P  +
Sbjct:  351 ECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLK 501          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q64303|PAK2_RAT (Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus OX=10116 GN=Pak2 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 4.846e-24
Identity = 57/157 (36.31%), Postives = 90/157 (57.32%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  E + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR SA  L++ P  +
Sbjct:  351 ECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLK 501          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: W7MA45 (STE/STE20/PAKA protein kinase OS=Gibberella moniliformis (strain M3125 / FGSC 7600) OX=334819 GN=FVEG_16276 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 2.755e-27
Identity = 74/215 (34.42%), Postives = 116/215 (53.95%), Query Frame = 2
Query: 1475 IMIQSRFRKAGNVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            +M  SR R   N L  F L N N ++   +++ME G+L  ++     +SE +   + ++  R +  +H ++IIHRDIKSDN++LD+  N K+ DFG         ++   K+    + GT ++MAPE++  + Y   +DIW+ GI+A+EMI    PY N  PLKA  +I      +   P+ +SKE   F+ +CL  D   R SAD L+     R
Sbjct:    2 VMKDSRHRNIVNFLDAF-LRNNNAELWVVMEFMEGGALTDVIDNNPSISEEQISTICHETCRGLQHLHSQNIIHRDIKSDNVLLDARGNVKITDFGFCA------KLTETKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPEKLSKELKAFLSVCLCVDVKSRASADELLAHDFLR 209          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A2C5ZVZ3 (Protein kinase domain-containing protein OS=Cordyceps sp. RAO-2017 OX=2004951 GN=CDD83_2657 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.219e-26
Identity = 83/245 (33.88%), Postives = 132/245 (53.88%), Query Frame = 2
Query: 1379 RGSYGQV-IRCID---ENQKEFVLKDPLNKSSIHQDIMIQSRFRKAGNVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLI 2101
            +GS  QV I+ +D   + +KE ++ + +        +M  SR R   N L  F L N N ++   ++YME G+L  ++     +SE +   + ++  R +  +H +SIIHRDIKSDN++LD+  N K+ DFG         ++   K+    + GT ++MAPE++  + Y   +DIW+ GI+A+EMI    PY N  PLKA  +I      +   P+ +SKE   F+ +CL  D   R SAD L+
Sbjct:  130 QGSRAQVAIKQMDLAHQPRKELIVNEIM--------VMKDSRHRNIVNFLDAF-LRNNNAELWVVMEYMEGGALTDVIDNNPSISEEQISTICHETCRGLQHLHSQSIIHRDIKSDNVLLDARGNVKITDFGFCA------KLTETKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPEKLSKELKAFLSVCLCVDIKSRASADELL 359          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A1Y1KCL4 (Protein kinase domain-containing protein (Fragment) OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.239e-25
Identity = 74/209 (35.41%), Postives = 113/209 (54.07%), Query Frame = 2
Query: 1475 IMIQSRFRKAGNVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLI 2101
            +M  SR R   N L  F L N N ++   ++YME G+L  ++     +SE +   +  +    +  +H +SIIHRDIKSDN++LD+  N K+ DFG         ++   K+    + GT ++MAPE++  + Y   +DIW+ GI+A+EMI    PY N  PLKA  +I      +   P+ +SKE   F+ +CL  D   R SAD L+
Sbjct:   64 VMKDSRHRNIVNFLDAF-LRNNNQELWVVMEYMEGGALTDVIDNNPSISEEQISTICNETCHGLQHLHSQSIIHRDIKSDNVLLDARGNVKITDFGFCA------KLTETKSKRATMVGTPYWMAPEVVKQKEYGPKVDIWSLGIMAIEMIESEPPYLNEEPLKALYLIATNGTPRLKKPEKLSKELKAFLSVCLCVDVKSRASADELL 265          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: U3JH52 (Protein kinase domain-containing protein OS=Ficedula albicollis OX=59894 GN=LOC101810521 PE=3 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.344e-25
Identity = 75/250 (30.00%), Postives = 130/250 (52.00%), Query Frame = 2
Query: 1373 LSRGSYGQVIRCIDENQKEFV------LKDPLNKSSIHQDIMIQSRFRKAGNVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIE 2104
            +  G++G+V R  D    E V      L+   +K  I  ++M+    R   N++ Y      + +    ++YM+ G+L  ++ +           +S + L+ +  +H   +IHRD+KS NI+L ++ + KL DFGLS       ++IP +N    + GT  +MAPE++  +PY   +DIW+FGIV +EM+   VPY N  P++A L+    +  K   P+ +S    +F+  CL+ D  +R SA  L++
Sbjct:    9 IGSGTFGEVCRAFDTATGEEVAIKKTNLQGLTSKEVIINELMVMKNNRNL-NLVNYLDSYLVDNQFWLVMEYMDGGTLSDVISKTHMTEGEIAA-VSRECLQGLDFLHSNLVIHRDVKSCNILLRTDGSVKLADFGLSA------QLIPEQNQRCSMTGTSGWMAPEVVTGQPYGPKVDIWSFGIVGIEMVEREVPYWNQTPVRAQLLTATGETPKLRQPKLLSPLLRDFLSCCLQTDEERRWSAKELLQ 250          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A177WFK1 (Non-specific serine/threonine protein kinase OS=Batrachochytrium dendrobatidis (strain JEL423) OX=403673 GN=BDEG_22707 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.328e-25
Identity = 60/158 (37.97%), Postives = 96/158 (60.76%), Query Frame = 2
Query: 1646 YQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            ++ L+ +  +H+R+IIHRDIKSDN++LDS+ + K+ DFG      Y  ++   ++    + GT ++MAPE++  + Y N +D+W+ GI+A+EMI G  PY    PLKA  +I          P+ I+++F  F+  CLE D SKR + + L+E P  R
Sbjct:  444 FETLKGLDHLHKRNIIHRDIKSDNVLLDSQGHVKITDFG------YCAKLTNDRSKRATMVGTPYWMAPEVVKQKEYGNKVDVWSLGIMAIEMIEGEPPYLEEEPLKALYLIATNGTPTLKEPEKITQQFKHFLGKCLEVDVSKRSTTEQLLEHPFMR 595          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak2b (p21 protein (Cdc42/Rac)-activated kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-3759])

HSP 1 Score: 108.612 bits (270), Expect = 1.584e-24
Identity = 56/157 (35.67%), Postives = 89/157 (56.69%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  SP+ +S  F +F+  CLE D  KR S+  L++ P  +
Sbjct:  316 ECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPEKLSPIFRDFLARCLEMDVEKRGSSKELLQHPFLK 466          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 107.842 bits (268), Expect = 3.467e-24
Identity = 57/152 (37.50%), Postives = 88/152 (57.89%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIE 2104
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EMI G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR SA  L++
Sbjct:  350 ECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSSVFRDFLNRCLEMDVEKRGSAKELLQ 495          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 107.457 bits (267), Expect = 4.821e-24
Identity = 57/152 (37.50%), Postives = 88/152 (57.89%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIE 2104
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EMI G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR SA  L++
Sbjct:  324 ECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSSVFRDFLNRCLEMDVEKRGSAKELLQ 469          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 107.071 bits (266), Expect = 5.619e-24
Identity = 57/152 (37.50%), Postives = 88/152 (57.89%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIE 2104
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EMI G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR SA  L++
Sbjct:  331 ECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSSVFRDFLNRCLEMDVEKRGSAKELLQ 476          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 105.916 bits (263), Expect = 1.178e-23
Identity = 54/157 (34.39%), Postives = 88/157 (56.05%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR     L++ P  +
Sbjct:  323 ECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGGGKELLQHPFLK 473          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000169.1 (pep scaffold:Pmarinus_7.0:GL478331:850:46844:1 gene:ENSPMAG00000000147.1 transcript:ENSPMAT00000000169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 1.926e-20
Identity = 53/163 (32.52%), Postives = 89/163 (54.60%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLV-----DEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRD 2122
            ++LR +S +H   +IHRDIK  N++L      KL+DFG+S  +   DR +  +N   ++ GT ++MAPE++      D  Y    D+W+ G+ A+EM  G  P C+  P++A  +I +    +  S +  SK F  F + CL  +  +RL  + L++ P  R+
Sbjct:   96 EILRGLSHLHAHRVIHRDIKGQNVLLTENAEVKLVDFGVSAQL---DRTVGRRNT--FI-GTPYWMAPEVIACDENPDATYDYRSDLWSLGVTAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKS-KKWSKRFLSFAESCLVKNYLQRLPTEQLLKHPFIRE 251          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 92.4337 bits (228), Expect = 1.264e-19
Identity = 55/168 (32.74%), Postives = 88/168 (52.38%), Query Frame = 2
Query: 1652 LLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRDFSSQT*IFVLI 2155
            +LR ++ +H + +IHRDIKSD+I+L ++   KL DFG    +  E          K + GT ++MAPE++   PY   +D+W+ GI+ +EM+ G  PY N  PL+A   I+     K  + Q  S     F+D  L  D + R +A  L++ P  ++      I  L+
Sbjct:  522 VLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFGFCAQVSKE------VTRRKSLVGTPYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDNVPPKMKNIQKASPLLRGFLDQMLVRDPALRATALELLQHPFLQNAGPPACIVPLM 683          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 86.6557 bits (213), Expect = 5.691e-19
Identity = 48/154 (31.17%), Postives = 75/154 (48.70%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMP 2110
            Q+ R ++ +H   ++H D+K  N V+      KLIDFG ++ +           ++  V GT ++MAPE++    Y    D+W+ G    EM  G  P+ +  P+ A L I  +  I    PQ  SKE  EF++ C   D  KR S+  L+  P
Sbjct:  129 QMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRVALALSCHENGGLHS-VHGTAYWMAPEVINGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHIGIRNGIMPGLPQAFSKEAQEFVEQCFIRDKLKRPSSQELLSHP 281          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 85.5001 bits (210), Expect = 2.124e-17
Identity = 58/157 (36.94%), Postives = 84/157 (53.50%), Query Frame = 2
Query: 1646 YQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEM-PI 2113
            YQL+  + ++H   I+HRDIK+ NI L      K+ DFG+SK +    +M        YV GT +YM+PEL+  + Y    DIWA G V  E++T    +    PLK    I   KK      Q  SKE  E +  CL+ D+ +R +A++L+E+ PI
Sbjct:  142 YQLVSAVEQIHNFKILHRDIKTLNIFLTKSDLIKVGDFGISKILDSRSQM-----AESYV-GTPYYMSPELIRGDKYNTKSDIWAMGCVLYELLTLTRTFDATNPLKLCYEIIHGKKQVEIDDQ-YSKEIKEVVQKCLQQDAEQRPTAEDLLELSPI 291          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: stk39 (serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GENE-140106-194])

HSP 1 Score: 82.0333 bits (201), Expect = 5.939e-17
Identity = 49/165 (29.70%), Postives = 83/165 (50.30%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVD-EPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSP-------QNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            ++L  +  +HR   IHRD+K+ NI+L  +   ++ DFG+S ++     +   K V K   GT  +MAPE++     Y    DIW+FGI A+E+ +G  PY    P+K  ++  +       +        +   K F + I  CL+ D +KR +A  L++   F+
Sbjct:   13 EVLEGLDYLHRNGQIHRDVKAGNILLGEDGTIQIADFGVSAFLATGGDVTRNK-VRKTFVGTPCWMAPEVMEQVRGYDFKADIWSFGITAMELASGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDKEMVKKYGKSFRKLISQCLQKDPAKRPTAAELLKSKFFQ 176          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 98.9821 bits (245), Expect = 5.996e-22
Identity = 52/143 (36.36%), Postives = 82/143 (57.34%), Query Frame = 2
Query: 1673 MHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLI 2101
            +H + IIHRDIKSDNI+L+S+   K+ DFG          +   ++    + GT ++MAPE++  + Y   +D+W+ GI+ +EMI G  PY N  PLKA  +I      K   P+++SK+  +F+D CL+ +   R S   L+
Sbjct:  498 LHNKKIIHRDIKSDNILLNSQGLVKITDFGFCV------ELTEKRSKRATMVGTPYWMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLL 634          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 97.8265 bits (242), Expect = 1.749e-21
Identity = 53/148 (35.81%), Postives = 80/148 (54.05%), Query Frame = 2
Query: 1673 MHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIF 2116
            +H + IIHRDIKSDN++LD+    K+ DFG         R+   ++    + GT ++MAPE++    Y   ID+W+ GI+ +EM+ G  PY N  PLKA  +I      K   P+++S E   F+ +CL  D   R S + L+    F
Sbjct:  684 LHDKHIIHRDIKSDNVLLDTRARVKITDFGFCA------RLTDKRSKRATMVGTPYWMAPEVVKQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGFF 825          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 96.2857 bits (238), Expect = 6.630e-21
Identity = 57/145 (39.31%), Postives = 82/145 (56.55%), Query Frame = 2
Query: 1673 MHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFID--LCLEPDSSKRLSADNLI 2101
            +H + ++HRDIKSDNI+L  E + KL DFG    I      + LK       GT ++MAPE++  + Y   +DIW+ GI+ +EMI G  PY N  PL+A  +I      K   P+N+S    +F+D  LC+EP+   R SA  L+
Sbjct:  730 LHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQI----NELNLKRTTMV--GTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPED--RASATELL 866          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 94.7449 bits (234), Expect = 7.893e-21
Identity = 76/269 (28.25%), Postives = 129/269 (47.96%), Query Frame = 2
Query: 1373 LSRGSYGQVIRCIDENQKE-FVLK-------DPLNKSSIHQDIMIQSRFRKAGNVLKYFRLLN--YNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIR----LSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPY------CNCGPLKASLXXXXXXXXXYTSPQ---NISKEFTEFIDLCLEPDSSKRLSADNLIEMP 2110
            L  G+ G V +C  +N K+ F LK       DP  +  I +++     F K+  +++Y+ +     +  I  A++YM   SL +  K         + R    ++  +LR +S +H R +IHRDIK  NI+L+ +   KL DFG+S           + ++     GT FYMAPE +  +PY+ + D+W+ G+  +E+  G  P+       N  P++   +I          P+   + SK F  FID CL+ D+ +R S   +++ P
Sbjct:  220 LGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQFNKSF-KSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSGEA--------VNSLAMTFTGTSFYMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLKHP 479          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 95.1301 bits (235), Expect = 1.521e-20
Identity = 55/158 (34.81%), Postives = 94/158 (59.49%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNS-IDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            +LL  +  +H+ ++IHRDIK+ N+++ +E N KL DFG++  +        L+   + + GT ++MAPE++++  Y ++ +DIW+ GI   E+ TG  PYC+   L+A + +  K K      ++ S    EFI LCL+ D  +RLSAD+L++    R
Sbjct:  127 ELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV----NQTSLR--RQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRA-MQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIR 277          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 107.071 bits (266), Expect = 2.358e-24
Identity = 56/157 (35.67%), Postives = 86/157 (54.78%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDNI+L  +   KL DFG    I       P +N    + GT ++MAPE++  + Y   +D+W+ GI+A+EM+ G  PY N  PL+A  +I      +   P+ +S  F +F+   LE D  KR SA  L++ P  +
Sbjct:  328 ECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDFGFCATI------TPEQNKRSTMVGTPYWMAPEVVTRKQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELAHPEKLSPVFKDFLAQSLEMDVEKRSSARELLQHPFLK 478          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 101.293 bits (251), Expect = 8.239e-24
Identity = 84/275 (30.55%), Postives = 134/275 (48.73%), Query Frame = 2
Query: 1346 MGNTKIHNELSRGSYGQVIRCID-ENQKEFVLKD----PLNKS------SIHQDIMIQSRFRKAGNVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRDFSSQT 2137
            M N +    L  G++GQV  C D +  +E  +K      LN S      ++  +I     FR    +++Y+ +   +  I   ++Y+  GS+   +K+   L+ES T + S Q+L  I  +H   I+HRDIK  NI+ D   N KL DFG SK +    + I  K   + V GT ++MAPE++  E Y    D+W+ G   VEM+T   P+ +  P+ A+L     +  +   P ++S +  EF+   L  +S  R SAD L+      + S  T
Sbjct:    1 MNNWRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNEVKALEGEIEFMKAFRNE-RIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRL----QTIRSKTGFRSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPM-AALFKIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVTNSSMST 269          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 99.7525 bits (247), Expect = 7.851e-23
Identity = 77/251 (30.68%), Postives = 127/251 (50.60%), Query Frame = 2
Query: 1367 NELSRGSYGQVIRCIDENQKEFVLKDPLNKSSIHQDIMIQSRFRKAGN---VLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIR--LSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIE 2104
             +L  GSYG V + + +   + V    +   +  Q+I+ +    +  +   V+KY+     N  +   ++Y   GS+  L+K        E I+  L Y L + +  +H R  IHRDIK+ NI+L+SE +AKL DFG++  +   D M     V     GT F+MAPE++ +  Y    DIW+ GI A+EM  G  PY +  P++A  +I  K    +  P   S++F +F+  CL  +  +R +A  L++
Sbjct:   28 EKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQEIIKEISMMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTL-KGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQL--TDTMAKRNTVI----GTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQ 271          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 97.8265 bits (242), Expect = 2.385e-22
Identity = 57/162 (35.19%), Postives = 90/162 (55.56%), Query Frame = 2
Query: 1652 LLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRDFSSQT 2137
            +L+ ++ +H + +IHRDIKSD+I+L S    KL DFG    +  ED  +P +   K + GT ++MAPE++  +PY   +DIW+ GI+ +EM+ G  PY N  PL+A   ++  +     +P  IS     F+D  L  D   R +A  L+  P  R+  + T
Sbjct:  132 VLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDFGFCAQV-TED--MPRR---KSLVGTPYWMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAMRKLRDLEPPTSRNPIQISPRLQSFLDNALIRDPLYRATAFELLNHPFIRNVGNST 287          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO41242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z6])

HSP 1 Score: 95.9005 bits (237), Expect = 4.834e-22
Identity = 71/263 (27.00%), Postives = 127/263 (48.29%), Query Frame = 2
Query: 1373 LSRGSYGQVIRCIDEN------QKEFVLKDPLNKSSIHQDIMIQSRFRKAGNVLKYFRLLNYNGKICPAIKYMEKGXXXXXXXXXXXXXXXXTIRLSYQLLRQISEMHRRSIIHRDIKSDNIVLDSERN---AKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQ----NISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRD 2122
            +  GS+ +V RCI+         KE  L D  +K  I Q+I +    R   N++  +  +     +C  ++Y+  GSL   + ++ Y SE +   ++ QLL  +  +H R I+HRDIK DN++L    N    KL DFGL++ +P +  +I          G   ++APE +++EP   ++DIWA G++   ++ G  P+ +    +  L      + +YT P     N+S +  + +   +  D   R+SA   +  P  ++
Sbjct:   11 IGEGSFAKVFRCIERKTGLEFAAKELRLTDVEDKEKIEQEIAVWKDLRHE-NIVSLYSSIREGETVCLIMEYVAGGSLFDEVIQQTYYSEKQARLVTRQLLNALEYLHSRRIVHRDIKPDNLLLKRTGNNVTIKLADFGLAQALPNDTDVISCG-----ASGAPMFLAPETVLEEPIGRAVDIWACGVIFYLLLVGYPPFWSNSDEQLLL---SILRGQYTMPSPFWDNVSNDARDLVHKLIVVDPEARISAKEALSHPALKE 264          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: ENSORLT00000015480.2 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 107.457 bits (267), Expect = 4.128e-24
Identity = 55/157 (35.03%), Postives = 88/157 (56.05%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            ++L+ +  +H   +IHRDIKSDN++L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F  F+  CLE D  KR S   L++ P  +
Sbjct:  304 EVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFLK 454          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: pak2b (p21 (RAC1) activated kinase 2 [Source:NCBI gene;Acc:101167280])

HSP 1 Score: 106.301 bits (264), Expect = 5.384e-24
Identity = 54/157 (34.39%), Postives = 88/157 (56.05%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            + L+ +  +H   +IHRDIKSDN++L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  KR     L++ P  +
Sbjct:  250 ECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFRDFLNRCLEMDVEKRGGGKELLQHPFLK 400          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: PAK3 (serine/threonine-protein kinase PAK 3 [Source:NCBI gene;Acc:101162700])

HSP 1 Score: 107.842 bits (268), Expect = 6.234e-24
Identity = 56/153 (36.60%), Postives = 90/153 (58.82%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEM 2107
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P +N    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  +R SA +L+++
Sbjct:  381 ECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSSVFRDFLNRCLEMDVDRRGSAKDLLQV 527          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: PAK3 (serine/threonine-protein kinase PAK 3 [Source:NCBI gene;Acc:101162700])

HSP 1 Score: 107.457 bits (267), Expect = 6.235e-24
Identity = 56/152 (36.84%), Postives = 89/152 (58.55%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIE 2104
            + L+ +  +H   +IHRDIKSDNI+L  + + KL DFG    I       P +N    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F +F++ CLE D  +R SA +L++
Sbjct:  381 ECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQI------TPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSSVFRDFLNRCLEMDVDRRGSAKDLLQ 526          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: ENSORLT00000028689.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 107.071 bits (266), Expect = 7.257e-24
Identity = 55/157 (35.03%), Postives = 88/157 (56.05%), Query Frame = 2
Query: 1649 QLLRQISEMHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFR 2119
            ++L+ +  +H   +IHRDIKSDN++L  + + KL DFG    I       P ++    + GT ++MAPE++  + Y   +DIW+ GI+A+EM+ G  PY N  PL+A  +I      +  +P+ +S  F  F+  CLE D  KR S   L++ P  +
Sbjct:  341 EVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQI------TPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFKSFLSRCLEMDVEKRGSGKELLQHPFLK 491          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000069952.1 (SMESG000069952.1)

HSP 1 Score: 969.533 bits (2505), Expect = 0.000e+0
Identity = 481/512 (93.95%), Postives = 485/512 (94.73%), Query Frame = 2
Query:   47 MKINVAIIGSDQQKVAIDIDELNIIWDMKSELDKVFDGKEKFLKKYVNIFYKDLILNDYKFVKFYKIDQDDEISVGKLELFLGSELIVVELFIVGSLEETMYLTARKSDSLCKFKSILKRLFPDLTDVRIWSRTGRQLKDCQSVIDIDQSEDYFKVIVEIVENGNLEMKSFKECCEIHDKYFLSNYGWIDDFDDEPSRRTLKAVVKQIQTDSGIEDDTHSKFQEDLSSALRSLKHSKYLFCFNIGGWIFDICDETFHSILMQLEKWIKNFDILEFYGFFRISIHVALINYVEKNQKIQRDVYKSINSIVMEAFKHFLSIINDSFMGWRDLMKLFINKFLFFPIKDSETNTNPVKDESFHEYLYVTISESTYRVLFPRHCQTNSQAKSIVSAQTGIDTENLYFIELAKNEPPLEKDIFDLDKVNYIYNYEVIYGMGNTKIHNELSRGSYGQVIRCIDENQKEFVLKDPLNKSSIHQDIMIQSRFRKAGNVLKYFRLLNYNGKICPAIKYMEKG 1582
            MKINVAIIGSDQQKVAIDIDELNIIWD+KSELDKVFDGKEKFLKKYVNIFYKDLILNDYKFVKFYKIDQDDEISVGKLELFLGSELIVVELFIVG LEETMYLTARKSDSLCKFKSILKRLFPDLTDVRIWSRTGRQLKDC+SVIDID SEDYFK IVEIVENGNLEMKSFKECCEIHDKYFLSNYGWIDDFDDEPSRRTLKAVVKQIQTDSGIEDD HSKFQEDLSSALR LKHSKYLFCFNIGGWIFDICDETFHSILMQL+K                  HVALINYVEKNQKIQRDVYKSI  IVMEAF+HFLSIINDSFMGWRDLMKLFINKFLFFPIKDSETNTNP KDESFHEYLYVTISESTYRVLFPRHCQTNSQAKSIVSAQTGIDTENLYFIELAKNEPPLEKDIFDLDKVNYIYNYEVIYGMGNTKIHNELSRGSYGQVIRCIDENQKEFVLKDPLNKSSIHQDIMIQS FRKAGNVLKYFRLLNYNGKICPAIKYMEKG
Sbjct:    1 MKINVAIIGSDQQKVAIDIDELNIIWDIKSELDKVFDGKEKFLKKYVNIFYKDLILNDYKFVKFYKIDQDDEISVGKLELFLGSELIVVELFIVGFLEETMYLTARKSDSLCKFKSILKRLFPDLTDVRIWSRTGRQLKDCESVIDIDHSEDYFKFIVEIVENGNLEMKSFKECCEIHDKYFLSNYGWIDDFDDEPSRRTLKAVVKQIQTDSGIEDDAHSKFQEDLSSALRLLKHSKYLFCFNIGGWIFDICDETFHSILMQLKKR-----------------HVALINYVEKNQKIQRDVYKSIKIIVMEAFEHFLSIINDSFMGWRDLMKLFINKFLFFPIKDSETNTNPAKDESFHEYLYVTISESTYRVLFPRHCQTNSQAKSIVSAQTGIDTENLYFIELAKNEPPLEKDIFDLDKVNYIYNYEVIYGMGNTKIHNELSRGSYGQVIRCIDENQKEFVLKDPLNKSSIHQDIMIQSMFRKAGNVLKYFRLLNYNGKICPAIKYMEKG 495          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000069952.1 (SMESG000069952.1)

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 273/283 (96.47%), Postives = 276/283 (97.53%), Query Frame = 2
Query:   47 MKINVAIIGSDQQKVAIDIDELNIIWDMKSELDKVFDGKEKFLKKYVNIFYKDLILNDYKFVKFYKIDQDDEISVGKLELFLGSELIVVELFIVGSLEETMYLTARKSDSLCKFKSILKRLFPDLTDVRIWSRTGRQLKDCQSVIDIDQSEDYFKVIVEIVENGNLEMKSFKECCEIHDKYFLSNYGWIDDFDDEPSRRTLKAVVKQIQTDSGIEDDTHSKFQEDLSSALRSLKHSKYLFCFNIGGWIFDICDETFHSILMQLEKWIKNFDILEFYGFFRISI 895
            MKINVAIIGSDQQKVAIDIDELNIIWD+KSELDKVFDGKEKFLKKYVNIFYKDLILNDYKFVKFYKIDQDDEISVGKLELFLGSELIVVELFIVG LEETMYLTARKSDSLCKFKSILKRLFPDLTDVRIWSRTGRQLKDC+SVIDID SEDYFK IVEIVENGNLEMKSFKECCEIHDKYFLSNYGWIDDFDDEPSRRTLKAVVKQIQTDSGIEDD HSKFQEDLSSALR LKHSKYLFCFNIGGWIFDICDETFHSILMQL+K IKNFDI EFYGFFRISI
Sbjct:    1 MKINVAIIGSDQQKVAIDIDELNIIWDIKSELDKVFDGKEKFLKKYVNIFYKDLILNDYKFVKFYKIDQDDEISVGKLELFLGSELIVVELFIVGFLEETMYLTARKSDSLCKFKSILKRLFPDLTDVRIWSRTGRQLKDCESVIDIDHSEDYFKFIVEIVENGNLEMKSFKECCEIHDKYFLSNYGWIDDFDDEPSRRTLKAVVKQIQTDSGIEDDAHSKFQEDLSSALRLLKHSKYLFCFNIGGWIFDICDETFHSILMQLKKRIKNFDIQEFYGFFRISI 283          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000069952.1 (SMESG000069952.1)

HSP 1 Score: 509.22 bits (1310), Expect = 7.293e-178
Identity = 259/283 (91.52%), Postives = 262/283 (92.58%), Query Frame = 2
Query:   47 MKINVAIIGSDQQKVAIDIDELNIIWDMKSELDKVFDGKEKFLKKYVNIFYKDLILNDYKFVKFYKIDQDDEISVGKLELFLGSELIVVELFIVGSLEETMYLTARKSDSLCKFKSILKRLFPDLTDVRIWSRTGRQLKDCQSVIDIDQSEDYFKVIVEIVENGNLEMKSFKECCEIHDKYFLSNYGWIDDFDDEPSRRTLKAVVKQIQTDSGIEDDTHSKFQEDLSSALRSLKHSKYLFCFNIGGWIFDICDETFHSILMQLEKWIKNFDILEFYGFFRISI 895
            MKINVAIIGSDQQKVAIDIDELNIIWD+KSELDKVFDGKEKFLKKY              FVKFYKIDQDDEISVGKLELFLGSELIVVELFIVG LEETMYLTARKSDSLCKFKSILKRLFPDLTDVRIWSRTGRQLKDC+SVIDID SEDYFK IVEIVENGNLEMKSFKECCEIHDKYFLSNYGWIDDFDDEPSRRTLKAVVKQIQTDSGIEDD HSKFQEDLSSALR LKHSKYLFCFNIGGWIFDICDETFHSILMQL+K IKNFDI EFYGFFRISI
Sbjct:    1 MKINVAIIGSDQQKVAIDIDELNIIWDIKSELDKVFDGKEKFLKKY--------------FVKFYKIDQDDEISVGKLELFLGSELIVVELFIVGFLEETMYLTARKSDSLCKFKSILKRLFPDLTDVRIWSRTGRQLKDCESVIDIDHSEDYFKFIVEIVENGNLEMKSFKECCEIHDKYFLSNYGWIDDFDDEPSRRTLKAVVKQIQTDSGIEDDAHSKFQEDLSSALRLLKHSKYLFCFNIGGWIFDICDETFHSILMQLKKRIKNFDIQEFYGFFRISI 269          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000069952.1 (SMESG000069952.1)

HSP 1 Score: 419.083 bits (1076), Expect = 2.688e-143
Identity = 200/203 (98.52%), Postives = 201/203 (99.01%), Query Frame = 2
Query:  974 MEAFKHFLSIINDSFMGWRDLMKLFINKFLFFPIKDSETNTNPVKDESFHEYLYVTISESTYRVLFPRHCQTNSQAKSIVSAQTGIDTENLYFIELAKNEPPLEKDIFDLDKVNYIYNYEVIYGMGNTKIHNELSRGSYGQVIRCIDENQKEFVLKDPLNKSSIHQDIMIQSRFRKAGNVLKYFRLLNYNGKICPAIKYMEKG 1582
            MEAF+HFLSIINDSFMGWRDLMKLFINKFLFFPIKDSETNTNP KDESFHEYLYVTISESTYRVLFPRHCQTNSQAKSIVSAQTGIDTENLYFIELAKNEPPLEKDIFDLDKVNYIYNYEVIYGMGNTKIHNELSRGSYGQVIRCIDENQKEFVLKDPLNKSSIHQDIMIQS FRKAGNVLKYFRLLNYNGKICPAIKYMEKG
Sbjct:    1 MEAFEHFLSIINDSFMGWRDLMKLFINKFLFFPIKDSETNTNPAKDESFHEYLYVTISESTYRVLFPRHCQTNSQAKSIVSAQTGIDTENLYFIELAKNEPPLEKDIFDLDKVNYIYNYEVIYGMGNTKIHNELSRGSYGQVIRCIDENQKEFVLKDPLNKSSIHQDIMIQSMFRKAGNVLKYFRLLNYNGKICPAIKYMEKG 203          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000069953.1 (SMESG000069953.1)

HSP 1 Score: 303.523 bits (776), Expect = 2.161e-99
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 2
Query: 1673 MHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLXXXXXXXXXYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRDFSSQT 2137
            MHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLIIKKKKKIKYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRDFSSQT
Sbjct:    1 MHRRSIIHRDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYMAPELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLIIKKKKKIKYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRDFSSQT 155          
The following BLAST results are available for this feature:
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAK12.338e-2537.50p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK29.911e-2536.31p21 (RAC1) activated kinase 2 [Source:HGNC Symbol;... [more]
PAK38.525e-2435.67p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
PAK39.983e-2435.67p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
PAK39.983e-2435.67p21 (RAC1) activated kinase 3 [Source:HGNC Symbol;... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
max-22.562e-2236.71Serine/threonine-protein kinase max-2 [Source:Uni... [more]
pak-14.344e-2235.03Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
pak-27.373e-2229.95Serine/threonine-protein kinase pak-2 [Source:Uni... [more]
pak-27.553e-2229.95Serine/threonine-protein kinase pak-2 [Source:Uni... [more]
pak-17.906e-2235.03Serine/threonine-protein kinase pak-1 [Source:Uni... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak39.004e-2330.19gene:FBgn0044826 transcript:FBtr0083312[more]
Pak39.004e-2330.19gene:FBgn0044826 transcript:FBtr0305003[more]
Pak39.175e-2330.19gene:FBgn0044826 transcript:FBtr0330047[more]
Pak3.418e-2235.67gene:FBgn0267698 transcript:FBtr0334539[more]
Pak3.418e-2235.67gene:FBgn0267698 transcript:FBtr0081714[more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak2b9.683e-2435.03p21 protein (Cdc42/Rac)-activated kinase 2b [Sourc... [more]
pak2b9.683e-2435.03p21 protein (Cdc42/Rac)-activated kinase 2b [Sourc... [more]
pak2a1.089e-2334.39p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a1.091e-2334.39p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a1.091e-2334.39p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qsox28.025e-2536.31quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox21.516e-2436.31quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox21.680e-2436.31quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox21.974e-2436.31quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox22.600e-2436.31quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak26.564e-2536.31p21 (RAC1) activated kinase 2 [Source:MGI Symbol;A... [more]
Pak34.668e-2435.67p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak34.668e-2435.67p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak34.668e-2435.67p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
Pak34.668e-2435.67p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54PX0|Y4251_DICDI3.130e-2429.10Probable serine/threonine-protein kinase DDB_G0284... [more]
sp|Q8CIN4|PAK2_MOUSE4.591e-2436.31Serine/threonine-protein kinase PAK 2 OS=Mus muscu... [more]
sp|Q29502|PAK2_RABIT4.675e-2436.31Serine/threonine-protein kinase PAK 2 OS=Oryctolag... [more]
sp|Q13177|PAK2_HUMAN4.760e-2436.31Serine/threonine-protein kinase PAK 2 OS=Homo sapi... [more]
sp|Q64303|PAK2_RAT4.846e-2436.31Serine/threonine-protein kinase PAK 2 OS=Rattus no... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W7MA452.755e-2734.42STE/STE20/PAKA protein kinase OS=Gibberella monili... [more]
A0A2C5ZVZ33.219e-2633.88Protein kinase domain-containing protein OS=Cordyc... [more]
A0A1Y1KCL41.239e-2535.41Protein kinase domain-containing protein (Fragment... [more]
U3JH521.344e-2530.00Protein kinase domain-containing protein OS=Ficedu... [more]
A0A177WFK12.328e-2537.97Non-specific serine/threonine protein kinase OS=Ba... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak2b1.584e-2435.67p21 protein (Cdc42/Rac)-activated kinase 2b [Sourc... [more]
pak13.467e-2437.50p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
pak14.821e-2437.50p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
pak15.619e-2437.50p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
pak2a1.178e-2334.39p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000169.11.926e-2032.52pep scaffold:Pmarinus_7.0:GL478331:850:46844:1 gen... [more]
pak41.264e-1932.74p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
map3k195.691e-1931.17mitogen-activated protein kinase kinase kinase 19 ... [more]
NEK92.124e-1736.94NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
stk395.939e-1729.70serine threonine kinase 39 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SKM15.996e-2236.36Member of the PAK family of serine/threonine prote... [more]
CLA41.749e-2135.81Cdc42p-activated signal transducing kinase; member... [more]
STE206.630e-2139.31Cdc42p-activated signal transducing kinase; involv... [more]
MKK27.893e-2128.25MAPKK involved in the protein kinase C signaling p... [more]
KIC11.521e-2034.81Protein kinase of the PAK/Ste20 family, required f... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO336672.358e-2435.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414108.239e-2430.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428457.851e-2330.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458462.385e-2235.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412424.834e-2227.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015480.24.128e-2435.03serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
pak2b5.384e-2434.39p21 (RAC1) activated kinase 2 [Source:NCBI gene;Ac... [more]
PAK36.234e-2436.60serine/threonine-protein kinase PAK 3 [Source:NCBI... [more]
PAK36.235e-2436.84serine/threonine-protein kinase PAK 3 [Source:NCBI... [more]
ENSORLT00000028689.17.257e-2435.03serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069952.10.000e+093.95SMESG000069952.1[more]
SMESG000069952.10.000e+096.47SMESG000069952.1[more]
SMESG000069952.17.293e-17891.52SMESG000069952.1[more]
SMESG000069952.12.688e-14398.52SMESG000069952.1[more]
SMESG000069953.12.161e-99100.00SMESG000069953.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012419 ID=SMED30012419|Name=Non-specific serine/threonine protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2220bp
CCGATCTGAATTATTCTATTTATAGATCAGCCAATCGCCAAGCTCGATGA
AAATCAATGTTGCAATTATTGGAAGCGATCAGCAGAAAGTTGCCATTGAT
ATCGATGAACTAAATATAATATGGGATATGAAAAGCGAATTGGACAAAGT
TTTCGACGGAAAGGAAAAGTTTTTAAAAAAATATGTGAATATTTTTTATA
AAGATTTGATTCTTAATGATTACAAGTTTGTCAAGTTTTATAAAATTGAT
CAAGATGATGAAATCTCCGTTGGGAAATTGGAACTATTCTTAGGATCTGA
ATTGATTGTGGTGGAGTTGTTCATTGTCGGATCTCTGGAAGAGACAATGT
ATTTGACAGCCAGAAAGTCTGACTCGCTATGCAAGTTCAAATCAATTCTG
AAAAGATTGTTTCCAGATTTGACTGATGTGCGAATCTGGTCTCGAACCGG
GCGCCAGTTGAAAGACTGCCAAAGTGTAATTGACATCGATCAGAGTGAAG
ACTACTTTAAAGTTATTGTTGAAATAGTTGAAAATGGAAATCTTGAAATG
AAATCTTTCAAAGAATGCTGTGAAATCCATGACAAATATTTTTTATCCAA
CTATGGATGGATTGATGATTTTGATGACGAGCCATCTAGGAGAACCTTAA
AGGCTGTAGTTAAACAAATCCAAACCGATAGTGGAATAGAGGACGACACT
CATTCCAAATTCCAAGAGGATCTTTCAAGTGCATTAAGGTCACTAAAGCA
TTCCAAATATTTATTCTGCTTCAATATTGGCGGATGGATTTTTGATATTT
GTGATGAAACATTTCATTCAATTCTGATGCAGTTGGAGAAATGGATCAAA
AATTTTGATATCCTAGAATTTTACGGATTTTTTCGAATTTCAATACATGT
GGCGCTGATTAATTACGTCGAAAAAAACCAAAAAATCCAACGAGATGTGT
ACAAATCGATAAATAGCATTGTAATGGAGGCATTCAAGCATTTTCTATCA
ATTATAAACGACTCCTTCATGGGCTGGCGTGACTTAATGAAATTATTTAT
TAATAAGTTCTTGTTTTTTCCAATCAAAGACTCCGAAACGAATACAAATC
CAGTCAAAGATGAATCCTTTCATGAATACTTATACGTGACAATATCTGAA
TCTACGTACCGAGTTCTATTCCCGAGACATTGTCAAACAAATTCCCAAGC
AAAATCTATTGTTTCGGCCCAAACTGGGATAGATACAGAAAATTTATATT
TTATAGAACTCGCTAAAAACGAGCCACCCTTGGAAAAAGATATTTTTGAT
TTAGACAAAGTTAATTACATTTACAATTATGAAGTTATTTACGGAATGGG
AAATACTAAAATTCACAACGAATTGAGCCGAGGCAGTTACGGACAAGTAA
TAAGATGCATCGATGAAAATCAAAAAGAATTTGTGCTGAAAGATCCACTT
AACAAATCAAGCATTCATCAAGACATTATGATTCAGTCAAGGTTCCGCAA
AGCTGGGAACGTTCTTAAATATTTTCGATTACTAAATTACAACGGAAAAA
TATGCCCAGCAATAAAATACATGGAGAAAGGTTCTCTCAGATCTCTTCTG
AAAGAGGAGAAGTACCTCTCGGAAAGTGAAACCATCCGACTGTCCTATCA
GTTATTGAGACAAATAAGCGAAATGCATCGTCGCTCGATAATTCACCGCG
ACATAAAAAGTGACAATATTGTCCTTGACAGTGAGAGAAATGCAAAATTG
ATAGATTTCGGACTTTCTAAATATATTCCTTACGAAGATAGGATGATACC
TTTGAAAAATGTAAACAAATATGTTCCTGGAACAATGTTTTACATGGCGC
CGGAACTGTTAGTGGATGAACCGTACACGAATTCAATTGACATTTGGGCA
TTTGGCATAGTAGCCGTTGAGATGATCACCGGTTGTGTGCCTTATTGCAA
TTGCGGTCCCTTAAAGGCTAGTTTAATTATTAAAAAGAAAAAGAAAATAA
AATATACTTCCCCACAAAACATTTCGAAAGAATTTACAGAATTTATTGAC
TTGTGCCTAGAGCCGGATTCTTCAAAGAGATTGTCAGCGGATAACTTGAT
TGAGATGCCGATTTTCAGAGATTTTTCTTCTCAAACATGAATTTTTGTTT
TAATTTTTATCATGTAACCTTCATTTATTCTAAGAATATAATTTTATTAT
TTAATTAAATATATATTATT
back to top

protein sequence of SMED30012419-orf-1

>SMED30012419-orf-1 ID=SMED30012419-orf-1|Name=SMED30012419-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=698bp
MKINVAIIGSDQQKVAIDIDELNIIWDMKSELDKVFDGKEKFLKKYVNIF
YKDLILNDYKFVKFYKIDQDDEISVGKLELFLGSELIVVELFIVGSLEET
MYLTARKSDSLCKFKSILKRLFPDLTDVRIWSRTGRQLKDCQSVIDIDQS
EDYFKVIVEIVENGNLEMKSFKECCEIHDKYFLSNYGWIDDFDDEPSRRT
LKAVVKQIQTDSGIEDDTHSKFQEDLSSALRSLKHSKYLFCFNIGGWIFD
ICDETFHSILMQLEKWIKNFDILEFYGFFRISIHVALINYVEKNQKIQRD
VYKSINSIVMEAFKHFLSIINDSFMGWRDLMKLFINKFLFFPIKDSETNT
NPVKDESFHEYLYVTISESTYRVLFPRHCQTNSQAKSIVSAQTGIDTENL
YFIELAKNEPPLEKDIFDLDKVNYIYNYEVIYGMGNTKIHNELSRGSYGQ
VIRCIDENQKEFVLKDPLNKSSIHQDIMIQSRFRKAGNVLKYFRLLNYNG
KICPAIKYMEKGSLRSLLKEEKYLSESETIRLSYQLLRQISEMHRRSIIH
RDIKSDNIVLDSERNAKLIDFGLSKYIPYEDRMIPLKNVNKYVPGTMFYM
APELLVDEPYTNSIDIWAFGIVAVEMITGCVPYCNCGPLKASLIIKKKKK
IKYTSPQNISKEFTEFIDLCLEPDSSKRLSADNLIEMPIFRDFSSQT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0000140anterior region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:1903013response to differentiation-inducing factor 1
GO:0000281mitotic cytokinesis
GO:0006909phagocytosis
GO:0006935chemotaxis
GO:0007163establishment or maintenance of cell polarity
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0030010establishment of cell polarity
GO:0031036myosin II filament assembly
GO:0031152aggregation involved in sorocarp development
GO:0031156regulation of sorocarp development
GO:0032467positive regulation of cytokinesis
GO:0043327chemotaxis to cAMP
GO:0048870cell motility
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005515protein binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0045159myosin II binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0097204phagocytic cup base
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005938cell cortex
GO:0031254cell trailing edge
GO:0032154cleavage furrow